Patent application title: ACTIVATABLE CLOSTRIDIAL TOXINS
Inventors:
Lance E. Steward (Irvine, CA, US)
Joseph Francis (Aliso Viejo, CA, US)
Ester Fernandez-Salas (Fullerton, CA, US)
Marcella A. Gilmore (Santa Ana, CA, US)
Shengwen Li (Irvine, CA, US)
J. Oliver Dolly (Portmarnock, GB)
Kei Roger Aoki (Coto De Caza, CA, US)
IPC8 Class: AA61K3816FI
USPC Class:
514 12
Class name: Designated organic active ingredient containing (doai) peptide containing (e.g., protein, peptones, fibrinogen, etc.) doai 25 or more peptide repeating units in known peptide chain structure
Publication date: 2009-01-01
Patent application number: 20090005313
Inventors list |
Agents list |
Assignees list |
List by place |
Classification tree browser |
Top 100 Inventors |
Top 100 Agents |
Top 100 Assignees |
Usenet FAQ Index |
Documents |
Other FAQs |
Patent application title: ACTIVATABLE CLOSTRIDIAL TOXINS
Inventors:
Lance E. Steward
Marcella A. Gilmore
Joseph Francis
Kei Roger Aoki
Ester Fernandez-Salas
Shengwen Li
J. Oliver Dolly
Agents:
Dean G. Stathakis;Allergan, Inc. -T2-7H
Assignees:
Origin: IRVINE, CA US
IPC8 Class: AA61K3816FI
USPC Class:
514 12
Abstract:
Compositions comprising activatable recombinant neurotoxins and
polypeptides derived therefrom. The invention also comprises nucleic
acids encoding such polypeptides, and methods of making such polypeptides
and nucleic acids.Claims:
1. A single-chain polypeptide comprising:a) a first amino acid sequence
region comprisingi) a first domain comprising a binding element
comprising a growth factor able to preferentially interact with a growth
factor receptor under physiological conditions; andii) a second domain
comprising a translocation element comprising a Clostridial neurotoxin
heavy chain able to facilitate the transfer of said single-chain
polypeptide across a vesicular membrane; andb) a second amino acid
sequence region comprising a therapeutic element comprising aClostridial
neurotoxin light chain having biological activity when released into the
cytoplasm of said target cell;c) a third amino acid sequence region
comprising an exogenous protease cleavage site;wherein the growth factor
is a GDNF, a neurturin, a persephrin, an artemin; a TGFβ, a BMP, a
GDF, an activin, a VEGF, an IGF-1, an IGF-2, or an EGF.wherein said first
and second amino acid sequence regions are separated by said third amino
acid sequence region.
6. The polypeptide of claim 1, wherein said TGFβ comprises a TGFβ1, a TGFβ2, a TGFβ3 or a TGFβ4.
8. The polypeptide of claim 1, wherein said BMP comprises a BMP2, a BMP3, a BMP4, a BMP5, a BMP6, a BMP7, a BMP8 or a BMP10.
10. The polypeptide of claim 1, wherein said GDF comprises a GDF1, a GDF2, a GDF3, a GDF5, a GDF6, a GDF7, a GDF8, a GDF10, a GDF11 or a GDF15.
12. The polypeptide of claim 1, wherein said activin comprises an activin A, an activin B, an activin C, an activin E or an inhibin A.
13. The polypeptide of claim 1, wherein said translocation element comprises a Clostridium botulinum neurotoxin heavy chain.
14. The polypeptide of claim 13, wherein said Clostridium botulinum neurotoxin heavy chain translocation element is selected from the group consisting of a Clostridium botulinum serotype A neurotoxin heavy chain, a Clostridium botulinum serotype B neurotoxin heavy chain, a Clostridium botulinum serotype C1 neurotoxin heavy chain, a Clostridium botulinum serotype D neurotoxin heavy chain, a Clostridium botulinum serotype E neurotoxin heavy chain, a Clostridium botulinum serotype F neurotoxin heavy chain and a Clostridium botulinum serotype G neurotoxin heavy chain.
15. The polypeptide of claim 1, wherein said translocation element comprises a Clostridium tetani neurotoxin heavy chain.
16. The polypeptide of claim 1, wherein said therapeutic element comprises a Clostridium botulinum neurotoxin light chain.
17. The polypeptide of claim 16, wherein said Clostridium botulinum neurotoxin light chain therapeutic element is selected from the group consisting of a Clostridium botulinum serotype A neurotoxin light chain, a Clostridium botulinum serotype B neurotoxin light chain, a Clostridium botulinum serotype C1 neurotoxin light chain, a Clostridium botulinum serotype D neurotoxin light chain, a Clostridium botulinum serotype E neurotoxin light chain, a Clostridium botulinum serotype F neurotoxin light chain and a Clostridium botulinum serotype G neurotoxin light chain.
18. The polypeptide of claim 1, wherein said therapeutic element comprises a Clostridium tetani neurotoxin light chain.
19. The polypeptide of claim 1, wherein said exogenous protease cleavage site comprises a non-human enterokinase cleavage site, a tobacco etch virus protease cleavage site, a tobacco vein mottling virus protease cleavage site, a human rhinovirus 3C protease cleavage site, a subtilisin cleavage site, a hydroxylamine cleavage site, a SUMO/ULP-1 protease cleavage site, or a non-human Caspase 3 protease cleavage site.
20. The polypeptide of claim 1, wherein said polypeptide comprises a fourth amino acid sequence region comprising a target-binding portion of a binding tag.
21. A nucleotide sequence encoding a single-chain polypeptide according to claim 1.
22. The nucleotide sequence of claim 21, further comprising an expression vector.
23. A method of making a single-chain polypeptide comprising:a) inserting a nucleotide sequence of claim 22 into a suitable host cell;b) growing said host cell in culture; andc) permitting or inducing the host cell to express the single chain polypeptide encoded by said nucleotide sequence.
24. A method of purifying a single chain-polypeptide comprising:a) lysing a host cell containing a nucleotide sequence expressing a single-chain polypeptide to produce a cell lysate, said single-chain polypeptide according to claim 1;b) contacting said cell lysate with a target compound so as to form a specific binding complex capable of being immobilized comprising said binding tag and said target compound; andc) separating said binding complex from said cell lysate.
25. A method of activating a single-chain polypeptide, the method comprising the step of incubating an single-chain polypeptide according to claim 1 with an exogenous protease;wherein the exogenous protease cleaves the exogenous protease cleavage site; andwherein cleavage of the single-chain polypeptide by the exogenous protease converts the single-chain polypeptide from its single-chain polypeptide form into its di-chain form, thereby activating the single-chain polypeptide.
26. A pharmaceutical composition comprising a carrier and a single-chain polypeptide activated according to claim 25.
Description:
[0001]This application is a continuation and claims priority pursuant to
35 U.S.C. §120 to U.S. patent application Ser. No. 11/844,899, filed
Aug. 24, 2007, a continuation application that claims priority pursuant
to 35 U.S.C. § 120 to U.S. patent application Ser. No. 11/833,720,
filed Aug. 3, 2007, a continuation-in-part application that claims
priority pursuant to 35 U.S.C. §120 to U.S. patent application Ser.
No. 11/326,265, filed Jan. 5, 2006, a divisional application that claims
priority pursuant to 35 U.S.C. §120 to U.S. patent application Ser.
No. 09/648,692, filed Aug. 8, 2000, an application that claims priority
pursuant to pursuant to 35 U.S.C. §119(e) to U.S. Provisional Patent
Application Ser. No. 60/150,710 filed on Aug. 5, 1999; and claims
priority pursuant to 35 U.S.C. §365(c) to International Patent
Application Serial No. 2006/027969 filed on Jul. 18, 2006, which claims
priority pursuant to 35 U.S.C. §365(c) to International Patent
Application Serial No. 2006/009831, filed on Mar. 14, 2006, which claims
priority pursuant to 35 U.S.C. §119(e) to U.S. Provisional Patent
Application Ser. No. 60/662,151 filed on Mar. 15, 2005 and U.S.
Provisional Patent Application Ser. No. 60/661,953 filed on Mar. 15,
2005, each of which is hereby incorporated by reference in its entirety.
FIELD OF THE INVENTION
[0002]This invention concerns methods and compositions useful in the fields of neurobiology, molecular biology, and medicine, as well as methods for the production of potentially toxic therapeutic agents and derivatives thereof. The invention also concerns recombinant clostridial neurotoxins (particular botulinum neurotoxins), modified versions thereof, and methods of making such molecules, for use as therapeutic agents, transporter molecules, adducts, and the like.
BACKGROUND OF THE INVENTION
[0003]Neurotoxins, such as those obtained from Clostridium botulinum and Clostridium tetani, are highly potent and specific poisons of neural cells, and other cells when delivered within such cells for therapeutic purposes. These Gram positive bacteria express two related but distinct toxins types, each comprising two disulfide-linked amino acid chains: a light chain (L) of about 50 KDa and a heavy chain (H) of about 100 KDa, which are wholly responsible for the symptoms of these diseases. The holotoxin is synthesised in vivo as a single-chain, then nicked in a post-translational modification to form the active neurotoxin comprising the separate L and H chains.
[0004]The tetanus and botulinum toxins are among the most lethal substances known to man, having a lethal dose in humans of between 0.1 ng and 1 ng per kilogram of body weight. Tonello et al., Adv. Exp. Med. & Biol. 389:251-260 (1996). Both toxins function by inhibiting neurotransmitter release in affected neurons. The tetanus neurotoxin (TeNT) acts mainly in the central nervous system, while botulinum neurotoxin (BONT) acts at the neuromuscular junction and other cholinergic synapses in the peripheral nervous system; both act by inhibiting neurotransmitter release from the axon of the affected neuron into the synapse, resulting in paralysis.
[0005]The tetanus neurotoxin (TeNT) is known to exist in one immunologically distinct type; the botulinum neurotoxins (BONT) are known to occur in seven different immunogenic types, termed BoNT/A through BoNT/G. While all of these types are produced by isolates of C. botulinum, two other species, C. baratii and C. butyricum also produce toxins similar to /F and /E, respectively. See e.g., Coffield et al., The Site and Mechanism of Action of Botulinum Neurotoxin in Therapy with Botulinum Toxin 3-13 (Jankovic J. & Hallett M. eds. 1994), the disclosure of which is incorporated herein by reference.
[0006]Regardless of type, the molecular mechanism of intoxication appears to be similar. In the first step of the process, the toxin binds to the presynaptic membrane of the target neuron through a specific interaction between the heavy (H) chain and a cell surface receptor; the receptor is thought to be different for each type of botulinum toxin and for TeNT. Dolly et al., Seminars in Neuroscience 6:149-158 (1994), incorporated by reference herein. The carboxyl terminus of the heavy chain appears to be important for targeting of the toxin to the cell surface. Id.
[0007]In the second step, the toxin crosses the plasma membrane of the poisoned cell. The toxin is first engulfed by the cell through receptor-mediated endocytosis, and an endosome containing the toxin is formed. The toxin then escapes the endosome into the cytoplasm of the cell. This last step is thought to be mediated by the amino terminus of the H chain, which triggers a conformational change of the toxin in response to a pH of about 5.5 or lower. Endosomes are known to possess a proton pump which decreases intra endosomal pH. The conformational shift exposes hydrophobic residues in the toxin, which permits the toxin to embed itself in the endosomal membrane. The toxin then translocates through the endosomal membrane into the cytosol.
[0008]The last step of the mechanism of botulinum toxin activity appears to involve reduction of the disulfide bond joining the H and light (L) chain. The entire toxic activity of botulinum and tetanus toxins is contained in the L chain of the holotoxin; the L chain is a zinc (Zn++) endopeptidase which selectively cleaves proteins essential for recognition and docking of neurotransmitter-containing vesicles with the cytoplasmic surface of the plasma membrane, and fusion of the vesicles with the plasma membrane. TxNT, BoNT/B BoNT/D, BoNT/F, and BoNT/G cause degradation of synaptobrevin, also called vesicle-associated membrane protein (VAMP), a synaptosomal membrane protein. Most of the cytosolic domain of VAMP extending from the surface of the synaptic vesicle is removed as a result of any one of these cleavage events. Each toxin (except TeNT and BoNT/B) specifically cleaves a different bond.
[0009]BoNT/A and /E selectively cleave the plasma membrane-associated protein SNAP-25; this protein, which is also cleaved by BoNT/C1 (Foran et al., Biochem. 35:2630-2636 (1996)), is predominantly bound to and present on the cytosolic surface of the plasma membrane. BoNT/C cleaves syntaxin, an integral protein having most of its mass exposed to the cytosol. Syntaxin interacts with the calcium channels at presynaptic terminal active zones. See Tonello et al., Tetanus and Botulinum Neurotoxins in Intracellular Protein Catabolism 251-260 (Suzuki K. & Bond J. eds. 1996), the disclosure of which is incorporated by reference as part of this specification.
[0010]Both TeNT and BoNT are taken up at the neuromuscular junction. BoNT remains within peripheral neurons, and blocks release of the neurotransmitter acetylcholine from these cells. Through its receptor, TeNT enters vesicles that move in a retrograde manner along the axon to the soma, and is discharged into the intersynaptic space between motor neurons and the inhibitory neurons of the spinal cord. At this point, TeNT binds receptors of the inhibitory neurons, is again internalized, and the light chain enters the cytosol to block the release of the inhibitory neurotransmitters 4-aminobutyric acid (GABA) and glycine from these cells.
[0011]Because of its specifically localized effects, minute doses of BoNT have been used since 1981 as therapeutic agents in the treatment of patients suffering from dystonias, including strabismus (misalignment of the eye), bephlarospasm (involuntary eyelid closure) and hemifacial spasm. See e.g., Borodic et al, Pharmacology and Histology of the Therapeutic Application of Botulinum Toxin in Therapy with Botulinum Toxin 119-157 (Jankovic J. & Hallett eds. 1994), hereby incorporated by reference herein. Of the seven toxin types, BoNT/A is the most potent of the BoNTs, and the best characterized. Intramuscular injection of spastic tissue with small quantities of BoNT/A has also been used effectively to treat spasticity due to brain injury, spinal cord injury, stroke, multiple sclerosis and cerebral palsy. The extent of paralysis depends on both the dose and volume delivered to the target site.
[0012]Although the L chain is the moiety responsible for neural intoxication, it must be delivered to the neural cytoplasm in order to be toxic. Similarly, the single-chain holotoxin pro-forms exhibit relatively low toxicity until they are cleaved at one or more peptide bonds in an exposed loop region between their H and L chains to create the fully-active mature neurotoxins. As implied in the mechanism provided above, the H chain of each neurotoxin is essential for cell receptor binding and endocytosis, while both the L and the H chains (and an intact disufide bond) are required for translocation of the toxin into the cytoplasm. As indicated above, the L chain alone is responsible for the toxicity caused by inhibition of acetylcholine secretion.
[0013]Despite the clear therapeutic efficacy of clostridial neurotoxin preparations, industrial production of the toxin is difficult. Production of neurotoxoin from anaerobic Clostridium cultures is a cumbersome and time-consuming process including a multi-step purification protocol involving several protein precipitation steps and either prolonged and repeated crystallisation of the toxin or several stages of column chromatography. Significantly, the high toxicity of the product dictates that the procedure must be performed under strict containment (BL-3). During the fermentation process, the folded single-chain neurotoxins are activated by endogenous clostridial proteases through a process termed nicking. This involves the removal of approximately 10 amino acid residues from the single-chain to create the di-chain form in which the two chains remain covalently linked through the interchain disulfide bond.
[0014]The nicked neurotoxin is much more active than the unnicked form. The amount and precise location of nicking varies with the serotypes of the bacteria producing the toxin. The differences in single-chain neurotoxin activation and, hence, the yield of nicked toxin, are due to variations in the type and amounts of proteolytic activity produced by a given strain. For example, greater than 99% of C. botulinum type A single-chain neurotoxin is activated by the Hall A C. botulinum strain, whereas type B and E strains produce toxins with lower amounts of activation (0 to 75% depending upon the fermentation time). Thus, the high toxicity of the mature neurotoxin plays a major part in the commercial manufacture of neurotoxins as therapeutic agents.
[0015]The degree of activation of engineered clostridial toxins is, therefore, an important consideration for manufacture of these materials. It would be a major advantage if neurotoxins such as BoNT and TeNT could be expressed in high yield in rapidly-growing bacteria (such as heterologous E. coli cells) as relatively non-toxic single-chains (or single-chains having reduced toxic activity) which are safe, easy to isolate and simple to convert to the fully-active form.
[0016]With safety being a prime concern, previous work has concentrated on the expression in E. coli and purification of individual H and L chains of TeNT and BoNT; these isolated chains are, by themselves, non-toxic; see Li et al., Biochemistry 33:7014-7020 (1994); Zhou et al., Biochemistry 34:15175-15181 (1995), hereby incorporated by reference herein. Following the separate production of these peptide chains and under strictly controlled conditions the H and L subunits can be combined by oxidative disulphide linkage to form the neuroparalytic di-chains. Unfortunately, this strategy has several drawbacks.
[0017]Firstly, it is not practical to express and isolate large amounts of the individual chains; in particular, in the absence of the L chain the isolated H chain is quite insoluble in aqueous solution and is highly susceptible to proteolytic degradation. Secondly, the in vitro oxidation of the individually expressed and purified H and L chains to produce the active di-chain is very inefficient, and leads to low yields of active toxin and the production of many inactive incorrectly folded or oxidized forms. The purification of the correctly folded and oxidized H and L chain-containing toxin is difficult, as is its separation from these inactive forms and the unreacted separate H and L chains.
[0018]It would therefore be useful and advantageous to express clostridial neurotoxins as inactive (or less active) single-chain forms, to eliminate the need for the time-consuming and inefficient reconstitution of the constituent chains, to maintain solubility of the protein chains, to reduce protein misfolding and consequent susceptibility to protease attack, to improve toxin yield, and/or to provide a simple method for the purification of the toxin.
[0019]Additionally, it would be useful to engineer these toxins to provide single-chain, modified neurotoxin molecules having novel therapeutic properties and/or longer duration of action, or toxic or non-toxic forms for use as transport molecules capable of delivering a therapeutic moiety to nerve or other cell types. By expressing such proteins as a single-chain, the yield and purification of the engineered proteins would be vastly improved.
SUMMARY OF THE INVENTION
[0020]The present invention is directed to recombinant and isolated proteins comprising a functional binding domain, translocation domain, and therapeutic domain in which such proteins also include an amino acid sequence that is susceptible to specific cleavage in vitro following expression as a single-chain. Such proteins may include clostridial neurotoxins and derivatives thereof, such as those proteins disclosed in Dolly et al., Modified Clostridial Toxins for Use as Transport Proteins, International Patent Publication WO 95/32738 (Dec. 7, 1995); and Foster et al., Clostridial Toxin Derivatives Able to Modify Peripheral Sensory Afferent Functions, U.S. Pat. No. 5,989,545 (Nov. 23, 1999), both incorporated by reference herein.
[0021]In one embodiment of the invention the protein comprises the functional domains of a clostridial neurotoxin H chain and some or all of the functions of a clostridial neurotoxin L chain in a single polypeptide chain, and having an inserted proteolytic cleavage site located between the H domain and the L domain by which the single-chain protein may be cleaved to produce the individual chains, preferably covalently linked by a disulfide linkage. The invention also includes methods of making such proteins and expressing them within a cell, as well as nucleic acid vectors for the transfer and expression of the nucleotide sequence regions encoding such proteins and cells containing such vectors. The proteolytic cleavage sites comprise amino acid sequences that are selectively recognized and cleaved by a specific enzyme.
[0022]In a preferred aspect of the invention, the expressed single-chain proteins comprise the biologically active domains of the H chain and L chain of a clostridial neurotoxin. Scission at the internal proteolytic cleavage site separating the chain domains thus results in the activation of a neurotoxin having full activity.
[0023]In another aspect of the invention the single-chain proteins comprise a binding domain targeted to a cell receptor other than one borne by a motor neuron. Such a binding domain may specific bind to, for example, a sensory afferent neuron, or to a non-neuronal cell type or tissue, such as pancreatic acinar cells. The single-chain proteins will contain a translocation domain similar to that of clostridial neurotoxins, and a therapeutic moiety. The therapeutic moiety may be a clostridial neurotoxin light chain, or may be a different therapeutic moiety such as an enzyme, a transcribable nucleotide sequence, growth factor, an antisense nucleotide sequence and the like.
[0024]Preferably, the toxins and toxin-based proteins of the present invention will be tailored to contain an additional amino acid sequence comprising a binding tag able to bind a target compound at sufficiently high efficiency to facilitate rapid isolation of the toxin protein. Proteins containing such binding sites are many and well known to those of skill in the art, and may comprise, without limitation, monoclonal antibodies, maltose binding protein, glutathione-S-transferase, protein A, a His6 tag, and the like.
[0025]Because such proteins exhibit binding selectivity to a certain compound or compound type, the target compound may be immobilized to a solid support, including without limitation, a chromotography resin or microtiter well and used for affinity purification of the modified toxin. The toxin molecule can then be eluted by standard methods, such as through the use of a high salt solution or specific antagonist.
[0026]To minimize the safety risk associated with handling neurotoxin, the toxins of the this aspect of the present invention are expressed as their low activity (or inactive) single-chain proforms, then, by a carefully controlled proteolytic reaction in vitro, they are activated, preferably to the same potency level as the native neurotoxin from which they were derived. To improve the efficiency and rate of proteolytic cleavage the engineered proteolytic cleavage sites can be designed to occur in a specially-designed loop between the H and L portions of the single amino acid chain that promotes accessibility of the protease to the holotoxin substrate.
[0027]To reduce the risk of unintentional activation of the toxin by human or commonly encountered proteases, the amino acid sequences of the cleavage site are preferably designed to have a high degree of specificity to proteolytic enzymes which do not normally occur in humans (as either human proteases or occurring in part of the foreseeable human fauna and flora). A non-exclusive list of examples of such proteases includes a protease isolated or derived from a non-human Enterokinase, like bovine enterokinase, a protease isolated or derived from plant legumain, a protease isolated or derived from plant papain, such as, e.g., like from Carica papaya, a protease isolated or derived from insect papain, like from the silkworm Sitophilus zeamatus, a protease isolated or derived from crustacian papain, a protease isolated or derived from Tobacco etch virus (TEV), a protease isolated or derived from a Tobacco Vein Mottling Virus (TVMV), a protease isolated or derived from Bacillus amyliquifaciens, such as, e.g., subtilisin and GENENASE®, a protease isolated or derived from 3c protease from human rhinovirus (HRV), such as, e.g., PRESCISSION®, a protease isolated or derived from 3c protease from human enteroviruses (HEV), and a protease isolated or derived from a non-human Caspase 3.
[0028]In an aspect of the invention the single-chain polypeptide is an isolated polypeptide. By "isolated" is meant removed from its natural environment. For example, for a protein expressed within the cell, isolation includes preparation of a cell lysate as well as subsequent purification steps. A protein expressed extracellularly may be isolated by, for example, separation of the supernatant from the cells as well as any subsequent purification steps.
[0029]In another aspect of the invention the interchain loop region of the C. botulinum subtype E neurotoxin, which is normally resistant to proteolytic nicking in the bacterium and mammals, is modified to include the inserted proteolytic cleavage site, and this loop region used as the interchain loop region in the single-chain toxin or modified toxin molecules of the present invention. It is believed that using the loop from C. botulinum subtype E will stabilize the unnicked toxin molecule in vivo, making it resistant to undesired cleavage until activated through the use of the selected protease.
[0030]In yet another aspect of the invention compositions are contemplated comprising recombinant forms of BoNT/E expressed as a single-chain polypeptide.
[0031]In still another aspect contemplate recombinant chimeric and/or modified toxin derivatives expressed as a single-chain polypeptide. Such polypeptide may be molecular transporters, such as, without limitation, those disclosed in Dolly et al., European Patent Specification EP 0 760 681 B1, incorporated by reference herein.
[0032]In a further aspect the invention includes neurotoxin derivatives comprising at least a portion of a light chain from one clostridial neurotoxin or subtype thereof, and at least a portion of a heavy chain from another neurotoxin or neurotoxin subtype, as well as methods for their production. In one embodiment the hybrid neurotoxin may contain the entire light chain of a light chain from one neurotoxin subtype and the heavy chain from another neurotoxin subtype. In another embodiment, a chimeric neurotoxin derivative may contain a portion (e.g., the binding domain) of the heavy chain of one neurotoxin subtype, with another portion of the heavy chain being from another neurotoxin subtype. Similarly or alternatively, the therapeutic element may comprise light chain portions from different neurotoxins.
[0033]Such hybrid or chimeric neurotoxin derivatives are useful, for example, as a means of delivering the therapeutic benefits of such neurotoxins to patients who are immunologically resistant to a given neurotoxin subtype, to patients who may have a lower than average concentration of receptors to a given neurotoxin heavy chain binding moiety, or to patients who may have a protease-resistant variant of the membrane or vesicle toxin substrate (e.g., SNAP-25, VAMP and syntaxin). Creation of recombinant chimeric or hybrid neurotoxin derivatives having a light chain with different substrate would permit such patients to respond to neurotoxin therapy.
[0034]With regard to immunological resistance, it is known that most neurotoxin epitopes exist on the heavy chain portion of the toxin. Thus if a patient has neutralizing antibodies to, for example BoNT/A, a chimeric neurotoxin containing the heavy chain from BoNT/E and the light chain from BoNT/A (which has a longer duration of therapeutic activity than other neurotoxin light chains) would overcome this resistance. Likewise if the patient has few cell surface receptors for BoNT/A, the chance are great that the same patient would have adequate receptors to another BoNT subtype. By creating a hybrid or chimeric neurotoxin (such as one containing at least a portion of a heavy chain selected from the group consisting of HCA, HCB, HCC, HCD, HCE, HCF, and HCG and a at least a portion of a light chain selected from a different clostridial neurotoxin subtype, said light chain being selected from the group consisting of LCA, LCB, LCC, LCD, LCE, LCF, and LCG) combining the heavy chain of that subtype with the most therapeutically appropriate light chain (for example, the BoNT/A light chain) the patient could better respond to neurotoxin therapy.
[0035]Another advantage of the hybrid or chimeric neurotoxin derivatives described above is related to the fact that certain of the light chains (e.g., LCA) have a long duration of action, others having a short duration of action (e.g., LCE and LCF) while still others have an intermediate duration of activity (e.g., LCB). Thus, hybrid and chimeric neurotoxins represent second and third generation neurotoxin drugs in which the neurotoxin activity may be tailored to a specific therapeutic need or condition, with different drugs having different activities, substrate specificities or duration of activity.
[0036]Such hybrid or chimeric neurotoxins would also be useful in treating a patient (such as a soldier or laboratory worker) who has been inoculated with the pentavalent BoNT vaccine. Such vaccines do not contain BoNT/F; thus, combining the appropriate light chain with the BoNT/F heavy chain would create a therapeutic agent which is effective in such a patient where current therapeutic neurotoxins may not be.
[0037]The same strategy may be useful in using derivatives of clostridial neurotoxins with a therapeutic moiety other than an active neurotoxin light chain. As the heavy chain of such an agent would be derived from a neurotoxin, it may be advantageous to use a lesser known, or rarer heavy chain to avoid resistance mechanisms neutralizing the effectiveness of the therapeutic neurotoxin derivative.
[0038]By the same token, the binding moiety may be one other than a binding moiety derived from a clostridial neurotoxin heavy chain, thus providing a targeting function to cell types other than motor neurons.
[0039]Also included herein are methods for the construction, expression, and purification of such molecules in high yield as biologically active entities.
BRIEF DESCRIPTION OF THE DRAWINGS
[0040]FIG. 1A is a diagrammatic view of the single-chain TeNT construct in plasmid pTrcHisA and the nucleotide sequence of the junction region.
[0041]FIG. 1B shows the and amino acid sequence connecting the carboxyl terminus of the L chain and the amino terminus of the H chain and an engineered loop region containing an enterokinase cleavage site.
[0042]FIG. 2A is a representation of a Western blot of an SDS-PAGE gel of cell extracts of E. coli JM 109 transformants containing 2 different recombinant single-chain toxins, either before or after induction of plasmid protein expression with IPTG. The antibody used for detection is an anti-His6 monoclonal antibody.
[0043]FIG. 2B is a Western blot of IPTG-induced cell extracts from cells transformed with the E234A construct.
[0044]FIG. 3A shows the results of an experiment in which affinity purified recombinant single-chain (SC) TeNT is nicked with enterokinase, then separated using SDS-PAGE and visualized using Commassie Brilliant Blue under reducing and non-reducing conditions.
[0045]FIG. 3B shows the results of an experiment in which affinity purified recombinant single-chain (SC) TeNT is nicked with enterokinase, then separated using SDS-PAGE under reducing and non-reducing conditions and subjected to a Western blot using anti TeNT heavy chain antibody.
[0046]FIG. 4 is a plot of the degree of paralysis induced in a nerve/muscle preparation in vitro using native TeNT, and recombinant single-chain neurotoxin before, and after nicking as a function of time.
[0047]FIG. 5 is a depiction of the peptide fragments generated upon incubation of the recombinant single-chain TeNT with trypsin and Arg C protease, and deduction, from the N-terminal sequences of one of the resulting fragments, of the amino acid sequence recognized by these agents.
[0048]FIG. 6 shows the digestion of unnicked SC WT TeNT and SC R496G TeNT with various concentrations of trypsin.
[0049]FIG. 7 shows the inhibitory effect upon TeNT stimulated inhibition of Ca++-dependent neurotransmitter release of preincubating cerebellar cells with the E234A mutant TeNT.
[0050]FIG. 8 shows the effect upon Ca++-dependent neurotransmitter release of cerebellar neurons upon exposure to native, recombinant E234A mutant single-chain, and the recombinant R496G mutant single-chain TeNT.
[0051]FIG. 9 shows the inhibitory effect upon TeNT-stimulated paralytic activity of preincubating mouse hemi diaphrams with the E234A mutant TeNT.
[0052]FIG. 10 shows the scheme for construction of a plasmid encoding single-chain BoNT/E, and an agarose gel electrophoretogram of the PCR fragment obtained during the construction of the plasmid.
[0053]FIG. 11 shows the scheme for construction of a plasmid encoding the E212Q proteolytically inactive single-chain BoNT/E mutant, and an agarose gel electrophoretogram of the inverse PCR fragment obtained during the construction of the plasmid.
[0054]FIG. 12 shows the expression and purification scheme for recombinant single-chain BoNT/E, and a SDS-PAGE electrophoretogram and Western blot of the purification fractions.
[0055]FIG. 13 shows SDS-PAGE electrophoretograms under reducing and non-reducing conditions of native recombinant unnicked, and recombinant nicked BoNT/E, and Western Blots directed towards the heavy and light chains of the toxin.
[0056]FIG. 14 shows the results of incubating native BoNT/E, recombinant nicked and un-nicked BoNT/E, and the E212Q mutant with a GST-SNAP-25[140-205] protease substrate.
[0057]FIG. 15 shows the effect upon Ca++-dependent glutamate release of incubating cerebellar cells with native BoNT/E, un-nicked recombinant single-chain BoNT/E, and nicked recombinant single-chain BoNT/E.
[0058]FIG. 16A shows the effects on muscle tension of incubating mouse phrenic-nerve hemi-diaphragms with 0.2 nM recombinant nicked BoNT/E (◯) or 0.2 nM native BoNT/E (quadrature).
[0059]FIG. 16B shows the effects on muscle tension of incubating mouse phrenic-nerve hemi-diaphragms with 1 nM recombinant un-nicked (◯), 1 nM recombinant nicked ( ) or 0.05 nM recombinant nicked (∇) BoNT/E.
[0060]FIG. 17 shows the attenuation of paralytic activity on mouse phrenic-nerve hemi-diaphragms of preincubation with the inactive E212Q mutant prior to exposure to native nicked BoNT/E toxin.
[0061]FIG. 18 shows a schematic of the current paradigm of neurotransmitter release and Clostridial toxin intoxication in a central and peripheral neuron. FIG. 18A shows a schematic for the neurotransmitter release mechanism of a central and peripheral neuron. The release process can be described as comprising two steps: 1) vesicle docking, where the vesicle-bound SNARE protein of a vesicle containing neurotransmitter molecules associates with the membrane-bound SNARE proteins located at the plasma membrane; and 2) neurotransmitter release, where the vesicle fuses with the plasma membrane and the neurotransmitter molecules are exocytosed. FIG. 18B shows a schematic of the intoxication mechanism for tetanus and botulinum toxin activity in a central and peripheral neuron. This intoxication process can be described as comprising four steps: 1) receptor binding, where a Clostridial toxin binds to a Clostridial receptor system and initiates the intoxication process; 2) complex internalization, where after toxin binding, a vesicle containing the toxin/receptor system complex is endocytosed into the cell; 3) light chain translocation, where multiple events are thought to occur, including, e.g., changes in the internal pH of the vesicle, formation of a channel pore comprising the HN domain of the Clostridial toxin heavy chain, separation of the Clostridial toxin light chain from the heavy chain, and release of the active light chain and 4) enzymatic target modification, where the activate light chain of Clostridial toxin proteolytically cleaves its target SNARE substrate, such as, e.g., SNAP-25, VAMP or Syntaxin, thereby preventing vesicle docking and neurotransmitter release.
[0062]FIG. 19 shows the domain organization of naturally-occurring Clostridial toxins. The single-chain form depicts the amino to carboxyl linear organization comprising an enzymatic domain, a translocation domain, and a binding domain. The di-chain loop region located between the translocation and enzymatic domains is depicted by the double SS bracket. This region comprises an endogenous di-chain loop protease cleavage site that upon proteolytic cleavage with a naturally-occurring protease, such as, e.g., an endogenous Clostridial toxin protease or a naturally-occurring protease produced in the environment, converts the single-chain form of the toxin into the di-chain form. Above the single-chain form, the HCC region of the Clostridial toxin binding domain is depicted. This region comprises the β-trefoil domain which comprises in a amino to carboxyl linear organization an α-fold, a β4/β5 hairpin turn, β-fold, a β8/β9 hairpin turn and a y-fold.
[0063]FIG. 20 shows modified Clostridial toxins with an enhanced targeting domain located at the amino terminus of the modified toxin. FIG. 20A depicts the single-chain polypeptide form of a modified Clostridial toxin with an amino to carboxyl linear organization comprising a binding element, a translocation element, a di-chain loop region comprising an exogenous protease cleavage site (P), and a therapeutic element. Upon proteolytic cleavage with a P protease, the single-chain form of the toxin is converted to the di-chain form. FIG. 20B depicts the single polypeptide form of a modified Clostridial toxin with an amino to carboxyl linear organization comprising a binding element, a therapeutic element, a di-chain loop region comprising an exogenous protease cleavage site (P), and a translocation element. Upon proteolytic cleavage with a P protease, the single-chain form of the toxin is converted to the di-chain form.
[0064]FIG. 21 shows modified Clostridial toxins with an enhanced targeting domain located between the other two domains. FIG. 21A depicts the single polypeptide form of a modified Clostridial toxin with an amino to carboxyl linear organization comprising a therapeutic element, a di-chain loop region comprising an exogenous protease cleavage site (P), a binding element, and a translocation element. Upon proteolytic cleavage with a P protease, the single-chain form of the toxin is converted to the di-chain form. FIG. 21B depicts the single polypeptide form of a modified Clostridial toxin with an amino to carboxyl linear organization comprising a translocation element, a di-chain loop region comprising an exogenous protease cleavage site (P), a binding element, and a therapeutic element. Upon proteolytic cleavage with a P protease, the single-chain form of the toxin is converted to the di-chain form. FIG. 21C depicts the single polypeptide form of a modified Clostridial toxin with an amino to carboxyl linear organization comprising a therapeutic element, a binding element, a di-chain loop region comprising an exogenous protease cleavage site (P), and a translocation element. Upon proteolytic cleavage with a P protease, the single-chain form of the toxin is converted to the di-chain form. FIG. 21D depicts the single polypeptide form of a modified Clostridial toxin with an amino to carboxyl linear organization comprising a translocation element, a binding element, a di-chain loop region comprising an exogenous protease cleavage site (P), and a therapeutic element. Upon proteolytic cleavage with a P protease, the single-chain form of the toxin is converted to the di-chain form.
[0065]FIG. 22 shows modified Clostridial toxins with an enhanced targeting domain located at the carboxyl terminus of the modified toxin. FIG. 22A depicts the single polypeptide form of a modified Clostridial toxin with an amino to carboxyl linear organization comprising a therapeutic element, a di-chain loop region comprising an exogenous protease cleavage site (P), a translocation element, and a binding element. Upon proteolytic cleavage with a P protease, the single-chain form of the toxin is converted to the di-chain form. FIG. 22B depicts the single polypeptide form of a modified Clostridial toxin with an amino to carboxyl linear organization comprising a translocation element, a di-chain loop region comprising an exogenous protease cleavage site (P), a therapeutic element, and a binding element. Upon proteolytic cleavage with a P protease, the single-chain form of the toxin is converted to the di-chain form.
DETAILED DESCRIPTION OF THE INVENTION
[0066]Clostridia toxins produced by Clostridium botulinum, Clostridium tetani, Clostridium baratii and Clostridium butyricum are the most widely used in therapeutic and cosmetic treatments of humans and other mammals. Strains of C. botulinum produce seven antigenically-distinct types of Botulinum toxins (BoNTs), which have been identified by investigating botulism outbreaks in man (BoNT/A, /B, /E and /F), animals (BoNT/C1 and /D), or isolated from soil (BoNT/G). BoNTs possess approximately 35% amino acid identity with each other and share the same functional domain organization and overall structural architecture. It is recognized by those of skill in the art that within each type of Clostridial toxin there can be subtypes that differ somewhat in their amino acid sequence, and also in the nucleic acids encoding these proteins. For example, there are presently four BoNT/A subtypes, BoNT/A1, BoNT/A2, BoNT/A3 and BoNT/A4, with specific subtypes showing approximately 89% amino acid identity when compared to another BoNT/A subtype. While all seven BoNT serotypes have similar structure and pharmacological properties, each also displays heterogeneous bacteriological characteristics. In contrast, tetanus toxin (TeNT) is produced by a uniform group of C. tetani. Two other species of Clostridia, C. baratii and C. butyricum, also produce toxins, BaNT and BuNT respectively, which are similar to BoNT/F and BoNT/E, respectively.
[0067]Each mature di-chain molecule comprises three functionally distinct domains: 1) an enzymatic domain located in the LC that includes a metalloprotease region containing a zinc-dependent endopeptidase activity which specifically targets core components of the neurotransmitter release apparatus; 2) a translocation domain contained within the amino-terminal half of the HC(HN) that facilitates release of the LC from intracellular vesicles into the cytoplasm of the target cell; and 3) a binding domain found within the carboxyl-terminal half of the HC (HC) that determines the binding activity and binding specificity of the toxin to the receptor complex located at the surface of the target cell. The HC domain comprises two distinct structural features of roughly equal size that indicate function and are designated the HCN and HCC subdomains. Table 1 gives approximate boundary regions for each domain found in exemplary Clostridial toxins.
TABLE-US-00001 TABLE 1 Clostridial Toxin Reference Sequences and Regions Toxin SEQ ID NO: LC HN HC BoNT/A 1 M1-K448 A449-K871 N872-L1296 BoNT/B 2 M1-K441 A442-S858 E859-E1291 BoNT/C1 3 M1-K449 T450-N866 N867-E1291 BoNT/D 4 M1-R445 D446-N862 S863-E1276 BoNT/E 5 M1-R422 K423-K845 R846-K1252 BoNT/F 6 M1-K439 A440-K864 K865-E1274 BoNT/G 7 M1-K446 S447-S863 N864-E1297 TeNT 8 M1-A457 S458-V879 I880-D1315 BaNT 9 M1-K431 N432-I857 I858-E1268 BuNT 10 M1-R422 K423-I847 Y1086-K1251
[0068]The binding, translocation and enzymatic activity of these three functional domains are all necessary for toxicity. While all details of this process are not yet precisely known, the overall cellular intoxication mechanism whereby Clostridial toxins enter a neuron and inhibit neurotransmitter release is similar, regardless of serotype or subtype. Although the applicants have no wish to be limited by the following description, the intoxication mechanism can be described as comprising at least four steps: 1) receptor binding, 2) complex internalization, 3) light chain translocation, and 4) enzymatic target modification (see FIG. 18). The process is initiated when the HC domain of a Clostridial toxin binds to a toxin-specific receptor system located on the plasma membrane surface of a target cell. The binding specificity of a receptor complex is thought to be achieved, in part, by specific combinations of gangliosides and protein receptors that appear to distinctly comprise each Clostridial toxin receptor complex. Once bound, the toxin/receptor complexes are internalized by endocytosis and the internalized vesicles are sorted to specific intracellular routes. The translocation step appears to be triggered by the acidification of the vesicle compartment. This process seems to initiate two important pH-dependent structural rearrangements that increase hydrophobicity and promote formation di-chain form of the toxin. Once activated, light chain endopeptidase of the toxin is released from the intracellular vesicle into the cytosol where it appears to specifically targets one of three known core components of the neurotransmitter release apparatus. These core proteins, vesicle-associated membrane protein (VAMP)/synaptobrevin, synaptosomal-associated protein of 25 kDa (SNAP-25) and Syntaxin, are necessary for synaptic vesicle docking and fusion at the nerve terminal and constitute members of the soluble N-ethylmaleimide-sensitive factor-attachment protein-receptor (SNARE) family. BoNT/A and BoNT/E cleave SNAP-25 in the carboxyl-terminal region, releasing a nine or twenty-six amino acid segment, respectively, and BoNT/C1 also cleaves SNAP-25 near the carboxyl-terminus. The botulinum serotypes BoNT/B, BoNT/D, BoNT/F and BoNT/G, and tetanus toxin, act on the conserved central portion of VAMP, and release the amino-terminal portion of VAMP into the cytosol. BoNT/C1 cleaves syntaxin at a single site near the cytosolic membrane surface. The selective proteolysis of synaptic SNAREs accounts for the block of neurotransmitter release caused by Clostridial toxins in vivo. The SNARE protein targets of Clostridial toxins are common to exocytosis in a variety of non-neuronal types; in these cells, as in neurons, light chain peptidase activity inhibits exocytosis, see, e.g., Yann Humeau et al., How Botulinum and Tetanus Neurotoxins Block Neurotransmitter Release, 82(5) Biochimie. 427-446 (2000); Kathryn Turton et al., Botulinum and Tetanus Neurotoxins: Structure, Function and Therapeutic Utility, 27(11) Trends Biochem. Sci. 552-558. (2002); Giovanna Lalli et al., The Journey of Tetanus and Botulinum Neurotoxins in Neurons, 11 (9) Trends Microbiol. 431-437, (2003).
[0069]Clostridial toxins are each translated as a single-chain polypeptide of approximately 150 kDa that is subsequently cleaved by proteolytic scission within a disulfide loop by a naturally-occurring protease (FIG. 18). This cleavage occurs within the discrete di-chain loop region created between two cysteine residues that form a disulfide bridge. This posttranslational processing yields a di-chain molecule comprising an approximately 50 kDa light chain (LC) and an approximately 100 kDa heavy chain (HC) held together by the single disulfide bond and non-covalent interactions between the two chains. The naturally-occurring protease used to convert the single-chain molecule into the di-chain is currently not known. In some bacterial serotypes, such as, e.g., a BoNT/A, a BoNT/B proteolytic, a BoNT/F proteolytic, a BaNT proteolytic strain, or a TeNT, the naturally-occurring protease is produced endogenously by the bacteria serotype and cleavage occurs within the cell before the toxin is release into the environment. However, in other bacterial serotypes, such as, e.g., a BoNT/B nonproteolytic, a BoNT/C1, a BoNT/D, a BoNT/E, a BoNT/F nonproteolytic, a BoNT/G, a BaNT nonproteolytic, or a BuNT, the bacterial strain appears not to produce appreciable amounts of an endogenous protease capable of converting the single-chain form of the toxin into the di-chain form. In these situations, the toxin is released from the cell as a single-chain toxin which is subsequently converted into the di-chain form by a naturally-occurring protease found in the environment.
[0070]The compositions and methods of the present invention involve modified neurotoxins, their synthesis and use. Di-chain neurotoxins that are normally activated by scission of a single-chain polypeptide by indigenous proteases can be modified at the nucleic acid level by alteration or removal of the nucleotide sequence encoding the indigenous protease cleavage site and insertion of a nucleotide sequence encoding another different proteolytic cleavage site resistant to cleavage by host cell or human proteases. The inserted amino acid sequence is designed to be cleaved in vitro through the use of a cleaving agent chosen in advance of expression that is, absent from both human and host cell tissue.
[0071]The amino acid sequences recognized by many proteases, and their cleavage specificity are well-known to those of skill in the art. Thus, both the design of a specific proteolytic cleavage site in the loop region between the L and H chain portions of the single-chain toxin and the modification of incidental protease sites in the polypeptide to be protease-resistant is a routine matter of comparing the specificity and recognition sequences for various proteins. In the first case, the specificity of a candidate proteolytic site need not be totally exclusive, but merely needs to exclude cleavage sites for human and/or host cell proteases that might be present during the handling, storage and purification of the single-chain neurotoxin. Of course, it is preferable that the protease site is as specific as possible. In the latter case, the modification of the proteolytic cleavage site need only be sufficient to render the site resistant to the activator protease and to human and host cell proteases.
[0072]As mentioned above, a Clostridial toxin is converted from a single polypeptide form into a di-chain molecule by proteolytic cleavage. While the naturally-occurring protease is currently not known, cleavage occurs within the di-chain loop region between the two cysteine residues that form the disulfide bridge (Table 2). As used herein, the term "di-chain loop region" means the amino acid sequence of a Clostridial toxin containing a protease cleavage site used to convert the single-chain polypeptide form of a Clostridial toxin into the di-chain form. Non-limiting examples of a Clostridial toxin di-chain loop region, include, a di-chain loop region of BoNT/A comprising SEQ ID NO: 11; a di-chain loop region of BoNT/B comprising SEQ ID NO: 12; a di-chain loop region of BoNT/C1 comprising SEQ ID NO: 13; a di-chain loop region of BoNT/D comprising SEQ ID NO: 14; a di-chain loop region of BoNT/E comprising SEQ ID NO: 15; a di-chain loop region of BoNT/F comprising SEQ ID NO: 16; a di-chain loop region of BoNT/G comprising SEQ ID NO: 17; a di-chain loop region of TeNT comprising SEQ ID NO: 18, a di-chain loop region of BaNT comprising SEQ ID NO: 19, and a di-chain loop region of BuNT comprising SEQ ID NO: 20 (Table 2).
TABLE-US-00002 TABLE 2 Di-chain Loop Region of Clostridial Toxins SEQ ID Di-Chain Loop Region Including a Toxin NO: Di-Chain Protease Cleavage Site BoNT/A 11 CVRGIITSKTKSLDKGYNK*----ALNDLC BoNT/B 12 CKSVK*-------------------APGIC BoNT/C1 13 CHKAIDGRSLYNK*------------TLDC BoNT/D 14 CLRLTKNSR*---------------DDSTC BoNT/E 15 CKNIVSVKGIR*--------------KSIC BoNT/F 16 CKSVIPRKGTK*------------APPRLC BoNT/G 17 CKPVMYKNTGK*--------------SEQC TeNT 18 CKKIIPPTNIRENLYNRTA*SLTDLGGELC BaNT 19 CKSIVSKKGTK*--------------NSLC BuNT 20 CKNIVSVKGIR*--------------KSTC The amino acid sequence displayed are as follows: BoNT/A, residues 430-454 of SEQ ID NO: 1; BoNT/B, residues 437-446 of SEQ ID NO: 2; BoNT/C1, residues 437-453 of SEQ ID NO: 3; BoNT/D, residues 437-450 of SEQ ID NO: 4; BoNT/E, residues 412-426 of SEQ ID NO: 5; BoNT/F, residues 429-445 of SEQ ID NO: 6; BoNT/G, residues 436-450 of SEQ ID NO: 7; TeNT, residues 439-467 of SEQ ID NO: 8; BaNT, residues 421-435 of SEQ ID NO: 9; and BuNT, residues 412-426 of SEQ ID NO: 10. An asterisks (*) indicates the peptide bond of the P1-P1 cleavage site that is believed to be cleaved by a Clostridial toxin di-chain loop protease.
[0073]The inserted amino acid sequence may be chosen to confer susceptibility to a chemical agent capable of cleaving peptide bonds, such as cyanogen bromide. However, and much more preferably, the encoded amino acid sequence may comprise a proteolytic cleavage site highly specific for a selected protease. The selected protease may be any protease that recognizes a specific amino acid sequence and cleaves a peptide bond near or at that location, but the selected protease is very preferably not a human protease such as, e.g., human trypsin, chymotrypsin or pepsin, or a protease expressed in the host cell. Moreover, the selected protease does not recognize the same amino acid sequence as the endogenous protease (i.e., the naturally-occurring di-chain loop protease cleavage site). Finally, the selected protease should not be one expressed by the host cell that contains the plasmid encoding the recombinant neurotoxin. Any non-human protease recognizing a relatively rare amino acid sequence may be used, provided that the amino acid recognition sequence is also known. Examples of proteases to be selected as activators may include any of the following, without limitation: a protease isolated or derived from non-human Enterokinase, such as, e.g., a bovine enterokinase, a protease isolated or derived from plant legumain, a protease isolated or derived from plant papain, such as, e.g., like from Carica papaya, a protease isolated or derived from insect papain, like from the silkworm Sitophilus zeamatus, a protease isolated or derived from crustacian papain, a protease isolated or derived from Tobacco etch virus (TEV), a protease isolated or derived from a Tobacco Vein Mottling Virus (TVMV), a protease isolated or derived from Bacillus amyliquifaciens, such as, e.g., subtilisin and GENENASE®, a protease isolated or derived from 3c protease from human rhinovirus (HRV), such as, e.g., PRESCISSION®, a protease isolated or derived from 3c protease from human enteroviruses (HEV) and a protease isolated or derived from a non-human Caspase 3, such as, e.g., a mouse Caspase 3.
[0074]In another aspect of the invention, a modified Clostridial toxin comprises, in part, an exogenous protease cleavage site within a di-chain loop region. As used herein, the term "exogenous protease cleavage site" is synonymous with a "non-naturally occurring protease cleavage site" or "non-native protease cleavage site" and means a protease cleavage site that is not normally present in a di-chain loop region from a naturally occurring Clostridial toxin, with the proviso that the exogenous protease cleavage site is not a human protease cleavage site or a protease cleavage site that is susceptible to a protease being expressed in the host cell that is expressing a construct encoding an activatable polypeptide disclosed in the present specification. It is envisioned that any and all exogenous protease cleavage sites can be used to convert the single-chain polypeptide form of a Clostridial toxin into the di-chain form are useful to practice aspects of the present invention. Non-limiting examples of exogenous protease cleavage sites include, e.g., a plant papain cleavage site, an insect papain cleavage site, a crustacian papain cleavage site, a non-human enterokinase cleavage site, a human rhinovirus 3C protease cleavage site, human enterovirus 3C protease cleavage site, a tobacco etch virus (TEV) protease cleavage site, a Tobacco Vein Mottling Virus (TVMV) cleavage site, a subtilisin cleavage site, a hydroxylamine cleavage site, or a non-human Caspase 3 cleavage site.
[0075]It is envisioned that an exogenous protease cleavage site of any and all lengths can be useful in aspects of the present invention with the proviso that the exogenous protease cleavage site is capable of being cleaved by its respective protease. Thus, in aspects of this embodiment, an exogenous protease cleavage site can be, e.g., at least 6 amino acids in length, at least 7 amino acids in length, at least 8 amino acids in length, at least 9 amino acids in length, at least 10 amino acids in length, at least 15 amino acids in length, at least 20 amino acids in length, at least 25 amino acids in length, at least 30 amino acids in length, at least 40 amino acids in length, at least 50 amino acids in length or at least 60 amino acids in length. In other aspects of this embodiment, an exogenous protease cleavage site can be, e.g., at most 6 amino acids in length, at most 7 amino acids in length, at most 8 amino acids in length, at most 9 amino acids in length, at most 10 amino acids in length, at most 15 amino acids in length, at most 20 amino acids in length, at most 25 amino acids in length, at most 30 amino acids in length, at most 40 amino acids in length, at most 50 amino acids in length or at most 60 amino acids in length.
[0076]In an embodiment, an exogenous protease cleavage site is located within the di-chain loop of a modified Clostridial toxin. In aspects of this embodiment, a modified Clostridial toxin comprises an exogenous protease cleavage site comprises, e.g., a plant papain cleavage site, an insect papain cleavage site, a crustacian papain cleavage site, a non-human enterokinase protease cleavage site, a Tobacco Etch Virus protease cleavage site, a Tobacco Vein Mottling Virus protease cleavage site, a human rhinovirus 3C protease cleavage site, a human enterovirus 3C protease cleavage site, a subtilisin cleavage site, a hydroxylamine cleavage site, a SUMO/ULP-1 protease cleavage site, and a non-human Caspase 3 cleavage site. In other aspects of this embodiment, an exogenous protease cleavage site is located within the di-chain loop of, e.g., a modified BoNT/A, a modified BoNT/B, a modified BoNT/C1, a modified BoNT/D, a modified BoNT/E, a modified BoNT/F, a modified BoNT/G, a modified TeNT, a modified BaNT, or a modified BuNT.
[0077]In an aspect of this embodiment, an exogenous protease cleavage site can comprise, e.g., a non-human enterokinase cleavage site is located within the di-chain loop of a modified Clostridial toxin. In other aspects of the embodiment, an exogenous protease cleavage site can comprise, e.g., a bovine enterokinase protease cleavage site located within the di-chain loop of a modified Clostridial toxin. In other aspects of the embodiment, an exogenous protease cleavage site can comprise, e.g., a bovine enterokinase protease cleavage site located within the di-chain loop of a modified Clostridial toxin comprises SEQ ID NO: 21. In still other aspects of this embodiment, a bovine enterokinase protease cleavage site is located within the di-chain loop of, e.g., a modified BoNT/A, a modified BoNT/B, a modified BoNT/C1, a modified BoNT/D, a modified BoNT/E, a modified BoNT/F, a modified BoNT/G, a modified TeNT, a modified BaNT, or a modified BuNT.
[0078]In another aspect of this embodiment, an exogenous protease cleavage site can comprise, e.g., a Tobacco Etch Virus protease cleavage site is located within the di-chain loop of a modified Clostridial toxin. In other aspects of the embodiment, an exogenous protease cleavage site can comprise, e.g., a Tobacco Etch Virus protease cleavage site located within the di-chain loop of a modified Clostridial toxin comprises the consensus sequence E-P5-P4-Y-P2-Q*-G (SEQ ID NO: 22) or E-P5-P4-Y-P2-Q*-S (SEQ ID NO: 23), where P2, P4 and P5 can be any amino acid. In other aspects of the embodiment, an exogenous protease cleavage site can comprise, e.g., a Tobacco Etch Virus protease cleavage site located within the di-chain loop of a modified Clostridial toxin comprises SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32 or SEQ ID NO: 33. In still other aspects of this embodiment, a Tobacco Etch Virus protease cleavage site is located within the di-chain loop of, e.g., a modified BoNT/A, a modified BoNT/B, a modified BoNT/C1, a modified BoNT/D, a modified BoNT/E, a modified BoNT/F, a modified BoNT/G, a modified TeNT, a modified BaNT, or a modified BuNT.
[0079]In another aspect of this embodiment, an exogenous protease cleavage site can comprise, e.g., a Tobacco Vein Mottling Virus protease cleavage site is located within the di-chain loop of a modified Clostridial toxin. In other aspects of the embodiment, an exogenous protease cleavage site can comprise, e.g., a Tobacco Vein Mottling Virus protease cleavage site located within the di-chain loop of a modified Clostridial toxin comprises the consensus sequence P6-P5-V-R-F-Q*-G (SEQ ID NO: 34) or P6-P5-V-R-F-Q*-S (SEQ ID NO: 35), where P5 and P6 can be any amino acid. In other aspects of the embodiment, an exogenous protease cleavage site can comprise, e.g., a Tobacco Vein Mottling Virus protease cleavage site located within the di-chain loop of a modified Clostridial toxin comprises SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, or SEQ ID NO: 39. In still other aspects of this embodiment, a Tobacco Vein Mottling Virus protease cleavage site is located within the di-chain loop of, e.g., a modified BoNT/A, a modified BoNT/B, a modified BoNT/C1, a modified BoNT/D, a modified BoNT/E, a modified BoNT/F, a modified BoNT/G, a modified TeNT, a modified BaNT, or a modified BuNT.
[0080]In still another aspect of this embodiment, an exogenous protease cleavage site can comprise, e.g., a human rhinovirus 3C protease cleavage site is located within the di-chain loop of a modified Clostridial toxin. In other aspects of the embodiment, an exogenous protease cleavage site can comprise, e.g., a human rhinovirus 3C protease cleavage site located within the di-chain loop of a modified Clostridial toxin comprises the consensus sequence P5-P4-L-F-Q*-G-P (SEQ ID NO: 40), where P4 is G, A, V, L, I, M, S or T and P5 can any amino acid, with D or E preferred. In other aspects of the embodiment, an exogenous protease cleavage site can comprise, e.g., a human rhinovirus 3C protease cleavage site located within the di-chain loop of a modified Clostridial toxin comprises SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45 or SEQ ID NO: 46. In other aspects of the embodiment, an exogenous protease cleavage site can comprise, e.g., a human rhinovirus 3C protease located within the di-chain loop of a modified Clostridial toxin that can be cleaved by PRESCISSION®. In still other aspects of this embodiment, a human rhinovirus 3C protease cleavage site is located within the di-chain loop of, e.g., a modified BoNT/A, a modified BoNT/B, a modified BoNT/C1, a modified BoNT/D, a modified BoNT/E, a modified BoNT/F, a modified BoNT/G, a modified TeNT, a modified BaNT, or a modified BuNT.
[0081]In yet another aspect of this embodiment, an exogenous protease cleavage site can comprise, e.g., a subtilisin cleavage site is located within the di-chain loop of a modified Clostridial toxin. In other aspects of the embodiment, an exogenous protease cleavage site can comprise, e.g., a subtilisin cleavage site located within the di-chain loop of a modified Clostridial toxin comprises the consensus sequence P6-P5-P4-P3-H*-Y (SEQ ID NO: 47) or P6-P5-P4-P3-Y-H* (SEQ ID NO: 48), where P3, P4 and P5 and P6 can be any amino acid. In other aspects of the embodiment, an exogenous protease cleavage site can comprise, e.g., a subtilisin cleavage site located within the di-chain loop of a modified Clostridial toxin comprises SEQ ID NO: 49, SEQ ID NO: 50, or SEQ ID NO: 51. In other aspects of the embodiment, an exogenous protease cleavage site can comprise, e.g., a subtilisin cleavage site located within the di-chain loop of a modified Clostridial toxin that can be cleaved by GENENASE®. In still other aspects of this embodiment, a subtilisin cleavage site is located within the di-chain loop of, e.g., a modified BoNT/A, a modified BoNT/B, a modified BoNT/C1, a modified BoNT/D, a modified BoNT/E, a modified BoNT/F, a modified BoNT/G, a modified TeNT, a modified BaNT, or a modified BuNT.
[0082]In yet another aspect of this embodiment, an exogenous protease cleavage site can comprise, e.g., a hydroxylamine cleavage site is located within the di-chain loop of a modified Clostridial toxin. In other aspects of the embodiment, an exogenous protease cleavage site can comprise, e.g., a hydroxylamine cleavage site comprising multiples of the dipeptide N*G. In other aspects of the embodiment, an exogenous protease cleavage site can comprise, e.g., a hydroxylamine cleavage site located within the di-chain loop of a modified Clostridial toxin comprises SEQ ID NO: 52, SEQ ID NO: 53, or SEQ ID NO: 54. In still other aspects of this embodiment, a hydroxylamine cleavage site is located within the di-chain loop of, e.g., a modified BoNT/A, a modified BoNT/B, a modified BoNT/C1, a modified BoNT/D, a modified BoNT/E, a modified BoNT/F, a modified BoNT/G, a modified TeNT, a modified BaNT, or a modified BuNT.
[0083]In yet another aspect of this embodiment, an exogenous protease cleavage site can comprise, e.g., a SUMO/ULP-1 protease cleavage site is located within the di-chain loop of a modified Clostridial toxin. In other aspects of the embodiment, an exogenous protease cleavage site can comprise, e.g., a SUMO/ULP-1 protease cleavage site located within the di-chain loop of a modified Clostridial toxin comprising the consensus sequence G-G*-P1'-P2'-P3' (SEQ ID NO: 55), where P1', P2', and P3' can be any amino acid. In other aspects of the embodiment, an exogenous protease cleavage site can comprise, e.g., a SUMO/ULP-1 protease cleavage site located within the di-chain loop of a modified Clostridial toxin comprises SEQ ID NO: 56. In still other aspects of this embodiment, a SUMO/ULP-1 protease cleavage site is located within the di-chain loop of, e.g., a modified BoNT/A, a modified BoNT/B, a modified BoNT/C1, a modified BoNT/D, a modified BoNT/E, a modified BoNT/F, a modified BoNT/G, a modified TeNT, a modified BaNT, or a modified BuNT.
[0084]In an aspect of this embodiment, an exogenous protease cleavage site can comprise, e.g., a non-human Caspase 3 cleavage site is located within the di-chain loop of a modified Clostridial toxin. In other aspects of the embodiment, an exogenous protease cleavage site can comprise, e.g., a mouse Caspase 3 protease cleavage site located within the di-chain loop of a modified Clostridial toxin. In other aspects of the embodiment, an exogenous protease cleavage site can comprise, e.g., a non-human Caspase 3 protease cleavage site located within the di-chain loop of a modified Clostridial toxin comprises the consensus sequence D-P3-P2-D*P1' (SEQ ID NO: 57), where P3 can be any amino acid, with E preferred, P2 can be any amino acid and P1' can any amino acid, with G or S preferred. In other aspects of the embodiment, an exogenous protease cleavage site can comprise, e.g., a non-human Caspase 3 protease cleavage site located within the di-chain loop of a modified Clostridial toxin comprising SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62 or SEQ ID NO: 63. In still other aspects of this embodiment, a bovine enterokinase protease cleavage site is located within the di-chain loop of, e.g., a modified BoNT/A, a modified BoNT/B, a modified BoNT/C1, a modified BoNT/D, a modified BoNT/E, a modified BoNT/F, a modified BoNT/G, a modified TeNT, a modified BaNT, or a modified BuNT.
[0085]A di-chain loop region is modified to replace a naturally-occurring di-chain loop protease cleavage site for an exogenous protease cleavage site. In this modification, the naturally-occurring di-chain loop protease cleavage site is made inoperable and thus can not be cleaved by its protease. Only the exogenous protease cleavage site can be cleaved by its corresponding exogenous protease. In this type of modification, the exogenous protease site is operably-linked in-frame to a modified Clostridial toxin as a fusion protein and the site can be cleaved by its respective exogenous protease. Replacement of an endogenous di-chain loop protease cleavage site with an exogenous protease cleavage site can be a substitution of the sites where the exogenous site is engineered at the position approximating the cleavage site location of the endogenous site. Replacement of an endogenous di-chain loop protease cleavage site with an exogenous protease cleavage site can be an addition of an exogenous site where the exogenous site is engineered at the position different from the cleavage site location of the endogenous site, the endogenous site being engineered to be inoperable. The location and kind of protease cleavage site may be critical because certain binding domains require a free amino-terminal or carboxyl-terminal amino acid. For example, when a binding domain is placed between two other domains, e.g., see FIG. 22, a criterion for selection of a protease cleavage site could be whether the protease that cleaves its site leaves a flush cut, exposing the free amino-terminal or carboxyl-terminal of the binding domain necessary for selective binding of the binding domain to its receptor.
[0086]A naturally-occurring protease cleavage site can be made inoperable by altering at least the two amino acids flanking the peptide bond cleaved by the naturally-occurring di-chain loop protease. More extensive alterations can be made, with the proviso that the two cysteine residues of the di-chain loop region remain intact and the region can still form the disulfide bridge. Non-limiting examples of an amino acid alteration include deletion of an amino acid or replacement of the original amino acid with a different amino acid. Thus, in one embodiment, a naturally-occurring protease cleavage site is made inoperable by altering the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease. In other aspects of this embodiment, a naturally-occurring protease cleavage site is made inoperable by altering, e.g., at least three amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at least four amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at least five amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at least six amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at least seven amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at least eight amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at least nine amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at least ten amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at least 15 amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; or at least 20 amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease.
[0087]In still other aspects of this embodiment, a naturally-occurring di-chain protease cleavage site is made inoperable by altering, e.g., at most three amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at most four amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at most five amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at most six amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at most seven amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at most eight amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at most nine amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at most ten amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at most 15 amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; or at most 20 amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease.
[0088]It is understood that a modified Clostridial toxin disclosed in the present specification can optionally further comprise a flexible region comprising a flexible spacer. Non-limiting examples of a flexible spacer include, e.g., a G-spacer GGGGS (SEQ ID NO: 64) or an A-spacer EAAAK (SEQ ID NO: 65). A flexible region comprising flexible spacers can be used to adjust the length of a polypeptide region in order to optimize a characteristic, attribute or property of a polypeptide. Such a flexible region is operably-linked in-frame to the modified Clostridial toxin as a fusion protein. As a non-limiting example, a polypeptide region comprising one or more flexible spacers in tandem can be use to better expose a protease cleavage site thereby facilitating cleavage of that site by a protease. As another non-limiting example, a polypeptide region comprising one or more flexible spacers in tandem can be use to better present a binding domain, thereby facilitating the binding of that binding domain to its receptor.
[0089]Thus, in an embodiment, a modified Clostridial toxin disclosed in the present specification can further comprise a flexible region comprising a flexible spacer. In another embodiment, a modified Clostridial toxin disclosed in the present specification can further comprise flexible region comprising a plurality of flexible spacers in tandem. In aspects of this embodiment, a flexible region can comprise in tandem, e.g., at least 1 G-spacer, at least 2 G-spacers, at least 3 G-spacers, at least 4 G-spacers or at least 5 G-spacers. In other aspects of this embodiment, a flexible region can comprise in tandem, e.g., at most 1 G-spacer, at most 2 G-spacers, at most 3 G-spacers, at most 4 G-spacers or at most 5 G-spacers. In still other aspects of this embodiment, a flexible region can comprise in tandem, e.g., at least 1 A-spacer, at least 2 A-spacers, at least 3 A-spacers, at least 4 A-spacers or at least 5 A-spacers. In still other aspects of this embodiment, a flexible region can comprise in tandem, e.g., at most 1 A-spacer, at most 2 A-spacers, at most 3 A-spacers, at most 4 A-spacers or at most 5 A-spacers. In another aspect of this embodiment, a modified Clostridial toxin can comprise a flexible region comprising one or more copies of the same flexible spacers, one or more copies of different flexible-spacer regions, or any combination thereof.
[0090]In other aspects of this embodiment, a modified Clostridial toxin comprising a flexible spacer can be, e.g., a modified BoNT/A, a modified BoNT/B, a modified BoNT/C1, a modified BoNT/D, a modified BoNT/E, a modified BoNT/F, a modified BoNT/G, a modified TeNT, a modified BaNT, or a modified BuNT.
[0091]It is envisioned that a modified Clostridial toxin disclosed in the present specification can comprise a flexible spacer in any and all locations with the proviso that modified Clostridial toxin is capable of performing the intoxication process. In aspects of this embodiment, a flexible spacer is positioned between, e.g., a therapeutic element and a translocation element, a therapeutic element and a binding element, a therapeutic element and an exogenous protease cleavage site. In other aspects of this embodiment, a G-spacer is positioned between, e.g., a therapeutic element and a translocation element, a therapeutic element and a binding element, a therapeutic element and an exogenous protease cleavage site. In other aspects of this embodiment, an A-spacer is positioned between, e.g., a therapeutic element and a translocation element, a therapeutic element and a binding element, a therapeutic element and an exogenous protease cleavage site.
[0092]In other aspects of this embodiment, a flexible spacer is positioned between, e.g., a binding element and a translocation element, a binding element and a therapeutic element, a binding element and an exogenous protease cleavage site. In other aspects of this embodiment, a G-spacer is positioned between, e.g., a binding element and a translocation element, a binding element and a therapeutic element, a binding element and an exogenous protease cleavage site. In other aspects of this embodiment, an A-spacer is positioned between, e.g., a binding element and a translocation element, a binding element and a therapeutic element, a binding element and an exogenous protease cleavage site.
[0093]In yet other aspects of this embodiment, a flexible spacer is positioned between, e.g., a translocation element and a therapeutic element, a translocation element and a binding element, a translocation element and an exogenous protease cleavage site. In other aspects of this embodiment, a G-spacer is positioned between, e.g., a translocation element and a therapeutic element, a translocation element and a binding element, a translocation element and an exogenous protease cleavage site. In other aspects of this embodiment, an A-spacer is positioned between, e.g., a translocation element and a therapeutic element, a translocation element and a binding element, a translocation element and an exogenous protease cleavage site.
[0094]In another aspect, the invention is drawn to recombinant single-chain modified clostridial neurotoxins that may be cleaved at will by a protease to provide an active di-chain molecule. Such modified neurotoxins need not be toxic; in certain of these proteins the enzymatic activity of the toxin L chain may be abrogated, and the toxin joined to a drug or other bioactive agent having therapeutic activity. Alternatively, in certain other modified neurotoxins the L chain is enzymatically active, but portions of the H chain are modified to provide specificity to target cells other than the natural target of the neurotoxin, while maintaining the translocation and endocytosis-stimulating activities of the native toxin. Modified neurotoxins such as those described in this aspect of the invention are disclosed in, for example, Dolly et al., Modified Clostridial Toxins for Use as Transport Proteins, International Patent Publication WO 95/32738 (Dec. 7, 1995); Foster et al., Botulinum Toxin Derivatives Able to Modify Peripheral Sensory Afferent Functions, International Patent Publication WO96/33273 (Oct. 24, 1996); Shone et al., Recombinant Toxin Fragments, International Patent Application WO 98/07864 (98/07864); and Duggan and Chaddock, Conjugates of Galactose-Binding Lectins and Clostridial Neurotoxins as Analgesics, International Patent Publication WO 99/17806 (Apr. 15, 1999); Dolly et al., Compositions and Methods for Extending the Action of Clostridial Neurotoxin, International Patent Publication WO 99/55359 (Nov. 4, 1999); Keith A. Foster et al., Clostridial Toxin Derivatives Able To Modify Peripheral Sensory Afferent Functions, U.S. Pat. No. 5,989,545 (Nov. 23, 1999); Clifford C. Shone et al., Recombinant Toxin Fragments, U.S. Pat. No. 6,461,617 (Oct. 8, 2002); Conrad P. Quinn et al., Methods and Compounds for the Treatment of Mucus Hypersecretion, U.S. Pat. No. 6,632,440 (Oct. 14, 2003); Lance E. Steward et al., Methods And Compositions For The Treatment Of Pancreatitis, U.S. Pat. No. 6,843,998 (Jan. 18, 2005); Stephan Donovan, Clostridial Toxin Derivatives and Methods For Treating Pain, U.S. Pat. No. 7,138,127 (Nov. 21, 2006); Keith A. Foster et al., Inhibition of Secretion from Non-Neural Cells, U.S. Patent Publication 2003/0180289 (Sep. 25, 2003); these publications are incorporated by reference herein. The present invention provides single-chain, cleavable versions of these molecules and improved methods of making such molecules.
[0095]In another aspect, the invention comprises a modified clostridial neurotoxin derived from tetanus toxin (TeNT), or one or more of the botulinum toxin (BONT) subtypes in which the naturally-occurring interchain loop region has been replace with a modified loop region comprising a different amino acid sequence conferring 1) resistance to cleavage by host proteases or autolytic action, and/or 2) lability to a selected protease. Preferably the cleavage site is highly specific for the selected protease. The interchain loop region of certain clostridial neurotoxins, for example, BoNT/E, is naturally resistant to proteolytic cleavage in vivo. This protease resistance may reflect a secondary or tertiary structure that makes the loop more resistant to indigenous proteases than other clostridial neurotoxins. In one embodiment of the present invention, therefore, the inter-chain loop region of BoNT/E is substituted for the natural loop region occurring an another BoNT having greater therapeutic activity or duration of action, for example BoNT/A or /B. In another embodiment of the invention the loop region of BoNT/E is modified to contain a proteolytic cleavage site highly specific to a selected protease prior to the subcloning. The otherwise highly conserved BoNT/E loop region would be resistant to indigenous proteases, or those encountered within a human, but would retain the ability to be activated by digestion with the selected protease.
[0096]Unless indicated otherwise, the following terms have the following meanings in this specification:
[0097]The "therapeutic element" of the present invention may comprise, without limitation: active or inactive (i.e., modified) hormone receptors (such as androgen, estrogen, retinoid, perioxysome proliferator and ecdysone receptors etc.), and hormone-agonists and antagonists, nucleic acids capable being of being used as replication, transcription, or translational templates (e.g., for expression of a protein drug having the desired biological activity or for synthesis of a nucleic acid drug as an antisense agent), enzymes, toxins (including apoptosis-inducing or -preventing agents), and the like.
[0098]In a preferred embodiment, the therapeutic element is a polypeptide comprising a clostridial neurotoxin light chain or a portion thereof retaining the SNARE-protein sequence-specific endopeptidase activity of a clostridial neurotoxin light chain. The amino acid sequences of the light chain of botulinum neurotoxin (BONT) subtypes A-G have been determined, as has the amino acid sequence of the light chains of the tetanus neurotoxin (TeNT), Baratii neurotoxin (BaNT), and butyricum neurotoxin (BuNT). Each chain contains the Zn++-binding motif His-Glu-Xaa-Xaa-His (SEQ ID NO: 66).
[0099]Recent studies of the BoNT/A light chain have revealed certain features important for the activity and specificity of the toxin towards its target substrate, SNAP-25. Thus, studies by Zhou et al. Biochemistry 34:15175-15181 (1995) have indicated that when the light chain amino acid residue His227 is substituted with tyrosine, the resulting polypeptide is unable to cleave SNAP-25; Kurazono et al., J. Biol. Chem. 14721-14729 (1992) performed studies in the presynaptic cholinergic neurons of the buccal ganglia of Aplysia californica using recombinant BoNT/A light chain that indicated that the removal of 8 N-terminal or 32 C-terminal residues did not abolish toxicity, but that removal of 10 N-terminal or 57 C-terminal residues abolished toxicity in this system. Most recently, the crystal structure of the entire BoNT/A holotoxin has been solved; the active site is indicated as involving the participation of His222, Glu223, His226, Glu26, and Tyr365. Lacy et al., supra. (These residues correspond to His223, Glu224, His227, Glu262 and Tyr366 of the BoNT/A L chain of Kurazono et al., supra.) Interestingly, an alignment of BoNT/A through E and TeNT light chains reveals that every such chain invariably has these residues in positions analogous to BoNT/A. Kurazono et al., supra.
[0100]The catalytic domain of BoNT/A is very specific for the C-terminus of SNAP-25 and appears to require a minimum of 17 SNAP-25 amino acids for cleavage to occur. The catalytic site resembles a pocket; when the light chained is linked to the heavy chain via the disulfide bond between Cys429 and Cys453, the translocation domain of the heavy chain appears to block access to the catalytic pocket until the light chain gains entry to the cytosol. When the disulfide bond is then reduced, the catalytic pocket is "opened" and the light chain is fully active.
[0101]The substrate specificities of the various clostridial neurotoxin light chains other than BoNT/A are known. As described above, VAMP and syntaxin are cleaved by BoNT/B, D, F, G and TeNT, and BoNT/C1, respectively, while SNAP-25 is cleaved by BoNT/A E and C1. Therefore, the person of ordinary skill in the art could easily determine the toxin residues essential in these subtypes for cleavage and substrate recognition (for example, by site-directed mutagenesis or deletion of various regions of the toxin molecule followed by testing of proteolytic activity and substrate specificity), and could therefore easily design variants of the native neurotoxin light chain that retain or lack the same or similar activity.
[0102]Aspects of the present invention provide, in part, a Clostridial toxin enzymatic domain. As used herein, the term "Clostridial toxin enzymatic domain" means any Clostridial toxin polypeptide that can execute the enzymatic target modification step of the intoxication process. Thus, a Clostridial toxin enzymatic domain specifically targets a Clostridial toxin substrate and encompasses the proteolytic cleavage of a Clostridial toxin substrate, such as, e.g., SNARE proteins like a SNAP-25 substrate, a VAMP substrate and a Syntaxin substrate. Non-limiting examples of a Clostridial toxin enzymatic domain include, e.g., a BoNT/A enzymatic domain, a BoNT/B enzymatic domain, a BoNT/C1 enzymatic domain, a BoNT/D enzymatic domain, a BoNT/E enzymatic domain, a BoNT/F enzymatic domain, a BoNT/G enzymatic domain, a TeNT enzymatic domain, a BaNT enzymatic domain, and a BuNT enzymatic domain. Other non-limiting examples of a Clostridial toxin enzymatic domain include, e.g., amino acids 1-448 of SEQ ID NO: 1, amino acids 1-441 of SEQ ID NO: 2, amino acids 1-449 of SEQ ID NO: 3, amino acids 1-445 of SEQ ID NO: 4, amino acids 1-422 of SEQ ID NO: 5, amino acids 1-439 of SEQ ID NO: 6, amino acids 1-446 of SEQ ID NO: 7, amino acids 1-457 of SEQ ID NO: 8, amino acids 1-431 of SEQ ID NO: 9, and amino acids 1-422 of SEQ ID NO: 10.
[0103]A Clostridial toxin enzymatic domain includes, without limitation, naturally occurring Clostridial toxin enzymatic domain variants, such as, e.g., Clostridial toxin enzymatic domain isoforms and Clostridial toxin enzymatic domain subtypes; non-naturally occurring Clostridial toxin enzymatic domain variants, such as, e.g., conservative Clostridial toxin enzymatic domain variants, non-conservative Clostridial toxin enzymatic domain variants, Clostridial toxin enzymatic domain chimerics, active Clostridial toxin enzymatic domain fragments thereof, or any combination thereof.
[0104]As used herein, the term "Clostridial toxin enzymatic domain variant," whether naturally-occurring or non-naturally-occurring, means a Clostridial toxin enzymatic domain that has at least one amino acid change from the corresponding region of the disclosed reference sequences (Table 1) and can be described in percent identity to the corresponding region of that reference sequence. Unless expressly indicated, all Clostridial toxin enzymatic domain variants disclosed in the present specification are capable of executing the enzymatic target modification step of the intoxication process. As non-limiting examples, a BoNT/A enzymatic domain variant comprising amino acids 1-448 of SEQ ID NO: 1 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1-448 of SEQ ID NO: 1; a BoNT/B enzymatic domain variant comprising amino acids 1-441 of SEQ ID NO: 2 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1-441 of SEQ ID NO: 2; a BoNT/C1 enzymatic domain variant comprising amino acids 1-449 of SEQ ID NO: 3 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1-449 of SEQ ID NO: 3; a BoNT/D enzymatic domain variant comprising amino acids 1-445 of SEQ ID NO: 4 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1-445 of SEQ ID NO: 4; a BoNT/E enzymatic domain variant comprising amino acids 1-422 of SEQ ID NO: 5 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1-422 of SEQ ID NO: 5; a BoNT/F enzymatic domain variant comprising amino acids 1-439 of SEQ ID NO: 6 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1-439 of SEQ ID NO: 6; a BoNT/G enzymatic domain variant comprising amino acids 1-446 of SEQ ID NO: 7 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1-446 of SEQ ID NO: 7; and a TeNT enzymatic domain variant comprising amino acids 1-457 of SEQ ID NO: 8 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1-457 of SEQ ID NO: 8.
[0105]It is recognized by those of skill in the art that within each serotype of Clostridial toxin there can be naturally occurring Clostridial toxin enzymatic domain variants that differ somewhat in their amino acid sequence, and also in the nucleic acids encoding these proteins. For example, there are presently four BoNT/A subtypes, BoNT/A1, BoNT/A2, BoNT/A3 and BoNT/A4, with specific enzymatic domain subtypes showing approximately 95% amino acid identity when compared to another BoNT/A enzymatic domain subtype. As used herein, the term "naturally occurring Clostridial toxin enzymatic domain variant" means any Clostridial toxin enzymatic domain produced by a naturally-occurring process, including, without limitation, Clostridial toxin enzymatic domain isoforms produced from alternatively-spliced transcripts, Clostridial toxin enzymatic domain isoforms produced by spontaneous mutation and Clostridial toxin enzymatic domain subtypes. A naturally occurring Clostridial toxin enzymatic domain variant can function in substantially the same manner as the reference Clostridial toxin enzymatic domain on which the naturally occurring Clostridial toxin enzymatic domain variant is based, and can be substituted for the reference Clostridial toxin enzymatic domain in any aspect of the present invention. A naturally occurring Clostridial toxin enzymatic domain variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, ten or more amino acids, 20 or more amino acids, 30 or more amino acids, 40 or more amino acids, 50 or more amino acids or 100 or more amino acids from the reference Clostridial toxin enzymatic domain on which the naturally occurring Clostridial toxin enzymatic domain variant is based. A naturally occurring Clostridial toxin enzymatic domain variant can also substitute at least 10 contiguous amino acids, at least 15 contiguous amino acids, at least 20 contiguous amino acids, or at least 25 contiguous amino acids from the reference Clostridial toxin enzymatic domain on which the naturally occurring Clostridial toxin enzymatic domain variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference Clostridial toxin enzymatic domain on which the naturally occurring Clostridial toxin enzymatic domain variant is based.
[0106]A non-limiting examples of a naturally occurring Clostridial toxin enzymatic domain variant is a Clostridial toxin enzymatic domain isoform such as, e.g., a BoNT/A enzymatic domain isoform, a BoNT/B enzymatic domain isoform, a BoNT/C1 enzymatic domain isoform, a BoNT/D enzymatic domain isoform, a BoNT/E enzymatic domain isoform, a BoNT/F enzymatic domain isoform, a BoNT/G enzymatic domain isoform, and a TeNT enzymatic domain isoform. A Clostridial toxin enzymatic domain isoform can function in substantially the same manner as the reference Clostridial toxin enzymatic domain on which the Clostridial toxin enzymatic domain isoform is based, and can be substituted for the reference Clostridial toxin enzymatic domain in any aspect of the present invention.
[0107]Another non-limiting examples of a naturally occurring Clostridial toxin enzymatic domain variant is a Clostridial toxin enzymatic domain subtype such as, e.g., a enzymatic domain from subtype BoNT/A1, BoNT/A2, BoNT/A3 and BoNT/A4; a enzymatic domain from subtype BoNT/B1, BoNT/B2, BoNT/B bivalent and BoNT/B nonproteolytic; a enzymatic domain from subtype BoNT/C1-1 and BoNT/C1-2; a enzymatic domain from subtype BoNT/E1, BoNT/E2 and BoNT/E3; and a enzymatic domain from subtype BoNT/F1, BoNT/F2, BoNT/F3 and BoNT/F4. A Clostridial toxin enzymatic domain subtype can function in substantially the same manner as the reference Clostridial toxin enzymatic domain on which the Clostridial toxin enzymatic domain subtype is based, and can be substituted for the reference Clostridial toxin enzymatic domain in any aspect of the present invention.
[0108]As used herein, the term "non-naturally occurring Clostridial toxin enzymatic domain variant" means any Clostridial toxin enzymatic domain produced with the aid of human manipulation, including, without limitation, Clostridial toxin enzymatic domains produced by genetic engineering using random mutagenesis or rational design and Clostridial toxin enzymatic domains produced by chemical synthesis. Non-limiting examples of non-naturally occurring Clostridial toxin enzymatic domain variants include, e.g., conservative Clostridial toxin enzymatic domain variants, non-conservative Clostridial toxin enzymatic domain variants, Clostridial toxin enzymatic domain chimeric variants and active Clostridial toxin enzymatic domain fragments.
[0109]As used herein, the term "conservative Clostridial toxin enzymatic domain variant" means a Clostridial toxin enzymatic domain that has at least one amino acid substituted by another amino acid or an amino acid analog that has at least one property similar to that of the original amino acid from the reference Clostridial toxin enzymatic domain sequence (Table 1). Examples of properties include, without limitation, similar size, topography, charge, hydrophobicity, hydrophilicity, lipophilicity, covalent-bonding capacity, hydrogen-bonding capacity, a physicochemical property, of the like, or any combination thereof. A conservative Clostridial toxin enzymatic domain variant can function in substantially the same manner as the reference Clostridial toxin enzymatic domain on which the conservative Clostridial toxin enzymatic domain variant is based, and can be substituted for the reference Clostridial toxin enzymatic domain in any aspect of the present invention. A conservative Clostridial toxin enzymatic domain variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, ten or more amino acids, 20 or more amino acids, 30 or more amino acids, 40 or more amino acids, 50 or more amino acids, 100 or more amino acids, 200 or more amino acids, 300 or more amino acids, 400 or more amino acids, or 500 or more amino acids from the reference Clostridial toxin enzymatic domain on which the conservative Clostridial toxin enzymatic domain variant is based. A conservative Clostridial toxin enzymatic domain variant can also substitute at least 10 contiguous amino acids, at least 15 contiguous amino acids, at least 20 contiguous amino acids, or at least 25 contiguous amino acids from the reference Clostridial toxin enzymatic domain on which the conservative Clostridial toxin enzymatic domain variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference Clostridial toxin enzymatic domain on which the conservative Clostridial toxin enzymatic domain variant is based. Non-limiting examples of a conservative Clostridial toxin enzymatic domain variant include, e.g., conservative BoNT/A enzymatic domain variants, conservative BoNT/B enzymatic domain variants, conservative BoNT/C1 enzymatic domain variants, conservative BoNT/D enzymatic domain variants, conservative BoNT/E enzymatic domain variants, conservative BoNT/F enzymatic domain variants, conservative BoNT/G enzymatic domain variants, and conservative TeNT enzymatic domain variants.
[0110]As used herein, the term "non-conservative Clostridial toxin enzymatic domain variant" means a Clostridial toxin enzymatic domain in which 1) at least one amino acid is deleted from the reference Clostridial toxin enzymatic domain on which the non-conservative Clostridial toxin enzymatic domain variant is based; 2) at least one amino acid added to the reference Clostridial toxin enzymatic domain on which the non-conservative Clostridial toxin enzymatic domain is based; or 3) at least one amino acid is substituted by another amino acid or an amino acid analog that does not share any property similar to that of the original amino acid from the reference Clostridial toxin enzymatic domain sequence (Table 1). A non-conservative Clostridial toxin enzymatic domain variant can function in substantially the same manner as the reference Clostridial toxin enzymatic domain on which the non-conservative Clostridial toxin enzymatic domain variant is based, and can be substituted for the reference Clostridial toxin enzymatic domain in any aspect of the present invention. A non-conservative Clostridial toxin enzymatic domain variant can delete one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, and ten or more amino acids from the reference Clostridial toxin enzymatic domain on which the non-conservative Clostridial toxin enzymatic domain variant is based. A non-conservative Clostridial toxin enzymatic domain variant can add one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, and ten or more amino acids to the reference Clostridial toxin enzymatic domain on which the non-conservative Clostridial toxin enzymatic domain variant is based. A non-conservative Clostridial toxin enzymatic domain variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, ten or more amino acids, 20 or more amino acids, 30 or more amino acids, 40 or more amino acids, 50 or more amino acids, 100 or more amino acids, 200 or more amino acids, 300 or more amino acids, 400 or more amino acids, or 500 or more amino acids from the reference Clostridial toxin enzymatic domain on which the non-conservative Clostridial toxin enzymatic domain variant is based. A non-conservative Clostridial toxin enzymatic domain variant can also substitute at least 10 contiguous amino acids, at least 15 contiguous amino acids, at least 20 contiguous amino acids, or at least 25 contiguous amino acids from the reference Clostridial toxin enzymatic domain on which the non-conservative Clostridial toxin enzymatic domain variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference Clostridial toxin enzymatic domain on which the non-conservative Clostridial toxin enzymatic domain variant is based. Non-limiting examples of a non-conservative Clostridial toxin enzymatic domain variant include, e.g., non-conservative BoNT/A enzymatic domain variants, non-conservative BoNT/B enzymatic domain variants, non-conservative BoNT/C1 enzymatic domain variants, non-conservative BoNT/D enzymatic domain variants, non-conservative BoNT/E enzymatic domain variants, non-conservative BoNT/F enzymatic domain variants, non-conservative BoNT/G enzymatic domain variants, and non-conservative TeNT enzymatic domain variants.
[0111]As used herein, the term "Clostridial toxin enzymatic domain chimeric" means a polypeptide comprising at least a portion of a Clostridial toxin enzymatic domain and at least a portion of at least one other polypeptide to form a toxin enzymatic domain with at least one property different from the reference Clostridial toxin enzymatic domains of Table 1, with the proviso that this Clostridial toxin enzymatic domain chimeric is still capable of specifically targeting the core components of the neurotransmitter release apparatus and thus participate in executing the overall cellular mechanism whereby a Clostridial toxin proteolytically cleaves a substrate. Such Clostridial toxin enzymatic domain chimerics are described in, e.g., Lance E. Steward et al., Leucine-based Motif and Clostridial Toxins, U.S. Patent Publication 2003/0027752 (Feb. 6, 2003); Lance E. Steward et al., Clostridial Neurotoxin Compositions and Modified Clostridial Neurotoxins, U.S. Patent Publication 2003/0219462 (Nov. 27, 2003); and Lance E. Steward et al., Clostridial Neurotoxin Compositions and Modified Clostridial Neurotoxins, U.S. Patent Publication 2004/0220386 (Nov. 4, 2004), each of which is incorporated by reference in its entirety.
[0112]As used herein, the term "active Clostridial toxin enzymatic domain fragment" means any of a variety of Clostridial toxin fragments comprising the enzymatic domain can be useful in aspects of the present invention with the proviso that these enzymatic domain fragments can specifically target the core components of the neurotransmitter release apparatus and thus participate in executing the overall cellular mechanism whereby a Clostridial toxin proteolytically cleaves a substrate. The enzymatic domains of Clostridial toxins are approximately 420-460 amino acids in length and comprise an enzymatic domain (Table 1). Research has shown that the entire length of a Clostridial toxin enzymatic domain is not necessary for the enzymatic activity of the enzymatic domain. As a non-limiting example, the first eight amino acids of the BoNT/A enzymatic domain (residues 1-8 of SEQ ID NO: 1) are not required for enzymatic activity. As another non-limiting example, the first eight amino acids of the TeNT enzymatic domain (residues 1-8 of SEQ ID NO: 8) are not required for enzymatic activity. Likewise, the carboxyl-terminus of the enzymatic domain is not necessary for activity. As a non-limiting example, the last 32 amino acids of the BoNT/A enzymatic domain (residues 417-448 of SEQ ID NO: 1) are not required for enzymatic activity. As another non-limiting example, the last 31 amino acids of the TeNT enzymatic domain (residues 427-457 of SEQ ID NO: 8) are not required for enzymatic activity. Thus, aspects of this embodiment can include Clostridial toxin enzymatic domains comprising an enzymatic domain having a length of, e.g., at least 350 amino acids, at least 375 amino acids, at least 400 amino acids, at least 425 amino acids and at least 450 amino acids. Other aspects of this embodiment can include Clostridial toxin enzymatic domains comprising an enzymatic domain having a length of, e.g., at most 350 amino acids, at most 375 amino acids, at most 400 amino acids, at most 425 amino acids and at most 450 amino acids.
[0113]Any of a variety of sequence alignment methods can be used to determine percent identity of naturally-occurring Clostridial toxin enzymatic domain variants and non-naturally-occurring Clostridial toxin enzymatic domain variants, including, without limitation, global methods, local methods and hybrid methods, such as, e.g., segment approach methods. Protocols to determine percent identity are routine procedures within the scope of one skilled in the art and from the teaching herein.
[0114]Global methods align sequences from the beginning to the end of the molecule and determine the best alignment by adding up scores of individual residue pairs and by imposing gap penalties. Non-limiting methods include, e.g., CLUSTAL W, see, e.g., Julie D. Thompson et al., CLUSTAL W: Improving the Sensitivity of Progressive Multiple Sequence Alignment Through Sequence Weighting, Position-Specific Gap Penalties and Weight Matrix Choice, 22(22) Nucleic Acids Research 4673-4680 (1994); and iterative refinement, see, e.g., Osamu Gotoh, Significant Improvement in Accuracy of Multiple Protein Sequence Alignments by Iterative Refinement as Assessed by Reference to Structural Alignments, 264(4) J. Mol. Biol. 823-838 (1996).
[0115]Local methods align sequences by identifying one or more conserved motifs shared by all of the input sequences. Non-limiting methods include, e.g., Match-box, see, e.g., Eric Depiereux and Ernest Feytmans, Match-Box: A Fundamentally New Algorithm for the Simultaneous Alignment of Several Protein Sequences, 8(5) CABIOS 501-509 (1992); Gibbs sampling, see, e.g., C. E. Lawrence et al., Detecting Subtle Sequence Signals: A Gibbs Sampling Strategy for Multiple Alignment, 262(5131) Science 208-214 (1993); Align-M, see, e.g., Ivo Van Walle et al., Align-M--A New Algorithm for Multiple Alignment of Highly Divergent Sequences, 20(9) Bioinformatics: 1428-1435 (2004).
[0116]Hybrid methods combine functional aspects of both global and local alignment methods. Non-limiting methods include, e.g., segment-to-segment comparison, see, e.g., Burkhard Morgenstern et al., Multiple DNA and Protein Sequence Alignment Based On Segment-To-Segment Comparison, 93(22) Proc. Natl. Acad. Sci. U.S.A. 12098-12103 (1996); T-Coffee, see, e.g., Cedric Notredame et al., T-Coffee: A Novel Algorithm for Multiple Sequence Alignment, 302(1) J. Mol. Biol. 205-217 (2000); MUSCLE, see, e.g., Robert C. Edgar, MUSCLE: Multiple Sequence Alignment With High Score Accuracy and High Throughput, 32(5) Nucleic Acids Res. 1792-1797 (2004); and DIALIGN-T, see, e.g., Amarendran R Subramanian et al., DIALIGN-T: An Improved Algorithm for Segment-Based Multiple Sequence Alignment, 6(1) BMC Bioinformatics 66 (2005).
[0117]Thus, in an embodiment, a modified Clostridial toxin disclosed in the present specification comprises a Clostridial toxin enzymatic domain. In an aspect of this embodiment, a Clostridial toxin enzymatic domain comprises a naturally occurring Clostridial toxin enzymatic domain variant, such as, e.g., a Clostridial toxin enzymatic domain isoform or a Clostridial toxin enzymatic domain subtype. In another aspect of this embodiment, a Clostridial toxin enzymatic domain comprises a non-naturally occurring Clostridial toxin enzymatic domain variant, such as, e.g., a conservative Clostridial toxin enzymatic domain variant, a non-conservative Clostridial toxin enzymatic domain variant, a Clostridial toxin chimeric enzymatic domain, an active Clostridial toxin enzymatic domain fragment, or any combination thereof.
[0118]In another embodiment, a Clostridial toxin enzymatic domain comprises a BoNT/A enzymatic domain. In an aspect of this embodiment, a BoNT/A enzymatic domain comprises amino acids 1-448 of SEQ ID NO: 1. In another aspect of this embodiment, a BoNT/A enzymatic domain comprises a naturally occurring BoNT/A enzymatic domain variant, such as, e.g., a enzymatic domain from a BoNT/A isoform or a enzymatic domain from a BoNT/A subtype. In another aspect of this embodiment, a BoNT/A enzymatic domain comprises amino acids 1-448 of a naturally occurring BoNT/A enzymatic domain variant of SEQ ID NO: 1, such as, e.g., amino acids 1-448 of a BoNT/A isoform of SEQ ID NO: 1 or amino acids 1-448 of a BoNT/A subtype of SEQ ID NO: 1. In still another aspect of this embodiment, a BoNT/A enzymatic domain comprises a non-naturally occurring BoNT/A enzymatic domain variant, such as, e.g., a conservative BoNT/A enzymatic domain variant, a non-conservative BoNT/A enzymatic domain variant, a BoNT/A chimeric enzymatic domain, an active BoNT/A enzymatic domain fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/A enzymatic domain comprises amino acids 1-448 of a non-naturally occurring BoNT/A enzymatic domain variant of SEQ ID NO: 1, such as, e.g., amino acids 1-448 of a conservative BoNT/A enzymatic domain variant of SEQ ID NO: 1, amino acids 1-448 of a non-conservative BoNT/A enzymatic domain variant of SEQ ID NO: 1, amino acids 1-448 of an active BoNT/A enzymatic domain fragment of SEQ ID NO: 1, or any combination thereof.
[0119]In other aspects of this embodiment, a BoNT/A enzymatic domain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1-448 of SEQ ID NO: 1, at least 75% amino acid identity with amino acids 1-448 of SEQ ID NO: 1, at least 80% amino acid identity with amino acids 1-448 of SEQ ID NO: 1, at least 85% amino acid identity with amino acids 1-448 of SEQ ID NO: 1, at least 90% amino acid identity with amino acids 1-448 of SEQ ID NO: 1 or at least 95% amino acid identity with amino acids 1-448 of SEQ ID NO: 1. In yet other aspects of this embodiment, a BoNT/A enzymatic domain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1-448 of SEQ ID NO: 1, at most 75% amino acid identity with amino acids 1-448 of SEQ ID NO: 1, at most 80% amino acid identity with amino acids 1-448 of SEQ ID NO: 1, at most 85% amino acid identity with amino acids 1-448 of SEQ ID NO: 1, at most 90% amino acid identity with amino acids 1-448 of SEQ ID NO: 1 or at most 95% amino acid identity with amino acids 1-448 of SEQ ID NO: 1.
[0120]In other aspects of this embodiment, a BoNT/A enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 1-448 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 1-448 of SEQ ID NO: 1. In yet other aspects of this embodiment, a BoNT/A enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-448 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-448 of SEQ ID NO: 1. In still other aspects of this embodiment, a BoNT/A enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-448 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-448 of SEQ ID NO: 1.
[0121]In other aspects of this embodiment, a BoNT/A enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-448 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-448 of SEQ ID NO: 1. In yet other aspects of this embodiment, a BoNT/A enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-448 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-448 of SEQ ID NO: 1. In still other aspects of this embodiment, a BoNT/A enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-448 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-448 of SEQ ID NO: 1.
[0122]In another embodiment, a Clostridial toxin enzymatic domain comprises a BoNT/B enzymatic domain. In an aspect of this embodiment, a BoNT/B enzymatic domain comprises amino acids 1-441 of SEQ ID NO: 2. In another aspect of this embodiment, a BoNT/B enzymatic domain comprises a naturally occurring BoNT/B enzymatic domain variant, such as, e.g., a enzymatic domain from a BoNT/B isoform or a enzymatic domain from a BoNT/B subtype. In another aspect of this embodiment, a BoNT/B enzymatic domain comprises amino acids 1-441 of a naturally occurring BoNT/B enzymatic domain variant of SEQ ID NO: 2, such as, e.g., amino acids 1-441 of a BoNT/β isoform of SEQ ID NO: 2 or amino acids 1-441 of a BoNT/B subtype of SEQ ID NO: 2. In still another aspect of this embodiment, a BoNT/B enzymatic domain comprises a non-naturally occurring BoNT/B enzymatic domain variant, such as, e.g., a conservative BoNT/B enzymatic domain variant, a non-conservative BoNT/B enzymatic domain variant, a BoNT/B chimeric enzymatic domain, an active BoNT/B enzymatic domain fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/B enzymatic domain comprises amino acids 1-441 of a non-naturally occurring BoNT/B enzymatic domain variant of SEQ ID NO: 2, such as, e.g., amino acids 1-441 of a conservative BoNT/B enzymatic domain variant of SEQ ID NO: 2, amino acids 1-441 of a non-conservative BoNT/B enzymatic domain variant of SEQ ID NO: 2, amino acids 1-441 of an active BoNT/B enzymatic domain fragment of SEQ ID NO: 2, or any combination thereof.
[0123]In other aspects of this embodiment, a BoNT/B enzymatic domain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1-441 of SEQ ID NO: 2, at least 75% amino acid identity with amino acids 1-441 of SEQ ID NO: 2, at least 80% amino acid identity with amino acids 1-441 of SEQ ID NO: 2, at least 85% amino acid identity with amino acids 1-441 of SEQ ID NO: 2, at least 90% amino acid identity with amino acids 1-441 of SEQ ID NO: 2 or at least 95% amino acid identity with amino acids 1-441 of SEQ ID NO: 2. In yet other aspects of this embodiment, a BoNT/B enzymatic domain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1-441 of SEQ ID NO: 2, at most 75% amino acid identity with amino acids 1-441 of SEQ ID NO: 2, at most 80% amino acid identity with amino acids 1-441 of SEQ ID NO: 2, at most 85% amino acid identity with amino acids 1-441 of SEQ ID NO: 2, at most 90% amino acid identity with amino acids 1-441 of SEQ ID NO: 2 or at most 95% amino acid identity with amino acids 1-441 of SEQ ID NO: 2.
[0124]In other aspects of this embodiment, a BoNT/B enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 1-441 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 1-441 of SEQ ID NO: 2. In yet other aspects of this embodiment, a BoNT/B enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-441 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-441 of SEQ ID NO: 2. In still other aspects of this embodiment, a BoNT/B enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-441 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-441 of SEQ ID NO: 2.
[0125]In other aspects of this embodiment, a BoNT/B enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-441 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-441 of SEQ ID NO: 2. In yet other aspects of this embodiment, a BoNT/B enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-441 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-441 of SEQ ID NO: 2. In still other aspects of this embodiment, a BoNT/B enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-441 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-441 of SEQ ID NO: 2.
[0126]In another embodiment, a Clostridial toxin enzymatic domain comprises a BoNT/C1 enzymatic domain. In an aspect of this embodiment, a BoNT/C1 enzymatic domain comprises amino acids 1-449 of SEQ ID NO: 3. In another aspect of this embodiment, a BoNT/C1 enzymatic domain comprises a naturally occurring BoNT/C1 enzymatic domain variant, such as, e.g., a enzymatic domain from a BoNT/C1 isoform or a enzymatic domain from a BoNT/C1 subtype. In another aspect of this embodiment, a BoNT/C1 enzymatic domain comprises amino acids 1-449 of a naturally occurring BoNT/C1 enzymatic domain variant of SEQ ID NO: 3, such as, e.g., amino acids 1-449 of a BoNT/C1 isoform of SEQ ID NO: 3 or amino acids 1-449 of a BoNT/C1 subtype of SEQ ID NO: 3. In still another aspect of this embodiment, a BoNT/C1 enzymatic domain comprises a non-naturally occurring BoNT/C1 enzymatic domain variant, such as, e.g., a conservative BoNT/C1 enzymatic domain variant, a non-conservative BoNT/C1 enzymatic domain variant, a BoNT/C1 chimeric enzymatic domain, an active BoNT/C1 enzymatic domain fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/C1 enzymatic domain comprises amino acids 1-449 of a non-naturally occurring BoNT/C1 enzymatic domain variant of SEQ ID NO: 3, such as, e.g., amino acids 1-449 of a conservative BoNT/C1 enzymatic domain variant of SEQ ID NO: 3, amino acids 1-449 of a non-conservative BoNT/C1 enzymatic domain variant of SEQ ID NO: 3, amino acids 1-449 of an active BoNT/C1 enzymatic domain fragment of SEQ ID NO: 3, or any combination thereof.
[0127]In other aspects of this embodiment, a BoNT/C1 enzymatic domain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1-449 of SEQ ID NO: 3, at least 75% amino acid identity with amino acids 1-449 of SEQ ID NO: 3, at least 80% amino acid identity with amino acids 1-449 of SEQ ID NO: 3, at least 85% amino acid identity with amino acids 1-449 of SEQ ID NO: 3, at least 90% amino acid identity with amino acids 1-449 of SEQ ID NO: 3 or at least 95% amino acid identity with amino acids 1-449 of SEQ ID NO: 3. In yet other aspects of this embodiment, a BoNT/C1 enzymatic domain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1-449 of SEQ ID NO: 3, at most 75% amino acid identity with amino acids 1-449 of SEQ ID NO: 3, at most 80% amino acid identity with amino acids 1-449 of SEQ ID NO: 3, at most 85% amino acid identity with amino acids 1-449 of SEQ ID NO: 3, at most 90% amino acid identity with amino acids 1-449 of SEQ ID NO: 3 or at most 95% amino acid identity with amino acids 1-449 of SEQ ID NO: 3.
[0128]In other aspects of this embodiment, a BoNT/C1 enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 1-449 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 1-449 of SEQ ID NO: 3. In yet other aspects of this embodiment, a BoNT/C1 enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-449 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-449 of SEQ ID NO: 3. In still other aspects of this embodiment, a BoNT/C1 enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-449 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-449 of SEQ ID NO: 3.
[0129]In other aspects of this embodiment, a BoNT/C1 enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-449 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-449 of SEQ ID NO: 3. In yet other aspects of this embodiment, a BoNT/C1 enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-449 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-449 of SEQ ID NO: 3. In still other aspects of this embodiment, a BoNT/C1 enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-449 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-449 of SEQ ID NO: 3.
[0130]In another embodiment, a Clostridial toxin enzymatic domain comprises a BoNT/D enzymatic domain. In an aspect of this embodiment, a BoNT/D enzymatic domain comprises amino acids 1-445 of SEQ ID NO: 4. In another aspect of this embodiment, a BoNT/D enzymatic domain comprises a naturally occurring BoNT/D enzymatic domain variant, such as, e.g., a enzymatic domain from a BoNT/D isoform or a enzymatic domain from a BoNT/D subtype. In another aspect of this embodiment, a BoNT/D enzymatic domain comprises amino acids 1-445 of a naturally occurring BoNT/D enzymatic domain variant of SEQ ID NO: 4, such as, e.g., amino acids 1-445 of a BoNT/D isoform of SEQ ID NO: 4 or amino acids 1-445 of a BoNT/D subtype of SEQ ID NO: 4. In still another aspect of this embodiment, a BoNT/D enzymatic domain comprises a non-naturally occurring BoNT/D enzymatic domain variant, such as, e.g., a conservative BoNT/D enzymatic domain variant, a non-conservative BoNT/D enzymatic domain variant, a BoNT/D chimeric enzymatic domain, an active BoNT/D enzymatic domain fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/D enzymatic domain comprises amino acids 1-445 of a non-naturally occurring BoNT/D enzymatic domain variant of SEQ ID NO: 4, such as, e.g., amino acids 1-445 of a conservative BoNT/D enzymatic domain variant of SEQ ID NO: 4, amino acids 1-445 of a non-conservative BoNT/D enzymatic domain variant of SEQ ID NO: 4, amino acids 1-445 of an active BoNT/D enzymatic domain fragment of SEQ ID NO: 4, or any combination thereof.
[0131]In other aspects of this embodiment, a BoNT/D enzymatic domain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1-445 of SEQ ID NO: 4, at least 75% amino acid identity with amino acids 1-445 of SEQ ID NO: 4, at least 80% amino acid identity with amino acids 1-445 of SEQ ID NO: 4, at least 85% amino acid identity with amino acids 1-445 of SEQ ID NO: 4, at least 90% amino acid identity with amino acids 1-445 of SEQ ID NO: 4 or at least 95% amino acid identity with amino acids 1-445 of SEQ ID NO: 4. In yet other aspects of this embodiment, a BoNT/D enzymatic domain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1-445 of SEQ ID NO: 4, at most 75% amino acid identity with amino acids 1-445 of SEQ ID NO: 4, at most 80% amino acid identity with amino acids 1-445 of SEQ ID NO: 4, at most 85% amino acid identity with amino acids 1-445 of SEQ ID NO: 4, at most 90% amino acid identity with amino acids 1-445 of SEQ ID NO: 4 or at most 95% amino acid identity with amino acids 1-445 of SEQ ID NO: 4.
[0132]In other aspects of this embodiment, a BoNT/D enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 1-445 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 1-445 of SEQ ID NO: 4. In yet other aspects of this embodiment, a BoNT/D enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-445 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-445 of SEQ ID NO: 4. In still other aspects of this embodiment, a BoNT/D enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-445 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-445 of SEQ ID NO: 4.
[0133]In other aspects of this embodiment, a BoNT/D enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-445 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-445 of SEQ ID NO: 4. In yet other aspects of this embodiment, a BoNT/D enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-445 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-445 of SEQ ID NO: 4. In still other aspects of this embodiment, a BoNT/D enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-445 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-445 of SEQ ID NO: 4.
[0134]In another embodiment, a Clostridial toxin enzymatic domain comprises a BoNT/E enzymatic domain. In an aspect of this embodiment, a BoNT/E enzymatic domain comprises amino acids 1-422 of SEQ ID NO: 5. In another aspect of this embodiment, a BoNT/E enzymatic domain comprises a naturally occurring BoNT/E enzymatic domain variant, such as, e.g., a enzymatic domain from a BoNT/E isoform or a enzymatic domain from a BoNT/E subtype. In another aspect of this embodiment, a BoNT/E enzymatic domain comprises amino acids 1-422 of a naturally occurring BoNT/E enzymatic domain variant of SEQ ID NO: 5, such as, e.g., amino acids 1-422 of a BoNT/E isoform of SEQ ID NO: 5 or amino acids 1-422 of a BoNT/E subtype of SEQ ID NO: 5. In still another aspect of this embodiment, a BoNT/E enzymatic domain comprises a non-naturally occurring BoNT/E enzymatic domain variant, such as, e.g., a conservative BoNT/E enzymatic domain variant, a non-conservative BoNT/E enzymatic domain variant, a BoNT/E chimeric enzymatic domain, an active BoNT/E enzymatic domain fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/E enzymatic domain comprises amino acids 1-422 of a non-naturally occurring BoNT/E enzymatic domain variant of SEQ ID NO: 5, such as, e.g., amino acids 1-422 of a conservative BoNT/E enzymatic domain variant of SEQ ID NO: 5, amino acids 1-422 of a non-conservative BoNT/E enzymatic domain variant of SEQ ID NO: 5, amino acids 1-422 of an active BoNT/E enzymatic domain fragment of SEQ ID NO: 5, or any combination thereof.
[0135]In other aspects of this embodiment, a BoNT/E enzymatic domain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1-422 of SEQ ID NO: 5, at least 75% amino acid identity with amino acids 1-422 of SEQ ID NO: 5, at least 80% amino acid identity with amino acids 1-422 of SEQ ID NO: 5, at least 85% amino acid identity with amino acids 1-422 of SEQ ID NO: 5, at least 90% amino acid identity with amino acids 1-422 of SEQ ID NO: 5 or at least 95% amino acid identity with amino acids 1-422 of SEQ ID NO: 5. In yet other aspects of this embodiment, a BoNT/E enzymatic domain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1-422 of SEQ ID NO: 5, at most 75% amino acid identity with amino acids 1-422 of SEQ ID NO: 5, at most 80% amino acid identity with amino acids 1-422 of SEQ ID NO: 5, at most 85% amino acid identity with amino acids 1-422 of SEQ ID NO: 5, at most 90% amino acid identity with amino acids 1-422 of SEQ ID NO: 5 or at most 95% amino acid identity with amino acids 1-422 of SEQ ID NO: 5.
[0136]In other aspects of this embodiment, a BoNT/E enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 1-422 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 1-422 of SEQ ID NO: 5. In yet other aspects of this embodiment, a BoNT/E enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-422 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-422 of SEQ ID NO: 5. In still other aspects of this embodiment, a BoNT/E enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-422 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-422 of SEQ ID NO: 5.
[0137]In other aspects of this embodiment, a BoNT/E enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-422 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-422 of SEQ ID NO: 5. In yet other aspects of this embodiment, a BoNT/E enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-422 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-422 of SEQ ID NO: 5. In still other aspects of this embodiment, a BoNT/E enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-422 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-422 of SEQ ID NO: 5.
[0138]In another embodiment, a Clostridial toxin enzymatic domain comprises a BoNT/F enzymatic domain. In an aspect of this embodiment, a BoNT/F enzymatic domain comprises amino acids 1-439 of SEQ ID NO: 6. In another aspect of this embodiment, a BoNT/F enzymatic domain comprises a naturally occurring BoNT/F enzymatic domain variant, such as, e.g., a enzymatic domain from a BoNT/F isoform or a enzymatic domain from a BoNT/F subtype. In another aspect of this embodiment, a BoNT/F enzymatic domain comprises amino acids 1-439 of a naturally occurring BoNT/F enzymatic domain variant of SEQ ID NO: 6, such as, e.g., amino acids 1-439 of a BoNT/F isoform of SEQ ID NO: 6 or amino acids 1-439 of a BoNT/F subtype of SEQ ID NO: 6. In still another aspect of this embodiment, a BoNT/F enzymatic domain comprises a non-naturally occurring BoNT/F enzymatic domain variant, such as, e.g., a conservative BoNT/F enzymatic domain variant, a non-conservative BoNT/F enzymatic domain variant, a BoNT/F chimeric enzymatic domain, an active BoNT/F enzymatic domain fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/F enzymatic domain comprises amino acids 1-439 of a non-naturally occurring BoNT/F enzymatic domain variant of SEQ ID NO: 6, such as, e.g., amino acids 1-439 of a conservative BoNT/F enzymatic domain variant of SEQ ID NO: 6, amino acids 1-439 of a non-conservative BoNT/F enzymatic domain variant of SEQ ID NO: 6, amino acids 1-439 of an active BoNT/F enzymatic domain fragment of SEQ ID NO: 6, or any combination thereof.
[0139]In other aspects of this embodiment, a BoNT/F enzymatic domain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1-439 of SEQ ID NO: 6, at least 75% amino acid identity with amino acids 1-439 of SEQ ID NO: 6, at least 80% amino acid identity with amino acids 1-439 of SEQ ID NO: 6, at least 85% amino acid identity with amino acids 1-439 of SEQ ID NO: 6, at least 90% amino acid identity with amino acids 1-439 of SEQ ID NO: 6 or at least 95% amino acid identity with amino acids 1-439 of SEQ ID NO: 6. In yet other aspects of this embodiment, a BoNT/F enzymatic domain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1-439 of SEQ ID NO: 6, at most 75% amino acid identity with amino acids 1-439 of SEQ ID NO: 6, at most 80% amino acid identity with amino acids 1-439 of SEQ ID NO: 6, at most 85% amino acid identity with amino acids 1-439 of SEQ ID NO: 6, at most 90% amino acid identity with amino acids 1-439 of SEQ ID NO: 6 or at most 95% amino acid identity with amino acids 1-439 of SEQ ID NO: 6.
[0140]In other aspects of this embodiment, a BoNT/F enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 1-439 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 1-439 of SEQ ID NO: 6. In yet other aspects of this embodiment, a BoNT/F enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-439 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-439 of SEQ ID NO: 6. In still other aspects of this embodiment, a BoNT/F enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-439 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-439 of SEQ ID NO: 6.
[0141]In other aspects of this embodiment, a BoNT/F enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-439 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-439 of SEQ ID NO: 6. In yet other aspects of this embodiment, a BoNT/F enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-439 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-439 of SEQ ID NO: 6. In still other aspects of this embodiment, a BoNT/F enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-439 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-439 of SEQ ID NO: 6.
[0142]In another embodiment, a Clostridial toxin enzymatic domain comprises a BoNT/G enzymatic domain. In an aspect of this embodiment, a BoNT/G enzymatic domain comprises amino acids 1-446 of SEQ ID NO: 7. In another aspect of this embodiment, a BoNT/G enzymatic domain comprises a naturally occurring BoNT/G enzymatic domain variant, such as, e.g., a enzymatic domain from a BoNT/G isoform or a enzymatic domain from a BoNT/G subtype. In another aspect of this embodiment, a BoNT/G enzymatic domain comprises amino acids 1-446 of a naturally occurring BoNT/G enzymatic domain variant of SEQ ID NO: 7, such as, e.g., amino acids 1-446 of a BoNT/G isoform of SEQ ID NO: 7 or amino acids 1-446 of a BoNT/G subtype of SEQ ID NO: 7. In still another aspect of this embodiment, a BoNT/G enzymatic domain comprises a non-naturally occurring BoNT/G enzymatic domain variant, such as, e.g., a conservative BoNT/G enzymatic domain variant, a non-conservative BoNT/G enzymatic domain variant, a BoNT/G chimeric enzymatic domain, an active BoNT/G enzymatic domain fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/G enzymatic domain comprises amino acids 1-446 of a non-naturally occurring BoNT/G enzymatic domain variant of SEQ ID NO: 7, such as, e.g., amino acids 1-446 of a conservative BoNT/G enzymatic domain variant of SEQ ID NO: 7, amino acids 1-446 of a non-conservative BoNT/G enzymatic domain variant of SEQ ID NO: 7, amino acids 1-446 of an active BoNT/G enzymatic domain fragment of SEQ ID NO: 7, or any combination thereof.
[0143]In other aspects of this embodiment, a BoNT/G enzymatic domain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1-446 of SEQ ID NO: 7, at least 75% amino acid identity with amino acids 1-446 of SEQ ID NO: 7, at least 80% amino acid identity with amino acids 1-446 of SEQ ID NO: 7, at least 85% amino acid identity with amino acids 1-446 of SEQ ID NO: 7, at least 90% amino acid identity with amino acids 1-446 of SEQ ID NO: 7 or at least 95% amino acid identity with amino acids 1-446 of SEQ ID NO: 7. In yet other aspects of this embodiment, a BoNT/G enzymatic domain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1-446 of SEQ ID NO: 7, at most 75% amino acid identity with amino acids 1-446 of SEQ ID NO: 7, at most 80% amino acid identity with amino acids 1-446 of SEQ ID NO: 7, at most 85% amino acid identity with amino acids 1-446 of SEQ ID NO: 7, at most 90% amino acid identity with amino acids 1-446 of SEQ ID NO: 7 or at most 95% amino acid identity with amino acids 1-446 of SEQ ID NO: 7.
[0144]In other aspects of this embodiment, a BoNT/G enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 1-446 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 1-446 of SEQ ID NO: 7. In yet other aspects of this embodiment, a BoNT/G enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-446 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-446 of SEQ ID NO: 7. In still other aspects of this embodiment, a BoNT/G enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-446 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-446 of SEQ ID NO: 7.
[0145]In other aspects of this embodiment, a BoNT/G enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-446 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-446 of SEQ ID NO: 7. In yet other aspects of this embodiment, a BoNT/G enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-446 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-446 of SEQ ID NO: 7. In still other aspects of this embodiment, a BoNT/G enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-446 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-446 of SEQ ID NO: 7.
[0146]In another embodiment, a Clostridial toxin enzymatic domain comprises a TeNT enzymatic domain. In an aspect of this embodiment, a TeNT enzymatic domain comprises amino acids 1-457 of SEQ ID NO: 8. In another aspect of this embodiment, a TeNT enzymatic domain comprises a naturally occurring TeNT enzymatic domain variant, such as, e.g., a enzymatic domain from a TeNT isoform or a enzymatic domain from a TeNT subtype. In another aspect of this embodiment, a TeNT enzymatic domain comprises amino acids 1-457 of a naturally occurring TeNT enzymatic domain variant of SEQ ID NO: 8, such as, e.g., amino acids 1-457 of a TeNT isoform of SEQ ID NO: 8 or amino acids 1-457 of a TeNT subtype of SEQ ID NO: 8. In still another aspect of this embodiment, a TeNT enzymatic domain comprises a non-naturally occurring TeNT enzymatic domain variant, such as, e.g., a conservative TeNT enzymatic domain variant, a non-conservative TeNT enzymatic domain variant, a TeNT chimeric enzymatic domain, an active TeNT enzymatic domain fragment, or any combination thereof. In still another aspect of this embodiment, a TeNT enzymatic domain comprises amino acids 1-457 of a non-naturally occurring TeNT enzymatic domain variant of SEQ ID NO: 8, such as, e.g., amino acids 1-457 of a conservative TeNT enzymatic domain variant of SEQ ID NO: 8, amino acids 1-457 of a non-conservative TeNT enzymatic domain variant of SEQ ID NO: 8, amino acids 1-457 of an active TeNT enzymatic domain fragment of SEQ ID NO: 8, or any combination thereof.
[0147]In other aspects of this embodiment, a TeNT enzymatic domain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1-457 of SEQ ID NO: 8, at least 75% amino acid identity with amino acids 1-457 of SEQ ID NO: 8, at least 80% amino acid identity with amino acids 1-457 of SEQ ID NO: 8, at least 85% amino acid identity with amino acids 1-457 of SEQ ID NO: 8, at least 90% amino acid identity with amino acids 1-457 of SEQ ID NO: 8 or at least 95% amino acid identity with amino acids 1-457 of SEQ ID NO: 8. In yet other aspects of this embodiment, a TeNT enzymatic domain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1-457 of SEQ ID NO: 8, at most 75% amino acid identity with amino acids 1-457 of SEQ ID NO: 8, at most 80% amino acid identity with amino acids 1-457 of SEQ ID NO: 8, at most 85% amino acid identity with amino acids 1-457 of SEQ ID NO: 8, at most 90% amino acid identity with amino acids 1-457 of SEQ ID NO: 8 or at most 95% amino acid identity with amino acids 1-457 of SEQ ID NO: 8.
[0148]In other aspects of this embodiment, a TeNT enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 1-457 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 1-457 of SEQ ID NO: 8. In yet other aspects of this embodiment, a TeNT enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-457 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-457 of SEQ ID NO: 8. In still other aspects of this embodiment, a TeNT enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-457 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-457 of SEQ ID NO: 8.
[0149]In other aspects of this embodiment, a TeNT enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-457 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-457 of SEQ ID NO: 8. In yet other aspects of this embodiment, a TeNT enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-457 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-457 of SEQ ID NO: 8. In still other aspects of this embodiment, a TeNT enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-457 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-457 of SEQ ID NO: 8.
[0150]In another embodiment, a Clostridial toxin enzymatic domain comprises a BaNT enzymatic domain. In an aspect of this embodiment, a BaNT enzymatic domain comprises amino acids 1-431 of SEQ ID NO: 9. In another aspect of this embodiment, a BaNT enzymatic domain comprises a naturally occurring BaNT enzymatic domain variant, such as, e.g., a enzymatic domain from a BaNT isoform or a enzymatic domain from a BaNT subtype. In another aspect of this embodiment, a BaNT enzymatic domain comprises amino acids 1-431 of a naturally occurring BaNT enzymatic domain variant of SEQ ID NO: 9, such as, e.g., amino acids 1-431 of a BaNT isoform of SEQ ID NO: 9 or amino acids 1-431 of a BaNT subtype of SEQ ID NO: 9. In still another aspect of this embodiment, a BaNT enzymatic domain comprises a non-naturally occurring BaNT enzymatic domain variant, such as, e.g., a conservative BaNT enzymatic domain variant, a non-conservative BaNT enzymatic domain variant, a BaNT chimeric enzymatic domain, an active BaNT enzymatic domain fragment, or any combination thereof. In still another aspect of this embodiment, a BaNT enzymatic domain comprises amino acids 1-431 of a non-naturally occurring BaNT enzymatic domain variant of SEQ ID NO: 9, such as, e.g., amino acids 1-431 of a conservative BaNT enzymatic domain variant of SEQ ID NO: 9, amino acids 1-431 of a non-conservative BaNT enzymatic domain variant of SEQ ID NO: 9, amino acids 1-431 of an active BaNT enzymatic domain fragment of SEQ ID NO: 9, or any combination thereof.
[0151]In other aspects of this embodiment, a BaNT enzymatic domain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1-431 of SEQ ID NO: 9, at least 75% amino acid identity with amino acids 1-431 of SEQ ID NO: 9, at least 80% amino acid identity with amino acids 1-431 of SEQ ID NO: 9, at least 85% amino acid identity with amino acids 1-431 of SEQ ID NO: 9, at least 90% amino acid identity with amino acids 1-431 of SEQ ID NO: 9 or at least 95% amino acid identity with amino acids 1-431 of SEQ ID NO: 9. In yet other aspects of this embodiment, a BaNT enzymatic domain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1-431 of SEQ ID NO: 9, at most 75% amino acid identity with amino acids 1-431 of SEQ ID NO: 9, at most 80% amino acid identity with amino acids 1-431 of SEQ ID NO: 9, at most 85% amino acid identity with amino acids 1-431 of SEQ ID NO: 9, at most 90% amino acid identity with amino acids 1-431 of SEQ ID NO: 9 or at most 95% amino acid identity with amino acids 1-431 of SEQ ID NO: 9.
[0152]In other aspects of this embodiment, a BaNT enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 1-431 of SEQ ID NO: 9. In other aspects of this embodiment, a BaNT enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 1-431 of SEQ ID NO: 9. In yet other aspects of this embodiment, a BaNT enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-431 of SEQ ID NO: 9. In other aspects of this embodiment, a BaNT enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-431 of SEQ ID NO: 9. In still other aspects of this embodiment, a BaNT enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-431 of SEQ ID NO: 9. In other aspects of this embodiment, a BaNT enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-431 of SEQ ID NO: 9.
[0153]In other aspects of this embodiment, a BaNT enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-431 of SEQ ID NO: 9. In other aspects of this embodiment, a BaNT enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-431 of SEQ ID NO: 9. In yet other aspects of this embodiment, a BaNT enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-431 of SEQ ID NO: 9. In other aspects of this embodiment, a BaNT enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-431 of SEQ ID NO: 9. In still other aspects of this embodiment, a BaNT enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-431 of SEQ ID NO: 9. In other aspects of this embodiment, a BaNT enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-431 of SEQ ID NO: 9.
[0154]In another embodiment, a Clostridial toxin enzymatic domain comprises a BuNT enzymatic domain. In an aspect of this embodiment, a BuNT enzymatic domain comprises amino acids 1-422 of SEQ ID NO: 10. In another aspect of this embodiment, a BuNT enzymatic domain comprises a naturally occurring BuNT enzymatic domain variant, such as, e.g., a enzymatic domain from a BuNT isoform or a enzymatic domain from a BuNT subtype. In another aspect of this embodiment, a BuNT enzymatic domain comprises amino acids 1-422 of a naturally occurring BuNT enzymatic domain variant of SEQ ID NO: 10, such as, e.g., amino acids 1-422 of a BuNT isoform of SEQ ID NO: 10 or amino acids 1-422 of a BuNT subtype of SEQ ID NO: 10. In still another aspect of this embodiment, a BuNT enzymatic domain comprises a non-naturally occurring BuNT enzymatic domain variant, such as, e.g., a conservative BuNT enzymatic domain variant, a non-conservative BuNT enzymatic domain variant, a BuNT chimeric enzymatic domain, an active BuNT enzymatic domain fragment, or any combination thereof. In still another aspect of this embodiment, a BuNT enzymatic domain comprises amino acids 1-422 of a non-naturally occurring BuNT enzymatic domain variant of SEQ ID NO: 10, such as, e.g., amino acids 1-422 of a conservative BuNT enzymatic domain variant of SEQ ID NO: 10, amino acids 1-422 of a non-conservative BuNT enzymatic domain variant of SEQ ID NO: 10, amino acids 1-422 of an active BuNT enzymatic domain fragment of SEQ ID NO: 10, or any combination thereof.
[0155]In other aspects of this embodiment, a BuNT enzymatic domain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1-422 of SEQ ID NO: 10, at least 75% amino acid identity with amino acids 1-422 of SEQ ID NO: 10, at least 80% amino acid identity with amino acids 1-422 of SEQ ID NO: 10, at least 85% amino acid identity with amino acids 1-422 of SEQ ID NO: 10, at least 90% amino acid identity with amino acids 1-422 of SEQ ID NO: 10 or at least 95% amino acid identity with amino acids 1-422 of SEQ ID NO: 10. In yet other aspects of this embodiment, a BuNT enzymatic domain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1-422 of SEQ ID NO: 10, at most 75% amino acid identity with amino acids 1-422 of SEQ ID NO: 10, at most 80% amino acid identity with amino acids 1-422 of SEQ ID NO: 10, at most 85% amino acid identity with amino acids 1-422 of SEQ ID NO: 10, at most 90% amino acid identity with amino acids 1-422 of SEQ ID NO: 10 or at most 95% amino acid identity with amino acids 1-422 of SEQ ID NO: 10.
[0156]In other aspects of this embodiment, a BuNT enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 1-422 of SEQ ID NO: 10. In other aspects of this embodiment, a BuNT enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 1-422 of SEQ ID NO: 10. In yet other aspects of this embodiment, a BuNT enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-422 of SEQ ID NO: 10. In other aspects of this embodiment, a BuNT enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-422 of SEQ ID NO: 10. In still other aspects of this embodiment, a BuNT enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-422 of SEQ ID NO: 10. In other aspects of this embodiment, a BuNT enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-422 of SEQ ID NO: 10.
[0157]In other aspects of this embodiment, a BuNT enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-422 of SEQ ID NO: 10. In other aspects of this embodiment, a BuNT enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-422 of SEQ ID NO: 10. In yet other aspects of this embodiment, a BuNT enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-422 of SEQ ID NO: 10. In other aspects of this embodiment, a BuNT enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-422 of SEQ ID NO: 10. In still other aspects of this embodiment, a BuNT enzymatic domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-422 of SEQ ID NO: 10. In other aspects of this embodiment, a BuNT enzymatic domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-422 of SEQ ID NO: 10.
[0158]The "translocation element" comprises a portion of a clostridial neurotoxin heavy chain having a translocation activity. By "translocation" is meant the ability to facilitate the transport of a polypeptide through a vesicular membrane, thereby exposing some or all of the polypeptide to the cytoplasm. In the various botulinum neurotoxins translocation is thought to involve an allosteric conformational change of the heavy chain caused by a decrease in pH within the endosome. This conformational change appears to involve and be mediated by the N terminal half of the heavy chain and to result in the formation of pores in the vesicular membrane; this change permits the movement of the proteolytic light chain from within the endosomal vesicle into the cytoplasm. See e.g., Lacy, et al., Nature Struct. Biol. 5:898-902 (October 1998).
[0159]The amino acid sequence of the translocation-mediating portion of the botulinum neurotoxin heavy chain is known to those of skill in the art; additionally, those amino acid residues within this portion that are known to be essential for conferring the translocation activity are also known. It would therefore be well within the ability of one of ordinary skill in the art, for example, to employ the naturally occurring N-terminal peptide half of the heavy chain of any of the various Clostridium tetanus or Clostridium botulinum neurotoxin subtypes as a translocation element, or to design an analogous translocation element by aligning the primary sequences of the N-terminal halves of the various heavy chains and selecting a consensus primary translocation sequence based on conserved amino acid, polarity, steric and hydrophobicity characteristics between the sequences.
[0160]Aspects of the present invention provide, in part, a Clostridial toxin translocation domain. As used herein, the term "Clostridial toxin translocation domain" means any Clostridial toxin polypeptide that can execute the translocation step of the intoxication process that mediates Clostridial toxin light chain translocation. Thus, a Clostridial toxin translocation domain facilitates the movement of a Clostridial toxin light chain across a membrane and encompasses the movement of a Clostridial toxin light chain through the membrane an intracellular vesicle into the cytoplasm of a cell. Non-limiting examples of a Clostridial toxin translocation domain include, e.g., a BoNT/A translocation domain, a BoNT/B translocation domain, a BoNT/C1 translocation domain, a BoNT/D translocation domain, a BoNT/E translocation domain, a BoNT/F translocation domain, a BoNT/G translocation domain, a TeNT translocation domain, a BaNT translocation domain, and a BuNT translocation domain. Other non-limiting examples of a Clostridial toxin translocation domain include, e.g., amino acids 449-873 of SEQ ID NO: 1, amino acids 442-860 of SEQ ID NO: 2, amino acids 450-868 of SEQ ID NO: 3, amino acids 446-864 of SEQ ID NO: 4, amino acids 423-847 of SEQ ID NO: 5, amino acids 440-866 of SEQ ID NO: 6, amino acids 447-865 of SEQ ID NO: 7, amino acids 458-881 of SEQ ID NO: 8, amino acids 432-857 of SEQ ID NO: 9, and amino acids 423-847 of SEQ ID NO: 10.
[0161]A Clostridial toxin translocation domain includes, without limitation, naturally occurring Clostridial toxin translocation domain variants, such as, e.g., Clostridial toxin translocation domain isoforms and Clostridial toxin translocation domain subtypes; non-naturally occurring Clostridial toxin translocation domain variants, such as, e.g., conservative Clostridial toxin translocation domain variants, non-conservative Clostridial toxin translocation domain variants, Clostridial toxin translocation domain chimerics, active Clostridial toxin translocation domain fragments thereof, or any combination thereof.
[0162]As used herein, the term "Clostridial toxin translocation domain variant," whether naturally-occurring or non-naturally-occurring, means a Clostridial toxin translocation domain that has at least one amino acid change from the corresponding region of the disclosed reference sequences (Table 1) and can be described in percent identity to the corresponding region of that reference sequence. Unless expressly indicated, all Clostridial toxin translocation domain variants disclosed in the present specification are capable of executing the translocation step of the intoxication process that mediates Clostridial toxin light chain translocation. As non-limiting examples, a BoNT/A translocation domain variant comprising amino acids 449-873 of SEQ ID NO: 1 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 449-873 of SEQ ID NO: 1; a BoNT/B translocation domain variant comprising amino acids 442-860 of SEQ ID NO: 2 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 442-860 of SEQ ID NO: 2; a BoNT/C1 translocation domain variant comprising amino acids 450-868 of SEQ ID NO: 3 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 450-868 of SEQ ID NO: 3; a BoNT/D translocation domain variant comprising amino acids 446-864 of SEQ ID NO: 4 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 446-864 of SEQ ID NO: 4; a BoNT/E translocation domain variant comprising amino acids 423-847 of SEQ ID NO: 5 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 423-847 of SEQ ID NO: 5; a BoNT/F translocation domain variant comprising amino acids 440-866 of SEQ ID NO: 6 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 440-866 of SEQ ID NO: 6; a BoNT/G translocation domain variant comprising amino acids 447-865 of SEQ ID NO: 7 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 447-865 of SEQ ID NO: 7; a TeNT translocation domain variant comprising amino acids 458-881 of SEQ ID NO: 8 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 458-881 of SEQ ID NO: 8; a BaNT translocation domain variant comprising amino acids 432-857 of SEQ ID NO: 9 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 432-857 of SEQ ID NO: 9; and a BuNT translocation domain variant comprising amino acids 423-847 of SEQ ID NO: 10 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 423-847 of SEQ ID NO: 10.
[0163]It is recognized by those of skill in the art that within each serotype of Clostridial toxin there can be naturally occurring Clostridial toxin translocation domain variants that differ somewhat in their amino acid sequence, and also in the nucleic acids encoding these proteins. For example, there are presently four BoNT/A subtypes, BoNT/A1, BoNT/A2, BoNT/A3 and BoNT/A4, with specific translocation domain subtypes showing approximately 87% amino acid identity when compared to another BoNT/A translocation domain subtype. As used herein, the term "naturally occurring Clostridial toxin translocation domain variant" means any Clostridial toxin translocation domain produced by a naturally-occurring process, including, without limitation, Clostridial toxin translocation domain isoforms produced from alternatively-spliced transcripts, Clostridial toxin translocation domain isoforms produced by spontaneous mutation and Clostridial toxin translocation domain subtypes. A naturally occurring Clostridial toxin translocation domain variant can function in substantially the same manner as the reference Clostridial toxin translocation domain on which the naturally occurring Clostridial toxin translocation domain variant is based, and can be substituted for the reference Clostridial toxin translocation domain in any aspect of the present invention. A naturally occurring Clostridial toxin translocation domain variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, ten or more amino acids, 20 or more amino acids, 30 or more amino acids, 40 or more amino acids, 50 or more amino acids or 100 or more amino acids from the reference Clostridial toxin translocation domain on which the naturally occurring Clostridial toxin translocation domain variant is based. A naturally occurring Clostridial toxin translocation domain variant can also substitute at least 10 contiguous amino acids, at least 15 contiguous amino acids, at least 20 contiguous amino acids, or at least 25 contiguous amino acids from the reference Clostridial toxin translocation domain on which the naturally occurring Clostridial toxin translocation domain variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference Clostridial toxin translocation domain on which the naturally occurring Clostridial toxin translocation domain variant is based.
[0164]A non-limiting examples of a naturally occurring Clostridial toxin translocation domain variant is a Clostridial toxin translocation domain isoform such as, e.g., a BoNT/A translocation domain isoform, a BoNT/B translocation domain isoform, a BoNT/C1 translocation domain isoform, a BoNT/D translocation domain isoform, a BoNT/E translocation domain isoform, a BoNT/F translocation domain isoform, a BoNT/G translocation domain isoform, a TeNT translocation domain isoform, a BaNT translocation domain isoform, and a BuNT translocation domain isoform. A Clostridial toxin translocation domain isoform can function in substantially the same manner as the reference Clostridial toxin translocation domain on which the Clostridial toxin translocation domain isoform is based, and can be substituted for the reference Clostridial toxin translocation domain in any aspect of the present invention.
[0165]Another non-limiting examples of a naturally occurring Clostridial toxin translocation domain variant is a Clostridial toxin translocation domain subtype such as, e.g., a translocation domain from subtype BoNT/A1, BoNT/A2, BoNT/A3 and BoNT/A4; a translocation domain from subtype BoNT/B1, BoNT/B2, BoNT/B bivalent and BoNT/B nonproteolytic; a translocation domain from subtype BoNT/C1-1 and BoNT/C1-2; a translocation domain from subtype BoNT/E1, BoNT/E2 and BoNT/E3; and a translocation domain from subtype BoNT/F1, BoNT/F2, BoNT/F3 and BoNT/F4. A Clostridial toxin translocation domain subtype can function in substantially the same manner as the reference Clostridial toxin translocation domain on which the Clostridial toxin translocation domain subtype is based, and can be substituted for the reference Clostridial toxin translocation domain in any aspect of the present invention.
[0166]As used herein, the term "non-naturally occurring Clostridial toxin translocation domain variant" means any Clostridial toxin translocation domain produced with the aid of human manipulation, including, without limitation, Clostridial toxin translocation domains produced by genetic engineering using random mutagenesis or rational design and Clostridial toxin translocation domains produced by chemical synthesis. Non-limiting examples of non-naturally occurring Clostridial toxin translocation domain variants include, e.g., conservative Clostridial toxin translocation domain variants, non-conservative Clostridial toxin translocation domain variants, Clostridial toxin translocation domain chimeric variants and active Clostridial toxin translocation domain fragments.
[0167]As used herein, the term "conservative Clostridial toxin translocation domain variant" means a Clostridial toxin translocation domain that has at least one amino acid substituted by another amino acid or an amino acid analog that has at least one property similar to that of the original amino acid from the reference Clostridial toxin translocation domain sequence (Table 1). Examples of properties include, without limitation, similar size, topography, charge, hydrophobicity, hydrophilicity, lipophilicity, covalent-bonding capacity, hydrogen-bonding capacity, a physicochemical property, of the like, or any combination thereof. A conservative Clostridial toxin translocation domain variant can function in substantially the same manner as the reference Clostridial toxin translocation domain on which the conservative Clostridial toxin translocation domain variant is based, and can be substituted for the reference Clostridial toxin translocation domain in any aspect of the present invention. A conservative Clostridial toxin translocation domain variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, ten or more amino acids, 20 or more amino acids, 30 or more amino acids, 40 or more amino acids, 50 or more amino acids, 100 or more amino acids, 200 or more amino acids, 300 or more amino acids, 400 or more amino acids, or 500 or more amino acids from the reference Clostridial toxin translocation domain on which the conservative Clostridial toxin translocation domain variant is based. A conservative Clostridial toxin translocation domain variant can also substitute at least 10 contiguous amino acids, at least 15 contiguous amino acids, at least 20 contiguous amino acids, or at least 25 contiguous amino acids from the reference Clostridial toxin translocation domain on which the conservative Clostridial toxin translocation domain variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference Clostridial toxin translocation domain on which the conservative Clostridial toxin translocation domain variant is based. Non-limiting examples of a conservative Clostridial toxin translocation domain variant include, e.g., conservative BoNT/A translocation domain variants, conservative BoNT/B translocation domain variants, conservative BoNT/C1 translocation domain variants, conservative BoNT/D translocation domain variants, conservative BoNT/E translocation domain variants, conservative BoNT/F translocation domain variants, conservative BoNT/G translocation domain variants, conservative TeNT translocation domain variants, conservative BaNT translocation domain variants, and conservative BuNT translocation domain variants.
[0168]As used herein, the term "non-conservative Clostridial toxin translocation domain variant" means a Clostridial toxin translocation domain in which 1) at least one amino acid is deleted from the reference Clostridial toxin translocation domain on which the non-conservative Clostridial toxin translocation domain variant is based; 2) at least one amino acid added to the reference Clostridial toxin translocation domain on which the non-conservative Clostridial toxin translocation domain is based; or 3) at least one amino acid is substituted by another amino acid or an amino acid analog that does not share any property similar to that of the original amino acid from the reference Clostridial toxin translocation domain sequence (Table 1). A non-conservative Clostridial toxin translocation domain variant can function in substantially the same manner as the reference Clostridial toxin translocation domain on which the non-conservative Clostridial toxin translocation domain variant is based, and can be substituted for the reference Clostridial toxin translocation domain in any aspect of the present invention. A non-conservative Clostridial toxin translocation domain variant can delete one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, and ten or more amino acids from the reference Clostridial toxin translocation domain on which the non-conservative Clostridial toxin translocation domain variant is based. A non-conservative Clostridial toxin translocation domain variant can add one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, and ten or more amino acids to the reference Clostridial toxin translocation domain on which the non-conservative Clostridial toxin translocation domain variant is based. A non-conservative Clostridial toxin translocation domain variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, ten or more amino acids, 20 or more amino acids, 30 or more amino acids, 40 or more amino acids, 50 or more amino acids, 100 or more amino acids, 200 or more amino acids, 300 or more amino acids, 400 or more amino acids, or 500 or more amino acids from the reference Clostridial toxin translocation domain on which the non-conservative Clostridial toxin translocation domain variant is based. A non-conservative Clostridial toxin translocation domain variant can also substitute at least 10 contiguous amino acids, at least 15 contiguous amino acids, at least 20 contiguous amino acids, or at least 25 contiguous amino acids from the reference Clostridial toxin translocation domain on which the non-conservative Clostridial toxin translocation domain variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference Clostridial toxin translocation domain on which the non-conservative Clostridial toxin translocation domain variant is based. Non-limiting examples of a non-conservative Clostridial toxin translocation domain variant include, e.g., non-conservative BoNT/A translocation domain variants, non-conservative BoNT/B translocation domain variants, non-conservative BoNT/C1 translocation domain variants, non-conservative BoNT/D translocation domain variants, non-conservative BoNT/E translocation domain variants, non-conservative BoNT/F translocation domain variants, non-conservative BoNT/G translocation domain variants, and non-conservative TeNT translocation domain variants, non-conservative BaNT translocation domain variants, and non-conservative BuNT translocation domain variants.
[0169]As used herein, the term "Clostridial toxin translocation domain chimeric" means a polypeptide comprising at least a portion of a Clostridial toxin translocation domain and at least a portion of at least one other polypeptide to form a toxin translocation domain with at least one property different from the reference Clostridial toxin translocation domains of Table 1, with the proviso that this Clostridial toxin translocation domain chimeric is still capable of specifically targeting the core components of the neurotransmitter release apparatus and thus participate in executing the overall cellular mechanism whereby a Clostridial toxin proteolytically cleaves a substrate.
[0170]As used herein, the term "active Clostridial toxin translocation domain fragment" means any of a variety of Clostridial toxin fragments comprising the translocation domain can be useful in aspects of the present invention with the proviso that these active fragments can facilitate the release of the LC from intracellular vesicles into the cytoplasm of the target cell and thus participate in executing the overall cellular mechanism whereby a Clostridial toxin proteolytically cleaves a substrate. The translocation domains from the heavy chains of Clostridial toxins are approximately 410-430 amino acids in length and comprise a translocation domain (Table 1). Research has shown that the entire length of a translocation domain from a Clostridial toxin heavy chain is not necessary for the translocating activity of the translocation domain. Thus, aspects of this embodiment can include Clostridial toxin translocation domains comprising a translocation domain having a length of, e.g., at least 350 amino acids, at least 375 amino acids, at least 400 amino acids and at least 425 amino acids. Other aspects of this embodiment can include Clostridial toxin translocation domains comprising translocation domain having a length of, e.g., at most 350 amino acids, at most 375 amino acids, at most 400 amino acids and at most 425 amino acids.
[0171]Any of a variety of sequence alignment methods can be used to determine percent identity of naturally-occurring Clostridial toxin translocation domain variants and non-naturally-occurring Clostridial toxin translocation domain variants, including, without limitation, global methods, local methods and hybrid methods, such as, e.g., segment approach methods. Protocols to determine percent identity are routine procedures within the scope of one skilled in the art and from the teaching herein.
[0172]Thus, in an embodiment, a modified Clostridial toxin disclosed in the present specification comprises a Clostridial toxin translocation domain. In an aspect of this embodiment, a Clostridial toxin translocation domain comprises a naturally occurring Clostridial toxin translocation domain variant, such as, e.g., a Clostridial toxin translocation domain isoform or a Clostridial toxin translocation domain subtype. In another aspect of this embodiment, a Clostridial toxin translocation domain comprises a non-naturally occurring Clostridial toxin translocation domain variant, such as, e.g., a conservative Clostridial toxin translocation domain variant, a non-conservative Clostridial toxin translocation domain variant, a Clostridial toxin chimeric translocation domain, an active Clostridial toxin translocation domain fragment, or any combination thereof.
[0173]In another embodiment, a Clostridial toxin translocation domain comprises a BoNT/A translocation domain. In an aspect of this embodiment, a BoNT/A translocation domain comprises amino acids 449-873 of SEQ ID NO: 1. In another aspect of this embodiment, a BoNT/A translocation domain comprises a naturally occurring BoNT/A translocation domain variant, such as, e.g., a translocation domain from a BoNT/A isoform or a translocation domain from a BoNT/A subtype. In another aspect of this embodiment, a BoNT/A translocation domain comprises amino acids 449-873 of a naturally occurring BoNT/A translocation domain variant of SEQ ID NO: 1, such as, e.g., amino acids 449-873 of a BoNT/A isoform of SEQ ID NO: 1 or amino acids 449-873 of a BoNT/A subtype of SEQ ID NO: 1. In still another aspect of this embodiment, a BoNT/A translocation domain comprises a non-naturally occurring BoNT/A translocation domain variant, such as, e.g., a conservative BoNT/A translocation domain variant, a non-conservative BoNT/A translocation domain variant, a BoNT/A chimeric translocation domain, an active BoNT/A translocation domain fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/A translocation domain comprises amino acids 449-873 of a non-naturally occurring BoNT/A translocation domain variant of SEQ ID NO: 1, such as, e.g., amino acids 449-873 of a conservative BoNT/A translocation domain variant of SEQ ID NO: 1, amino acids 449-873 of a non-conservative BoNT/A translocation domain variant of SEQ ID NO: 1, amino acids 449-873 of an active BoNT/A translocation domain fragment of SEQ ID NO: 1, or any combination thereof.
[0174]In other aspects of this embodiment, a BoNT/A translocation domain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 449-873 of SEQ ID NO: 1, at least 75% amino acid identity with amino acids 449-873 of SEQ ID NO: 1, at least 80% amino acid identity with amino acids 449-873 of SEQ ID NO: 1, at least 85% amino acid identity with amino acids 449-873 of SEQ ID NO: 1, at least 90% amino acid identity with amino acids 449-873 of SEQ ID NO: 1 or at least 95% amino acid identity with amino acids 449-873 of SEQ ID NO: 1. In yet other aspects of this embodiment, a BoNT/A translocation domain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 449-873 of SEQ ID NO: 1, at most 75% amino acid identity with amino acids 449-873 of SEQ ID NO: 1, at most 80% amino acid identity with amino acids 449-873 of SEQ ID NO: 1, at most 85% amino acid identity with amino acids 449-873 of SEQ ID NO: 1, at most 90% amino acid identity with amino acids 449-873 of SEQ ID NO: 1 or at most 95% amino acid identity with amino acids 449-873 of SEQ ID NO: 1.
[0175]In other aspects of this embodiment, a BoNT/A translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 449-873 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 449-873 of SEQ ID NO: 1. In yet other aspects of this embodiment, a BoNT/A translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 449-873 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 449-873 of SEQ ID NO: 1. In still other aspects of this embodiment, a BoNT/A translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 449-873 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 449-873 of SEQ ID NO: 1.
[0176]In other aspects of this embodiment, a BoNT/A translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 449-873 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 449-873 of SEQ ID NO: 1. In yet other aspects of this embodiment, a BoNT/A translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 449-873 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 449-873 of SEQ ID NO: 1. In still other aspects of this embodiment, a BoNT/A translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 449-873 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 449-873 of SEQ ID NO: 1.
[0177]In another embodiment, a Clostridial toxin translocation domain comprises a BoNT/B translocation domain. In an aspect of this embodiment, a BoNT/B translocation domain comprises amino acids 442-860 of SEQ ID NO: 2. In another aspect of this embodiment, a BoNT/B translocation domain comprises a naturally occurring BoNT/B translocation domain variant, such as, e.g., a translocation domain from a BoNT/β isoform or a translocation domain from a BoNT/B subtype. In another aspect of this embodiment, a BoNT/B translocation domain comprises amino acids 442-860 of a naturally occurring BoNT/B translocation domain variant of SEQ ID NO: 2, such as, e.g., amino acids 442-860 of a BoNT/β isoform of SEQ ID NO: 2 or amino acids 442-860 of a BoNT/B subtype of SEQ ID NO: 2. In still another aspect of this embodiment, a BoNT/B translocation domain comprises a non-naturally occurring BoNT/B translocation domain variant, such as, e.g., a conservative BoNT/B translocation domain variant, a non-conservative BoNT/B translocation domain variant, a BoNT/B chimeric translocation domain, an active BoNT/B translocation domain fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/B translocation domain comprises amino acids 442-860 of a non-naturally occurring BoNT/B translocation domain variant of SEQ ID NO: 2, such as, e.g., amino acids 442-860 of a conservative BoNT/B translocation domain variant of SEQ ID NO: 2, amino acids 442-860 of a non-conservative BoNT/B translocation domain variant of SEQ ID NO: 2, amino acids 442-860 of an active BoNT/B translocation domain fragment of SEQ ID NO: 2, or any combination thereof.
[0178]In other aspects of this embodiment, a BoNT/B translocation domain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 442-860 of SEQ ID NO: 2, at least 75% amino acid identity with amino acids 442-860 of SEQ ID NO: 2, at least 80% amino acid identity with amino acids 442-860 of SEQ ID NO: 2, at least 85% amino acid identity with amino acids 442-860 of SEQ ID NO: 2, at least 90% amino acid identity with amino acids 442-860 of SEQ ID NO: 2 or at least 95% amino acid identity with amino acids 442-860 of SEQ ID NO: 2. In yet other aspects of this embodiment, a BoNT/B translocation domain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 442-860 of SEQ ID NO: 2, at most 75% amino acid identity with amino acids 442-860 of SEQ ID NO: 2, at most 80% amino acid identity with amino acids 442-860 of SEQ ID NO: 2, at most 85% amino acid identity with amino acids 442-860 of SEQ ID NO: 2, at most 90% amino acid identity with amino acids 442-860 of SEQ ID NO: 2 or at most 95% amino acid identity with amino acids 442-860 of SEQ ID NO: 2.
[0179]In other aspects of this embodiment, a BoNT/B translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 442-860 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 442-860 of SEQ ID NO: 2. In yet other aspects of this embodiment, a BoNT/B translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 442-860 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 442-860 of SEQ ID NO: 2. In still other aspects of this embodiment, a BoNT/B translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 442-860 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 442-860 of SEQ ID NO: 2.
[0180]In other aspects of this embodiment, a BoNT/B translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 442-860 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 442-860 of SEQ ID NO: 2. In yet other aspects of this embodiment, a BoNT/B translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 442-860 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 442-860 of SEQ ID NO: 2. In still other aspects of this embodiment, a BoNT/B translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 442-860 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 442-860 of SEQ ID NO: 2.
[0181]In another embodiment, a Clostridial toxin translocation domain comprises a BoNT/C1 translocation domain. In an aspect of this embodiment, a BoNT/C1 translocation domain comprises amino acids 450-868 of SEQ ID NO: 3. In another aspect of this embodiment, a BoNT/C1 translocation domain comprises a naturally occurring BoNT/C1 translocation domain variant, such as, e.g., a translocation domain from a BoNT/C1 isoform or a translocation domain from a BoNT/C1 subtype. In another aspect of this embodiment, a BoNT/C1 translocation domain comprises amino acids 450-868 of a naturally occurring BoNT/C1 translocation domain variant of SEQ ID NO: 3, such as, e.g., amino acids 450-868 of a BoNT/C1 isoform of SEQ ID NO: 3 or amino acids 450-868 of a BoNT/C1 subtype of SEQ ID NO: 3. In still another aspect of this embodiment, a BoNT/C1 translocation domain comprises a non-naturally occurring BoNT/C1 translocation domain variant, such as, e.g., a conservative BoNT/C1 translocation domain variant, a non-conservative BoNT/C1 translocation domain variant, a BoNT/C1 chimeric translocation domain, an active BoNT/C1 translocation domain fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/C1 translocation domain comprises amino acids 450-868 of a non-naturally occurring BoNT/C1 translocation domain variant of SEQ ID NO: 3, such as, e.g., amino acids 450-868 of a conservative BoNT/C1 translocation domain variant of SEQ ID NO: 3, amino acids 450-868 of a non-conservative BoNT/C1 translocation domain variant of SEQ ID NO: 3, amino acids 450-868 of an active BoNT/C1 translocation domain fragment of SEQ ID NO: 3, or any combination thereof.
[0182]In other aspects of this embodiment, a BoNT/C1 translocation domain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 450-868 of SEQ ID NO: 3, at least 75% amino acid identity with amino acids 450-868 of SEQ ID NO: 3, at least 80% amino acid identity with amino acids 450-868 of SEQ ID NO: 3, at least 85% amino acid identity with amino acids 450-868 of SEQ ID NO: 3, at least 90% amino acid identity with amino acids 450-868 of SEQ ID NO: 3 or at least 95% amino acid identity with amino acids 450-868 of SEQ ID NO: 3. In yet other aspects of this embodiment, a BoNT/C1 translocation domain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 450-868 of SEQ ID NO: 3, at most 75% amino acid identity with amino acids 450-868 of SEQ ID NO: 3, at most 80% amino acid identity with amino acids 450-868 of SEQ ID NO: 3, at most 85% amino acid identity with amino acids 450-868 of SEQ ID NO: 3, at most 90% amino acid identity with amino acids 450-868 of SEQ ID NO: 3 or at most 95% amino acid identity with amino acids 450-868 of SEQ ID NO: 3.
[0183]In other aspects of this embodiment, a BoNT/C1 translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 450-868 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 450-868 of SEQ ID NO: 3. In yet other aspects of this embodiment, a BoNT/C1 translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 450-868 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 450-868 of SEQ ID NO: 3. In still other aspects of this embodiment, a BoNT/C1 translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 450-868 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 450-868 of SEQ ID NO: 3.
[0184]In other aspects of this embodiment, a BoNT/C1 translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 450-868 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 450-868 of SEQ ID NO: 3. In yet other aspects of this embodiment, a BoNT/C1 translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 450-868 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 450-868 of SEQ ID NO: 3. In still other aspects of this embodiment, a BoNT/C1 translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 450-868 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 450-868 of SEQ ID NO: 3.
[0185]In another embodiment, a Clostridial toxin translocation domain comprises a BoNT/D translocation domain. In an aspect of this embodiment, a BoNT/D translocation domain comprises amino acids 446-864 of SEQ ID NO: 4. In another aspect of this embodiment, a BoNT/D translocation domain comprises a naturally occurring BoNT/D translocation domain variant, such as, e.g., a translocation domain from a BoNT/D isoform or a translocation domain from a BoNT/D subtype. In another aspect of this embodiment, a BoNT/D translocation domain comprises amino acids 446-864 of a naturally occurring BoNT/D translocation domain variant of SEQ ID NO: 4, such as, e.g., amino acids 446-864 of a BoNT/D isoform of SEQ ID NO: 4 or amino acids 446-864 of a BoNT/D subtype of SEQ ID NO: 4. In still another aspect of this embodiment, a BoNT/D translocation domain comprises a non-naturally occurring BoNT/D translocation domain variant, such as, e.g., a conservative BoNT/D translocation domain variant, a non-conservative BoNT/D translocation domain variant, a BoNT/D chimeric translocation domain, an active BoNT/D translocation domain fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/D translocation domain comprises amino acids 446-864 of a non-naturally occurring BoNT/D translocation domain variant of SEQ ID NO: 4, such as, e.g., amino acids 446-864 of a conservative BoNT/D translocation domain variant of SEQ ID NO: 4, amino acids 446-864 of a non-conservative BoNT/D translocation domain variant of SEQ ID NO: 4, amino acids 446-864 of an active BoNT/D translocation domain fragment of SEQ ID NO: 4, or any combination thereof.
[0186]In other aspects of this embodiment, a BoNT/D translocation domain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 446-864 of SEQ ID NO: 4, at least 75% amino acid identity with amino acids 446-864 of SEQ ID NO: 4, at least 80% amino acid identity with amino acids 446-864 of SEQ ID NO: 4, at least 85% amino acid identity with amino acids 446-864 of SEQ ID NO: 4, at least 90% amino acid identity with amino acids 446-864 of SEQ ID NO: 4 or at least 95% amino acid identity with amino acids 446-864 of SEQ ID NO: 4. In yet other aspects of this embodiment, a BoNT/D translocation domain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 446-864 of SEQ ID NO: 4, at most 75% amino acid identity with amino acids 446-864 of SEQ ID NO: 4, at most 80% amino acid identity with amino acids 446-864 of SEQ ID NO: 4, at most 85% amino acid identity with amino acids 446-864 of SEQ ID NO: 4, at most 90% amino acid identity with amino acids 446-864 of SEQ ID NO: 4 or at most 95% amino acid identity with amino acids 446-864 of SEQ ID NO: 4.
[0187]In other aspects of this embodiment, a BoNT/D translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 446-864 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 446-864 of SEQ ID NO: 4. In yet other aspects of this embodiment, a BoNT/D translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 446-864 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 446-864 of SEQ ID NO: 4. In still other aspects of this embodiment, a BoNT/D translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 446-864 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 446-864 of SEQ ID NO: 4.
[0188]In other aspects of this embodiment, a BoNT/D translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 446-864 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 446-864 of SEQ ID NO: 4. In yet other aspects of this embodiment, a BoNT/D translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 446-864 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 446-864 of SEQ ID NO: 4. In still other aspects of this embodiment, a BoNT/D translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 446-864 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 446-864 of SEQ ID NO: 4.
[0189]In another embodiment, a Clostridial toxin translocation domain comprises a BoNT/E translocation domain. In an aspect of this embodiment, a BoNT/E translocation domain comprises amino acids 423-847 of SEQ ID NO: 5. In another aspect of this embodiment, a BoNT/E translocation domain comprises a naturally occurring BoNT/E translocation domain variant, such as, e.g., a translocation domain from a BoNT/E isoform or a translocation domain from a BoNT/E subtype. In another aspect of this embodiment, a BoNT/E translocation domain comprises amino acids 423-847 of a naturally occurring BoNT/E translocation domain variant of SEQ ID NO: 5, such as, e.g., amino acids 423-847 of a BoNT/E isoform of SEQ ID NO: 5 or amino acids 423-847 of a BoNT/E subtype of SEQ ID NO: 5. In still another aspect of this embodiment, a BoNT/E translocation domain comprises a non-naturally occurring BoNT/E translocation domain variant, such as, e.g., a conservative BoNT/E translocation domain variant, a non-conservative BoNT/E translocation domain variant, a BoNT/E chimeric translocation domain, an active BoNT/E translocation domain fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/E translocation domain comprises amino acids 423-847 of a non-naturally occurring BoNT/E translocation domain variant of SEQ ID NO: 5, such as, e.g., amino acids 423-847 of a conservative BoNT/E translocation domain variant of SEQ ID NO: 5, amino acids 423-847 of a non-conservative BoNT/E translocation domain variant of SEQ ID NO: 5, amino acids 423-847 of an active BoNT/E translocation domain fragment of SEQ ID NO: 5, or any combination thereof.
[0190]In other aspects of this embodiment, a BoNT/E translocation domain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 423-847 of SEQ ID NO: 5, at least 75% amino acid identity with amino acids 423-847 of SEQ ID NO: 5, at least 80% amino acid identity with amino acids 423-847 of SEQ ID NO: 5, at least 85% amino acid identity with amino acids 423-847 of SEQ ID NO: 5, at least 90% amino acid identity with amino acids 423-847 of SEQ ID NO: 5 or at least 95% amino acid identity with amino acids 423-847 of SEQ ID NO: 5. In yet other aspects of this embodiment, a BoNT/E translocation domain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 423-847 of SEQ ID NO: 5, at most 75% amino acid identity with amino acids 423-847 of SEQ ID NO: 5, at most 80% amino acid identity with amino acids 423-847 of SEQ ID NO: 5, at most 85% amino acid identity with amino acids 423-847 of SEQ ID NO: 5, at most 90% amino acid identity with amino acids 423-847 of SEQ ID NO: 5 or at most 95% amino acid identity with amino acids 423-847 of SEQ ID NO: 5.
[0191]In other aspects of this embodiment, a BoNT/E translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 423-847 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 423-847 of SEQ ID NO: 5. In yet other aspects of this embodiment, a BoNT/E translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 423-847 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 423-847 of SEQ ID NO: 5. In still other aspects of this embodiment, a BoNT/E translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 423-847 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 423-847 of SEQ ID NO: 5.
[0192]In other aspects of this embodiment, a BoNT/E translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 423-847 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 423-847 of SEQ ID NO: 5. In yet other aspects of this embodiment, a BoNT/E translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 423-847 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 423-847 of SEQ ID NO: 5. In still other aspects of this embodiment, a BoNT/E translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 423-847 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 423-847 of SEQ ID NO: 5.
[0193]In another embodiment, a Clostridial toxin translocation domain comprises a BoNT/F translocation domain. In an aspect of this embodiment, a BoNT/F translocation domain comprises amino acids 440-866 of SEQ ID NO: 6. In another aspect of this embodiment, a BoNT/F translocation domain comprises a naturally occurring BoNT/F translocation domain variant, such as, e.g., a translocation domain from a BoNT/F isoform or a translocation domain from a BoNT/F subtype. In another aspect of this embodiment, a BoNT/F translocation domain comprises amino acids 440-866 of a naturally occurring BoNT/F translocation domain variant of SEQ ID NO: 6, such as, e.g., amino acids 440-866 of a BoNT/F isoform of SEQ ID NO: 6 or amino acids 440-866 of a BoNT/F subtype of SEQ ID NO: 6. In still another aspect of this embodiment, a BoNT/F translocation domain comprises a non-naturally occurring BoNT/F translocation domain variant, such as, e.g., a conservative BoNT/F translocation domain variant, a non-conservative BoNT/F translocation domain variant, a BoNT/F chimeric translocation domain, an active BoNT/F translocation domain fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/F translocation domain comprises amino acids 440-866 of a non-naturally occurring BoNT/F translocation domain variant of SEQ ID NO: 6, such as, e.g., amino acids 440-866 of a conservative BoNT/F translocation domain variant of SEQ ID NO: 6, amino acids 440-866 of a non-conservative BoNT/F translocation domain variant of SEQ ID NO: 6, amino acids 440-866 of an active BoNT/F translocation domain fragment of SEQ ID NO: 6, or any combination thereof.
[0194]In other aspects of this embodiment, a BoNT/F translocation domain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 440-866 of SEQ ID NO: 6, at least 75% amino acid identity with amino acids 440-866 of SEQ ID NO: 6, at least 80% amino acid identity with amino acids 440-866 of SEQ ID NO: 6, at least 85% amino acid identity with amino acids 440-866 of SEQ ID NO: 6, at least 90% amino acid identity with amino acids 440-866 of SEQ ID NO: 6 or at least 95% amino acid identity with amino acids 440-866 of SEQ ID NO: 6. In yet other aspects of this embodiment, a BoNT/F translocation domain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 440-866 of SEQ ID NO: 6, at most 75% amino acid identity with amino acids 440-866 of SEQ ID NO: 6, at most 80% amino acid identity with amino acids 440-866 of SEQ ID NO: 6, at most 85% amino acid identity with amino acids 440-866 of SEQ ID NO: 6, at most 90% amino acid identity with amino acids 440-866 of SEQ ID NO: 6 or at most 95% amino acid identity with amino acids 440-866 of SEQ ID NO: 6.
[0195]In other aspects of this embodiment, a BoNT/F translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 440-866 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 440-866 of SEQ ID NO: 6. In yet other aspects of this embodiment, a BoNT/F translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 440-866 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 440-866 of SEQ ID NO: 6. In still other aspects of this embodiment, a BoNT/F translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 440-866 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 440-866 of SEQ ID NO: 6.
[0196]In other aspects of this embodiment, a BoNT/F translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 440-866 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 440-866 of SEQ ID NO: 6. In yet other aspects of this embodiment, a BoNT/F translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 440-866 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 440-866 of SEQ ID NO: 6. In still other aspects of this embodiment, a BoNT/F translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 440-866 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 440-866 of SEQ ID NO: 6.
[0197]In another embodiment, a Clostridial toxin translocation domain comprises a BoNT/G translocation domain. In an aspect of this embodiment, a BoNT/G translocation domain comprises amino acids 447-865 of SEQ ID NO: 7. In another aspect of this embodiment, a BoNT/G translocation domain comprises a naturally occurring BoNT/G translocation domain variant, such as, e.g., a translocation domain from a BoNT/G isoform or a translocation domain from a BoNT/G subtype. In another aspect of this embodiment, a BoNT/G translocation domain comprises amino acids 447-865 of a naturally occurring BoNT/G translocation domain variant of SEQ ID NO: 7, such as, e.g., amino acids 447-865 of a BoNT/G isoform of SEQ ID NO: 7 or amino acids 447-865 of a BoNT/G subtype of SEQ ID NO: 7. In still another aspect of this embodiment, a BoNT/G translocation domain comprises a non-naturally occurring BoNT/G translocation domain variant, such as, e.g., a conservative BoNT/G translocation domain variant, a non-conservative BoNT/G translocation domain variant, a BoNT/G chimeric translocation domain, an active BoNT/G translocation domain fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/G translocation domain comprises amino acids 447-865 of a non-naturally occurring BoNT/G translocation domain variant of SEQ ID NO: 7, such as, e.g., amino acids 447-865 of a conservative BoNT/G translocation domain variant of SEQ ID NO: 7, amino acids 447-865 of a non-conservative BoNT/G translocation domain variant of SEQ ID NO: 7, amino acids 447-865 of an active BoNT/G translocation domain fragment of SEQ ID NO: 7, or any combination thereof.
[0198]In other aspects of this embodiment, a BoNT/G translocation domain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 447-865 of SEQ ID NO: 7, at least 75% amino acid identity with amino acids 447-865 of SEQ ID NO: 7, at least 80% amino acid identity with amino acids 447-865 of SEQ ID NO: 7, at least 85% amino acid identity with amino acids 447-865 of SEQ ID NO: 7, at least 90% amino acid identity with amino acids 447-865 of SEQ ID NO: 7 or at least 95% amino acid identity with amino acids 447-865 of SEQ ID NO: 7. In yet other aspects of this embodiment, a BoNT/G translocation domain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 447-865 of SEQ ID NO: 7, at most 75% amino acid identity with amino acids 447-865 of SEQ ID NO: 7, at most 80% amino acid identity with amino acids 447-865 of SEQ ID NO: 7, at most 85% amino acid identity with amino acids 447-865 of SEQ ID NO: 7, at most 90% amino acid identity with amino acids 447-865 of SEQ ID NO: 7 or at most 95% amino acid identity with amino acids 447-865 of SEQ ID NO: 7.
[0199]In other aspects of this embodiment, a BoNT/G translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 447-865 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 447-865 of SEQ ID NO: 7. In yet other aspects of this embodiment, a BoNT/G translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 447-865 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 447-865 of SEQ ID NO: 7. In still other aspects of this embodiment, a BoNT/G translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 447-865 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 447-865 of SEQ ID NO: 7.
[0200]In other aspects of this embodiment, a BoNT/G translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 447-865 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 447-865 of SEQ ID NO: 7. In yet other aspects of this embodiment, a BoNT/G translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 447-865 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 447-865 of SEQ ID NO: 7. In still other aspects of this embodiment, a BoNT/G translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 447-865 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 447-865 of SEQ ID NO: 7.
[0201]In another embodiment, a Clostridial toxin translocation domain comprises a TeNT translocation domain. In an aspect of this embodiment, a TeNT translocation domain comprises amino acids 458-881 of SEQ ID NO: 8. In another aspect of this embodiment, a TeNT translocation domain comprises a naturally occurring TeNT translocation domain variant, such as, e.g., a translocation domain from a TeNT isoform or a translocation domain from a TeNT subtype. In another aspect of this embodiment, a TeNT translocation domain comprises amino acids 458-881 of a naturally occurring TeNT translocation domain variant of SEQ ID NO: 8, such as, e.g., amino acids 458-881 of a TeNT isoform of SEQ ID NO: 8 or amino acids 458-881 of a TeNT subtype of SEQ ID NO: 8. In still another aspect of this embodiment, a TeNT translocation domain comprises a non-naturally occurring TeNT translocation domain variant, such as, e.g., a conservative TeNT translocation domain variant, a non-conservative TeNT translocation domain variant, a TeNT chimeric translocation domain, an active TeNT translocation domain fragment, or any combination thereof. In still another aspect of this embodiment, a TeNT translocation domain comprises amino acids 458-881 of a non-naturally occurring TeNT translocation domain variant of SEQ ID NO: 8, such as, e.g., amino acids 458-881 of a conservative TeNT translocation domain variant of SEQ ID NO: 8, amino acids 458-881 of a non-conservative TeNT translocation domain variant of SEQ ID NO: 8, amino acids 458-881 of an active TeNT translocation domain fragment of SEQ ID NO: 8, or any combination thereof.
[0202]In other aspects of this embodiment, a TeNT translocation domain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 458-881 of SEQ ID NO: 8, at least 75% amino acid identity with amino acids 458-881 of SEQ ID NO: 8, at least 80% amino acid identity with amino acids 458-881 of SEQ ID NO: 8, at least 85% amino acid identity with amino acids 458-881 of SEQ ID NO: 8, at least 90% amino acid identity with amino acids 458-881 of SEQ ID NO: 8 or at least 95% amino acid identity with amino acids 458-881 of SEQ ID NO: 8. In yet other aspects of this embodiment, a TeNT translocation domain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 458-881 of SEQ ID NO: 8, at most 75% amino acid identity with amino acids 458-881 of SEQ ID NO: 8, at most 80% amino acid identity with amino acids 458-881 of SEQ ID NO: 8, at most 85% amino acid identity with amino acids 458-881 of SEQ ID NO: 8, at most 90% amino acid identity with amino acids 458-881 of SEQ ID NO: 8 or at most 95% amino acid identity with amino acids 458-881 of SEQ ID NO: 8.
[0203]In other aspects of this embodiment, a TeNT translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 458-881 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 458-881 of SEQ ID NO: 8. In yet other aspects of this embodiment, a TeNT translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 458-881 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 458-881 of SEQ ID NO: 8. In still other aspects of this embodiment, a TeNT translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 458-881 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 458-881 of SEQ ID NO: 8.
[0204]In other aspects of this embodiment, a TeNT translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 458-881 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 458-881 of SEQ ID NO: 8. In yet other aspects of this embodiment, a TeNT translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 458-881 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 458-881 of SEQ ID NO: 8. In still other aspects of this embodiment, a TeNT translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 458-881 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 458-881 of SEQ ID NO: 8.
[0205]In another embodiment, a Clostridial toxin translocation domain comprises a BaNT translocation domain. In an aspect of this embodiment, a BaNT translocation domain comprises amino acids 432-857 of SEQ ID NO: 9. In another aspect of this embodiment, a BaNT translocation domain comprises a naturally occurring BaNT translocation domain variant, such as, e.g., a translocation domain from a BaNT isoform or a translocation domain from a BaNT subtype. In another aspect of this embodiment, a BaNT translocation domain comprises amino acids 432-857 of a naturally occurring BaNT translocation domain variant of SEQ ID NO: 9, such as, e.g., amino acids 432-857 of a BaNT isoform of SEQ ID NO: 9 or amino acids 432-857 of a BaNT subtype of SEQ ID NO: 9. In still another aspect of this embodiment, a BaNT translocation domain comprises a non-naturally occurring BaNT translocation domain variant, such as, e.g., a conservative BaNT translocation domain variant, a non-conservative BaNT translocation domain variant, a BaNT chimeric translocation domain, an active BaNT translocation domain fragment, or any combination thereof. In still another aspect of this embodiment, a BaNT translocation domain comprises amino acids 432-857 of a non-naturally occurring BaNT translocation domain variant of SEQ ID NO: 9, such as, e.g., amino acids 432-857 of a conservative BaNT translocation domain variant of SEQ ID NO: 9, amino acids 432-857 of a non-conservative BaNT translocation domain variant of SEQ ID NO: 9, amino acids 432-857 of an active BaNT translocation domain fragment of SEQ ID NO: 9, or any combination thereof.
[0206]In other aspects of this embodiment, a BaNT translocation domain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 432-857 of SEQ ID NO: 9, at least 75% amino acid identity with amino acids 432-857 of SEQ ID NO: 9, at least 80% amino acid identity with amino acids 432-857 of SEQ ID NO: 9, at least 85% amino acid identity with amino acids 432-857 of SEQ ID NO: 9, at least 90% amino acid identity with amino acids 432-857 of SEQ ID NO: 9 or at least 95% amino acid identity with amino acids 432-857 of SEQ ID NO: 9. In yet other aspects of this embodiment, a BaNT translocation domain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 432-857 of SEQ ID NO: 9, at most 75% amino acid identity with amino acids 432-857 of SEQ ID NO: 9, at most 80% amino acid identity with amino acids 432-857 of SEQ ID NO: 9, at most 85% amino acid identity with amino acids 432-857 of SEQ ID NO: 9, at most 90% amino acid identity with amino acids 432-857 of SEQ ID NO: 9 or at most 95% amino acid identity with amino acids 432-857 of SEQ ID NO: 9.
[0207]In other aspects of this embodiment, a BaNT translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 432-857 of SEQ ID NO: 9. In other aspects of this embodiment, a BaNT translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 432-857 of SEQ ID NO: 9. In yet other aspects of this embodiment, a BaNT translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 432-857 of SEQ ID NO: 9. In other aspects of this embodiment, a BaNT translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 432-857 of SEQ ID NO: 9. In still other aspects of this embodiment, a BaNT translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 432-857 of SEQ ID NO: 9. In other aspects of this embodiment, a BaNT translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 432-857 of SEQ ID NO: 9.
[0208]In other aspects of this embodiment, a BaNT translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 432-857 of SEQ ID NO: 9. In other aspects of this embodiment, a BaNT translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 432-857 of SEQ ID NO: 9. In yet other aspects of this embodiment, a BaNT translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 432-857 of SEQ ID NO: 9. In other aspects of this embodiment, a BaNT translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 432-857 of SEQ ID NO: 9. In still other aspects of this embodiment, a BaNT translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 432-857 of SEQ ID NO: 9. In other aspects of this embodiment, a BaNT translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 432-857 of SEQ ID NO: 9.
[0209]In another embodiment, a Clostridial toxin translocation domain comprises a BuNT translocation domain. In an aspect of this embodiment, a BuNT translocation domain comprises amino acids 423-847 of SEQ ID NO: 10. In another aspect of this embodiment, a BuNT translocation domain comprises a naturally occurring BuNT translocation domain variant, such as, e.g., a translocation domain from a BuNT isoform or a translocation domain from a BuNT subtype. In another aspect of this embodiment, a BuNT translocation domain comprises amino acids 423-847 of a naturally occurring BuNT translocation domain variant of SEQ ID NO: 10, such as, e.g., amino acids 423-847 of a BuNT isoform of SEQ ID NO: 10 or amino acids 423-847 of a BuNT subtype of SEQ ID NO: 10. In still another aspect of this embodiment, a BuNT translocation domain comprises a non-naturally occurring BuNT translocation domain variant, such as, e.g., a conservative BuNT translocation domain variant, a non-conservative BuNT translocation domain variant, a BuNT chimeric translocation domain, an active BuNT translocation domain fragment, or any combination thereof. In still another aspect of this embodiment, a BuNT translocation domain comprises amino acids 423-847 of a non-naturally occurring BuNT translocation domain variant of SEQ ID NO: 10, such as, e.g., amino acids 423-847 of a conservative BuNT translocation domain variant of SEQ ID NO: 10, amino acids 423-847 of a non-conservative BuNT translocation domain variant of SEQ ID NO: 10, amino acids 423-847 of an active BuNT translocation domain fragment of SEQ ID NO: 10, or any combination thereof.
[0210]In other aspects of this embodiment, a BuNT translocation domain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 423-847 of SEQ ID NO: 10, at least 75% amino acid identity with amino acids 423-847 of SEQ ID NO: 10, at least 80% amino acid identity with amino acids 423-847 of SEQ ID NO: 10, at least 85% amino acid identity with amino acids 423-847 of SEQ ID NO: 10, at least 90% amino acid identity with amino acids 423-847 of SEQ ID NO: 10 or at least 95% amino acid identity with amino acids 423-847 of SEQ ID NO: 10. In yet other aspects of this embodiment, a BuNT translocation domain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 423-847 of SEQ ID NO: 10, at most 75% amino acid identity with amino acids 423-847 of SEQ ID NO: 10, at most 80% amino acid identity with amino acids 423-847 of SEQ ID NO: 10, at most 85% amino acid identity with amino acids 423-847 of SEQ ID NO: 10, at most 90% amino acid identity with amino acids 423-847 of SEQ ID NO: 10 or at most 95% amino acid identity with amino acids 423-847 of SEQ ID NO: 10.
[0211]In other aspects of this embodiment, a BuNT translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 423-847 of SEQ ID NO: 10. In other aspects of this embodiment, a BuNT translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 423-847 of SEQ ID NO: 10. In yet other aspects of this embodiment, a BuNT translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 423-847 of SEQ ID NO: 10. In other aspects of this embodiment, a BuNT translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 423-847 of SEQ ID NO: 10. In still other aspects of this embodiment, a BuNT translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 423-847 of SEQ ID NO: 10. In other aspects of this embodiment, a BuNT translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 423-847 of SEQ ID NO: 10.
[0212]In other aspects of this embodiment, a BuNT translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 423-847 of SEQ ID NO: 10. In other aspects of this embodiment, a BuNT translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 423-847 of SEQ ID NO: 10. In yet other aspects of this embodiment, a BuNT translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 423-847 of SEQ ID NO: 10. In other aspects of this embodiment, a BuNT translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 423-847 of SEQ ID NO: 10. In still other aspects of this embodiment, a BuNT translocation domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 423-847 of SEQ ID NO: 10. In other aspects of this embodiment, a BuNT translocation domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 423-847 of SEQ ID NO: 10.
[0213]By "binding element" is meant an amino acid sequence region able to preferentially bind to a cell surface marker characteristic of the target cell under physiological conditions. The cell surface marker may comprise a polypeptide, a polysaccharide, a lipid, a glycoprotein, a lipoprotein, or may have structural characteristics of more than one of these. By "preferentially interact" is meant that the disassociation constant (Kd) of the binding element for the cell surface marker is at least one order of magnitude less than that of the binding element for any other cell surface marker. Preferably, the disassociation constant is at least 2 orders of magnitude less, even more preferably the disassociation constant is at least 3 orders of magnitude less than that of the binding element for any other cell surface marker to which the neurotoxin or modified neurotoxin is exposed. Examples of binding elements are described in, e.g., Steward, L. E. et al., Modified Clostridial Toxins with Enhanced Translocation Capability and Enhanced Targeting Activity, U.S. patent application Ser. No. 11/776,043 (Jul. 11, 2007); Steward, L. E. et al., Modified Clostridial Toxins with Enhanced Translocation Capabilities and Altered Targeting Activity For Clostridial Toxin Target Cells, U.S. patent application Ser. No. 11/776,052 (Jul. 11, 2007); and Steward, L. E. et al., Modified Clostridial Toxins with Enhanced Translocation Capabilities and Altered Targeting Activity For Non-Clostridial Toxin Target Cells, U.S. patent application Ser. No. 11/776,075 (Jul. 11, 2007), each of which is incorporated by reference in its entirety.
[0214]A non-limiting example of a binding element disclosed in the present specification is, e.g., a growth factor. Examples of growth fators include, without limitation, a GDNF; a neurturin; a persephrin; an artemin; a TGFβ like a TGFβ1, a TGFβ2, a TGFβ3 or a TGFβ4; a BMP: a BMP2, a BMP3, a BMP4, a BMP5, a BMP6, a BMP7, a BMP8 or a BMP10; a GDF: a GDF1, a GDF2, a GDF3, a GDF5, a GDF6, a GDF7, a GDF8, a GDF10, a GDF11 or a GDF15; an activin: an activin A, an activin B, an activin C, an activin E or an inhibin A; a VEGF; an IGF-1; an IGF-2; and an EGF.
[0215]Thus, in an embodiment, a binding element comprising a GDNF. In another embodiment, a binding element comprising a GDNF comprises SEQ ID NO: 81. In an aspect of this embodiment, a binding element comprising a GDNF comprises amino acids 118-211 of SEQ ID NO: 81.
[0216]In other aspects of this embodiment, a binding element comprising a GDNF has, e.g., at least 70% amino acid identity with amino acids 118-211 of SEQ ID NO: 81, at least 75% amino acid identity with amino acids 118-211 of SEQ ID NO: 81, at least 80% amino acid identity with amino acids 118-211 of SEQ ID NO: 81, at least 85% amino acid identity with amino acids 118-211 of SEQ ID NO: 81, at least 90% amino acid identity with amino acids 118-211 of SEQ ID NO: 81 or at least 95% amino acid identity with amino acids 118-211 of SEQ ID NO: 81. In yet other aspects of this embodiment, a binding element comprising a GDNF has, e.g., at most 70% amino acid identity with amino acids 118-211 of SEQ ID NO: 81, at most 75% amino acid identity with amino acids 118-211 of SEQ ID NO: 81, at most 80% amino acid identity with amino acids 118-211 of SEQ ID NO: 81, at most 85% amino acid identity with amino acids 118-211 of SEQ ID NO: 81, at most 90% amino acid identity with amino acids 118-211 of SEQ ID NO: 81 or at most 95% amino acid identity with amino acids 118-211 of SEQ ID NO: 81.
[0217]In other aspects of this embodiment, a binding element comprising a GDNF has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 118-211 of SEQ ID NO: 81. In other aspects of this embodiment, a binding element comprising a GDNF has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 118-211 of SEQ ID NO: 81. In yet other aspects of this embodiment, a binding element comprising a GDNF has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 118-211 of SEQ ID NO: 81. In other aspects of this embodiment, a binding element comprising a GDNF has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 118-211 of SEQ ID NO: 81. In still other aspects of this embodiment, a binding element comprising a GDNF has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 118-211 of SEQ ID NO: 81. In other aspects of this embodiment, a binding element comprising a GDNF has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 118-211 of SEQ ID NO: 81.
[0218]In other aspects of this embodiment, a binding element comprising a GDNF has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 118-211 of SEQ ID NO: 81. In other aspects of this embodiment, a binding element comprising a GDNF has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 118-211 of SEQ ID NO: 81. In yet other aspects of this embodiment, a binding element comprising a GDNF has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 118-211 of SEQ ID NO: 81. In other aspects of this embodiment, a binding element comprising a GDNF has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 118-211 of SEQ ID NO: 81. In still other aspects of this embodiment, a binding element comprising a GDNF has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 118-211 of SEQ ID NO: 81. In other aspects of this embodiment, a binding element comprising a GDNF has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 118-211 of SEQ ID NO: 81.
[0219]In another embodiment, a binding element comprising a Neurturin. In another embodiment, a binding element comprising a Neurturin comprises SEQ ID NO: 82. In an aspect of this embodiment, a binding element comprising a Neurturin comprises amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82.
[0220]In other aspects of this embodiment, a binding element comprising a Neurturin has, e.g., at least 70% amino acid identity with amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82, at least 75% amino acid identity with amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82, at least 80% amino acid identity with amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82, at least 85% amino acid identity with amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82, at least 90% amino acid identity with amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82 or at least 95% amino acid identity with amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82. In yet other aspects of this embodiment, a binding element comprising a Neurturin has, e.g., at most 70% amino acid identity with amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82, at most 75% amino acid identity with amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82, at most 80% amino acid identity with amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82, at most 85% amino acid identity with amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82, at most 90% amino acid identity with amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82 or at most 95% amino acid identity with amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82.
[0221]In other aspects of this embodiment, a binding element comprising a Neurturin has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82. In other aspects of this embodiment, a binding element comprising a Neurturin has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82. In yet other aspects of this embodiment, a binding element comprising a Neurturin has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82. In other aspects of this embodiment, a binding element comprising a Neurturin has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82. In still other aspects of this embodiment, a binding element comprising a Neurturin has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82. In other aspects of this embodiment, a binding element comprising a Neurturin has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82.
[0222]In other aspects of this embodiment, a binding element comprising a Neurturin has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82. In other aspects of this embodiment, a binding element comprising a Neurturin has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82. In yet other aspects of this embodiment, a binding element comprising a Neurturin has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82. In other aspects of this embodiment, a binding element comprising a Neurturin has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82. In still other aspects of this embodiment, a binding element comprising a Neurturin has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82. In other aspects of this embodiment, a binding element comprising a Neurturin has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82.
[0223]In another embodiment, a binding element comprising a Persephrin. In another embodiment, a binding element comprising a Persephrin comprises SEQ ID NO: 83. In an aspect of this embodiment, a binding element comprising a Persephrin comprises amino acids 66-155 of SEQ ID NO: 83.
[0224]In other aspects of this embodiment, a binding element comprising a Persephrin has, e.g., at least 70% amino acid identity with amino acids 66-155 of SEQ ID NO: 83, at least 75% amino acid identity with amino acids 66-155 of SEQ ID NO: 83, at least 80% amino acid identity with amino acids 66-155 of SEQ ID NO: 83, at least 85% amino acid identity with amino acids 66-155 of SEQ ID NO: 83, at least 90% amino acid identity with amino acids 66-155 of SEQ ID NO: 83 or at least 95% amino acid identity with amino acids 66-155 of SEQ ID NO: 83. In yet other aspects of this embodiment, a binding element comprising a Persephrin has, e.g., at most 70% amino acid identity with amino acids 66-155 of SEQ ID NO: 83, at most 75% amino acid identity with amino acids 66-155 of SEQ ID NO: 83, at most 80% amino acid identity with amino acids 66-155 of SEQ ID NO: 83, at most 85% amino acid identity with amino acids 66-155 of SEQ ID NO: 83, at most 90% amino acid identity with amino acids 66-155 of SEQ ID NO: 83 or at most 95% amino acid identity with amino acids 66-155 of SEQ ID NO: 83.
[0225]In other aspects of this embodiment, a binding element comprising a Persephrin has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 66-155 of SEQ ID NO: 83. In other aspects of this embodiment, a binding element comprising a Persephrin has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 66-155 of SEQ ID NO: 83. In yet other aspects of this embodiment, a binding element comprising a Persephrin has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 66-155 of SEQ ID NO: 83. In other aspects of this embodiment, a binding element comprising a Persephrin has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 66-155 of SEQ ID NO: 83. In still other aspects of this embodiment, a binding element comprising a Persephrin has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 66-155 of SEQ ID NO: 83. In other aspects of this embodiment, a binding element comprising a Persephrin has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 66-155 of SEQ ID NO: 83.
[0226]In other aspects of this embodiment, a binding element comprising a Persephrin has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 66-155 of SEQ ID NO: 83. In other aspects of this embodiment, a binding element comprising a Persephrin has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 66-155 of SEQ ID NO: 83. In yet other aspects of this embodiment, a binding element comprising a Persephrin has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 66-155 of SEQ ID NO: 83. In other aspects of this embodiment, a binding element comprising a Persephrin has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 66-155 of SEQ ID NO: 83. In still other aspects of this embodiment, a binding element comprising a Persephrin has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 66-155 of SEQ ID NO: 83. In other aspects of this embodiment, a binding element comprising a Persephrin has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 66-155 of SEQ ID NO: 83.
[0227]In another embodiment, a binding element comprising an Artemin. In another embodiment, a binding element comprising an Artemin comprises SEQ ID NO: 84. In an aspect of this embodiment, a binding element comprising an Artemin comprises amino acids 123-218 of SEQ ID NO: 84.
[0228]In other aspects of this embodiment, a binding element comprising an Artemin has, e.g., at least 70% amino acid identity with amino acids 123-218 of SEQ ID NO: 84, at least 75% amino acid identity with amino acids 123-218 of SEQ ID NO: 84, at least 80% amino acid identity with amino acids 123-218 of SEQ ID NO: 84, at least 85% amino acid identity with amino acids 123-218 of SEQ ID NO: 84, at least 90% amino acid identity with amino acids 123-218 of SEQ ID NO: 84 or at least 95% amino acid identity with amino acids 123-218 of SEQ ID NO: 84. In yet other aspects of this embodiment, a binding element comprising an Artemin has, e.g., at most 70% amino acid identity with amino acids 123-218 of SEQ ID NO: 84, at most 75% amino acid identity with amino acids 123-218 of SEQ ID NO: 84, at most 80% amino acid identity with amino acids 123-218 of SEQ ID NO: 84, at most 85% amino acid identity with amino acids 123-218 of SEQ ID NO: 84, at most 90% amino acid identity with amino acids 123-218 of SEQ ID NO: 84 or at most 95% amino acid identity with amino acids 123-218 of SEQ ID NO: 84.
[0229]In other aspects of this embodiment, a binding element comprising an Artemin has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 123-218 of SEQ ID NO: 84. In other aspects of this embodiment, a binding element comprising an Artemin has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 123-218 of SEQ ID NO: 84. In yet other aspects of this embodiment, a binding element comprising an Artemin has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 123-218 of SEQ ID NO: 84. In other aspects of this embodiment, a binding element comprising an Artemin has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 123-218 of SEQ ID NO: 84. In still other aspects of this embodiment, a binding element comprising an Artemin has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 123-218 of SEQ ID NO: 84. In other aspects of this embodiment, a binding element comprising an Artemin has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 123-218 of SEQ ID NO: 84.
[0230]In other aspects of this embodiment, a binding element comprising an Artemin has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 123-218 of SEQ ID NO: 84. In other aspects of this embodiment, a binding element comprising an Artemin has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 123-218 of SEQ ID NO: 84. In yet other aspects of this embodiment, a binding element comprising an Artemin has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 123-218 of SEQ ID NO: 84. In other aspects of this embodiment, a binding element comprising an Artemin has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 123-218 of SEQ ID NO: 84. In still other aspects of this embodiment, a binding element comprising an Artemin has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 123-218 of SEQ ID NO: 84. In other aspects of this embodiment, a binding element comprising an Artemin has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 123-218 of SEQ ID NO: 84.
[0231]Another example of a binding element disclosed in the present specification is, e.g., a TGFβs, such as, e.g., a TGFβ1, a TGFβ2, a TGFβ3 or a TGFβ4.
[0232]Thus, in an embodiment, a binding element comprising a TGFβ1. In another embodiment, a binding element comprising a TGFβ1 comprises SEQ ID NO: 85. In an aspect of this embodiment, a binding element comprising a TGFβ1 comprises amino acids 293-390 of SEQ ID NO: 85. In other aspects of this embodiment, a binding element comprising a TGFβ1 has, e.g., at least 70% amino acid identity with amino acids 293-390 of SEQ ID NO: 85, at least 75% amino acid identity with amino acids 293-390 of SEQ ID NO: 85, at least 80% amino acid identity with amino acids 293-390 of SEQ ID NO: 85, at least 85% amino acid identity with amino acids 293-390 of SEQ ID NO: 85, at least 90% amino acid identity with amino acids 293-390 of SEQ ID NO: 85 or at least 95% amino acid identity with amino acids 293-390 of SEQ ID NO: 85. In yet other aspects of this embodiment, a binding element comprising a TGFβ1 has, e.g., at most 70% amino acid identity with amino acids 293-390 of SEQ ID NO: 85, at most 75% amino acid identity with amino acids 293-390 of SEQ ID NO: 85, at most 80% amino acid identity with amino acids 293-390 of SEQ ID NO: 85, at most 85% amino acid identity with amino acids 293-390 of SEQ ID NO: 85, at most 90% amino acid identity with amino acids 293-390 of SEQ ID NO: 85 or at most 95% amino acid identity with amino acids 293-390 of SEQ ID NO: 85.
[0233]In other aspects of this embodiment, a binding element comprising a TGFβ1 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 293-390 of SEQ ID NO: 85. In other aspects of this embodiment, a binding element comprising a TGFβ1 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 293-390 of SEQ ID NO: 85. In yet other aspects of this embodiment, a binding element comprising a TGFβ1 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 293-390 of SEQ ID NO: 85. In other aspects of this embodiment, a binding element comprising a TGFβ1 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 293-390 of SEQ ID NO: 85. In still other aspects of this embodiment, a binding element comprising a TGFβ1 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 293-390 of SEQ ID NO: 85. In other aspects of this embodiment, a binding element comprising a TGFβ1 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 293-390 of SEQ ID NO: 85.
[0234]In other aspects of this embodiment, a binding element comprising a TGFβ1 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 293-390 of SEQ ID NO: 85. In other aspects of this embodiment, a binding element comprising a TGFβ1 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 293-390 of SEQ ID NO: 85. In yet other aspects of this embodiment, a binding element comprising a TGFβ1 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 293-390 of SEQ ID NO: 85. In other aspects of this embodiment, a binding element comprising a TGFβ1 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 293-390 of SEQ ID NO: 85. In still other aspects of this embodiment, a binding element comprising a TGFβ1 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 293-390 of SEQ ID NO: 85. In other aspects of this embodiment, a binding element comprising a TGFβ1 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 293-390 of SEQ ID NO: 85.
[0235]In another embodiment, a binding element comprising a TGFβ2. In another embodiment, a binding element comprising a TGFβ2 comprises SEQ ID NO: 85. In an aspect of this embodiment, a binding element comprising a TGFβ2 comprises amino acids 317-414 of SEQ ID NO: 86.
[0236]In other aspects of this embodiment, a binding element comprising a TGFβ2 has, e.g., at least 70% amino acid identity with amino acids 317-414 of SEQ ID NO: 86, at least 75% amino acid identity with amino acids 317-414 of SEQ ID NO: 86, at least 80% amino acid identity with amino acids 317-414 of SEQ ID NO: 86, at least 85% amino acid identity with amino acids 317-414 of SEQ ID NO: 86, at least 90% amino acid identity with amino acids 317-414 of SEQ ID NO: 86 or at least 95% amino acid identity with amino acids 317-414 of SEQ ID NO: 86. In yet other aspects of this embodiment, a binding element comprising a TGFβ2 has, e.g., at most 70% amino acid identity with amino acids 317-414 of SEQ ID NO: 86, at most 75% amino acid identity with amino acids 317-414 of SEQ ID NO: 86, at most 80% amino acid identity with amino acids 317-414 of SEQ ID NO: 86, at most 85% amino acid identity with amino acids 317-414 of SEQ ID NO: 86, at most 90% amino acid identity with amino acids 317-414 of SEQ ID NO: 86 or at most 95% amino acid identity with amino acids 317-414 of SEQ ID NO: 86.
[0237]In other aspects of this embodiment, a binding element comprising a TGFβ2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 317-414 of SEQ ID NO: 86. In other aspects of this embodiment, a binding element comprising a TGFβ2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 317-414 of SEQ ID NO: 86. In yet other aspects of this embodiment, a binding element comprising a TGFβ2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 317-414 of SEQ ID NO: 86. In other aspects of this embodiment, a binding element comprising a TGFβ2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 317-414 of SEQ ID NO: 86. In still other aspects of this embodiment, a binding element comprising a TGFβ2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 317-414 of SEQ ID NO: 86. In other aspects of this embodiment, a binding element comprising a TGFβ2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 317-414 of SEQ ID NO: 86.
[0238]In other aspects of this embodiment, a binding element comprising a TGFβ2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 317-414 of SEQ ID NO: 86. In other aspects of this embodiment, a binding element comprising a TGFβ2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 317-414 of SEQ ID NO: 86. In yet other aspects of this embodiment, a binding element comprising a TGFβ2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 317-414 of SEQ ID NO: 86. In other aspects of this embodiment, a binding element comprising a TGFβ2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 317-414 of SEQ ID NO: 86. In still other aspects of this embodiment, a binding element comprising a TGFβ2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 317-414 of SEQ ID NO: 86. In other aspects of this embodiment, a binding element comprising a TGFβ2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 317-414 of SEQ ID NO: 86.
[0239]In another embodiment, a binding element comprising a TGFβ3. In another embodiment, a binding element comprising a TGFβ3 comprises SEQ ID NO: 85. In an aspect of this embodiment, a binding element comprising a TGFβ3 comprises amino acids 315-412 of SEQ ID NO: 87.
[0240]In other aspects of this embodiment, a binding element comprising a TGFβ3 has, e.g., at least 70% amino acid identity with amino acids 315-412 of SEQ ID NO: 87, at least 75% amino acid identity with amino acids 315-412 of SEQ ID NO: 87, at least 80% amino acid identity with amino acids 315-412 of SEQ ID NO: 87, at least 85% amino acid identity with amino acids 315-412 of SEQ ID NO: 87, at least 90% amino acid identity with amino acids 315-412 of SEQ ID NO: 87 or at least 95% amino acid identity with amino acids 315-412 of SEQ ID NO: 87. In yet other aspects of this embodiment, a binding element comprising a TGFβ3 has, e.g., at most 70% amino acid identity with amino acids 315-412 of SEQ ID NO: 87, at most 75% amino acid identity with amino acids 315-412 of SEQ ID NO: 87, at most 80% amino acid identity with amino acids 315-412 of SEQ ID NO: 87, at most 85% amino acid identity with amino acids 315-412 of SEQ ID NO: 87, at most 90% amino acid identity with amino acids 315-412 of SEQ ID NO: 87 or at most 95% amino acid identity with amino acids 315-412 of SEQ ID NO: 87.
[0241]In other aspects of this embodiment, a binding element comprising a TGFβ3 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 315-412 of SEQ ID NO: 87. In other aspects of this embodiment, a binding element comprising a TGFβ3 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 315-412 of SEQ ID NO: 87. In yet other aspects of this embodiment, a binding element comprising a TGFβ3 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 315-412 of SEQ ID NO: 87. In other aspects of this embodiment, a binding element comprising a TGFβ3 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 315-412 of SEQ ID NO: 87. In still other aspects of this embodiment, a binding element comprising a TGFβ3 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 315-412 of SEQ ID NO: 87. In other aspects of this embodiment, a binding element comprising a TGFβ3 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 315-412 of SEQ ID NO: 87.
[0242]In other aspects of this embodiment, a binding element comprising a TGFβ3 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 315-412 of SEQ ID NO: 87. In other aspects of this embodiment, a binding element comprising a TGFβ3 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 315-412 of SEQ ID NO: 87. In yet other aspects of this embodiment, a binding element comprising a TGFβ3 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 315-412 of SEQ ID NO: 87. In other aspects of this embodiment, a binding element comprising a TGFβ3 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 315-412 of SEQ ID NO: 87. In still other aspects of this embodiment, a binding element comprising a TGFβ3 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 315-412 of SEQ ID NO: 87. In other aspects of this embodiment, a binding element comprising a TGFβ3 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 315-412 of SEQ ID NO: 87.
[0243]In another embodiment, a binding element comprising a TGFβ4. In another embodiment, a binding element comprising a TGFβ4 comprises SEQ ID NO: 85. In an aspect of this embodiment, a binding element comprising a TGFβ4 comprises amino acids 276-373 of SEQ ID NO: 88.
[0244]In other aspects of this embodiment, a binding element comprising a TGFβ4 has, e.g., at least 70% amino acid identity with amino acids 276-373 of SEQ ID NO: 88, at least 75% amino acid identity with amino acids 276-373 of SEQ ID NO: 88, at least 80% amino acid identity with amino acids 276-373 of SEQ ID NO: 88, at least 85% amino acid identity with amino acids 276-373 of SEQ ID NO: 88, at least 90% amino acid identity with amino acids 276-373 of SEQ ID NO: 88 or at least 95% amino acid identity with amino acids 276-373 of SEQ ID NO: 88. In yet other aspects of this embodiment, a binding element comprising a TGFβ4 has, e.g., at most 70% amino acid identity with amino acids 276-373 of SEQ ID NO: 88, at most 75% amino acid identity with amino acids 276-373 of SEQ ID NO: 88, at most 80% amino acid identity with amino acids 276-373 of SEQ ID NO: 88, at most 85% amino acid identity with amino acids 276-373 of SEQ ID NO: 88, at most 90% amino acid identity with amino acids 276-373 of SEQ ID NO: 88 or at most 95% amino acid identity with amino acids 276-373 of SEQ ID NO: 88.
[0245]In other aspects of this embodiment, a binding element comprising a TGFβ4 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 276-373 of SEQ ID NO: 88. In other aspects of this embodiment, a binding element comprising a TGFβ4 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 276-373 of SEQ ID NO: 88. In yet other aspects of this embodiment, a binding element comprising a TGFβ4 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 276-373 of SEQ ID NO: 88. In other aspects of this embodiment, a binding element comprising a TGFβ4 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 276-373 of SEQ ID NO: 88. In still other aspects of this embodiment, a binding element comprising a TGFβ4 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 276-373 of SEQ ID NO: 88. In other aspects of this embodiment, a binding element comprising a TGFβ4 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 276-373 of SEQ ID NO: 88.
[0246]In other aspects of this embodiment, a binding element comprising a TGFβ4 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 276-373 of SEQ ID NO: 88. In other aspects of this embodiment, a binding element comprising a TGFβ4 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 276-373 of SEQ ID NO: 88. In yet other aspects of this embodiment, a binding element comprising a TGFβ4 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 276-373 of SEQ ID NO: 88. In other aspects of this embodiment, a binding element comprising a TGFβ4 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 276-373 of SEQ ID NO: 88. In still other aspects of this embodiment, a binding element comprising a TGFβ4 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 276-373 of SEQ ID NO: 88. In other aspects of this embodiment, a binding element comprising a TGFβ4 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 276-373 of SEQ ID NO: 88.
[0247]Another example of a binding element disclosed in the present specification is, e.g., a BMPs, such as, e.g., a BMP2, a BMP3, a BMP4, a BMP5, a BMP6, a BMP7, a BMP8 or a BMP10.
[0248]Thus, in an embodiment, a binding element comprising a BMP2. In another embodiment, a binding element comprising a BMP2 comprises SEQ ID NO: 89. In an aspect of this embodiment, a binding element comprising a BMP2 comprises amino acids 296-396 of SEQ ID NO: 89.
[0249]In other aspects of this embodiment, a binding element comprising a BMP2 has, e.g., at least 70% amino acid identity with amino acids 296-396 of SEQ ID NO: 89, at least 75% amino acid identity with amino acids 296-396 of SEQ ID NO: 89, at least 80% amino acid identity with amino acids 296-396 of SEQ ID NO: 89, at least 85% amino acid identity with amino acids 296-396 of SEQ ID NO: 89, at least 90% amino acid identity with amino acids 296-396 of SEQ ID NO: 89 or at least 95% amino acid identity with amino acids 296-396 of SEQ ID NO: 89. In yet other aspects of this embodiment, a binding element comprising a BMP2 has, e.g., at most 70% amino acid identity with amino acids 296-396 of SEQ ID NO: 89, at most 75% amino acid identity with amino acids 296-396 of SEQ ID NO: 89, at most 80% amino acid identity with amino acids 296-396 of SEQ ID NO: 89, at most 85% amino acid identity with amino acids 296-396 of SEQ ID NO: 89, at most 90% amino acid identity with amino acids 296-396 of SEQ ID NO: 89 or at most 95% amino acid identity with amino acids 296-396 of SEQ ID NO: 89.
[0250]In other aspects of this embodiment, a binding element comprising a BMP2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 296-396 of SEQ ID NO: 89. In other aspects of this embodiment, a binding element comprising a BMP2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 296-396 of SEQ ID NO: 89. In yet other aspects of this embodiment, a binding element comprising a BMP2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 296-396 of SEQ ID NO: 89. In other aspects of this embodiment, a binding element comprising a BMP2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 296-396 of SEQ ID NO: 89. In still other aspects of this embodiment, a binding element comprising a BMP2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 296-396 of SEQ ID NO: 89. In other aspects of this embodiment, a binding element comprising a BMP2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 296-396 of SEQ ID NO: 89.
[0251]In other aspects of this embodiment, a binding element comprising a BMP2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 296-396 of SEQ ID NO: 89. In other aspects of this embodiment, a binding element comprising a BMP2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 296-396 of SEQ ID NO: 89. In yet other aspects of this embodiment, a binding element comprising a BMP2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 296-396 of SEQ ID NO: 89. In other aspects of this embodiment, a binding element comprising a BMP2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 296-396 of SEQ ID NO: 89. In still other aspects of this embodiment, a binding element comprising a BMP2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 296-396 of SEQ ID NO: 89. In other aspects of this embodiment, a binding element comprising a BMP2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 296-396 of SEQ ID NO: 89.
[0252]In another embodiment, a binding element comprising a BMP3. In another embodiment, a binding element comprising a BMP3 comprises SEQ ID NO: 90. In an aspect of this embodiment, a binding element comprising a BMP3 comprises amino acids 370-472 of SEQ ID NO: 90.
[0253]In other aspects of this embodiment, a binding element comprising a BMP3 has, e.g., at least 70% amino acid identity with amino acids 370-472 of SEQ ID NO: 90, at least 75% amino acid identity with amino acids 370-472 of SEQ ID NO: 90, at least 80% amino acid identity with amino acids 370-472 of SEQ ID NO: 90, at least 85% amino acid identity with amino acids 370-472 of SEQ ID NO: 90, at least 90% amino acid identity with amino acids 370-472 of SEQ ID NO: 90 or at least 95% amino acid identity with amino acids 370-472 of SEQ ID NO: 90. In yet other aspects of this embodiment, a binding element comprising a BMP3 has, e.g., at most 70% amino acid identity with amino acids 370-472 of SEQ ID NO: 90, at most 75% amino acid identity with amino acids 370-472 of SEQ ID NO: 90, at most 80% amino acid identity with amino acids 370-472 of SEQ ID NO: 90, at most 85% amino acid identity with amino acids 370-472 of SEQ ID NO: 90, at most 90% amino acid identity with amino acids 370-472 of SEQ ID NO: 90 or at most 95% amino acid identity with amino acids 370-472 of SEQ ID NO: 90.
[0254]In other aspects of this embodiment, a binding element comprising a BMP3 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 370-472 of SEQ ID NO: 90. In other aspects of this embodiment, a binding element comprising a BMP3 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 370-472 of SEQ ID NO: 90. In yet other aspects of this embodiment, a binding element comprising a BMP3 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 370-472 of SEQ ID NO: 90. In other aspects of this embodiment, a binding element comprising a BMP3 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 370-472 of SEQ ID NO: 90. In still other aspects of this embodiment, a binding element comprising a BMP3 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 370-472 of SEQ ID NO: 90. In other aspects of this embodiment, a binding element comprising a BMP3 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 370-472 of SEQ ID NO: 90.
[0255]In other aspects of this embodiment, a binding element comprising a BMP3 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 370-472 of SEQ ID NO: 90. In other aspects of this embodiment, a binding element comprising a BMP3 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 370-472 of SEQ ID NO: 90. In yet other aspects of this embodiment, a binding element comprising a BMP3 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 370-472 of SEQ ID NO: 90. In other aspects of this embodiment, a binding element comprising a BMP3 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 370-472 of SEQ ID NO: 90. In still other aspects of this embodiment, a binding element comprising a BMP3 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 370-472 of SEQ ID NO: 90. In other aspects of this embodiment, a binding element comprising a BMP3 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 370-472 of SEQ ID NO: 90.
[0256]In another embodiment, a binding element comprising a BMP4. In another embodiment, a binding element comprising a BMP4 comprises SEQ ID NO: 91. In an aspect of this embodiment, a binding element comprising a BMP4 comprises amino acids 309-409 of SEQ ID NO: 91.
[0257]In other aspects of this embodiment, a binding element comprising a BMP4 has, e.g., at least 70% amino acid identity with amino acids 309-409 of SEQ ID NO: 91, at least 75% amino acid identity with amino acids 309-409 of SEQ ID NO: 91, at least 80% amino acid identity with amino acids 309-409 of SEQ ID NO: 91, at least 85% amino acid identity with amino acids 309-409 of SEQ ID NO: 91, at least 90% amino acid identity with amino acids 309-409 of SEQ ID NO: 91 or at least 95% amino acid identity with amino acids 309-409 of SEQ ID NO: 91. In yet other aspects of this embodiment, a binding element comprising a BMP4 has, e.g., at most 70% amino acid identity with amino acids 309-409 of SEQ ID NO: 91, at most 75% amino acid identity with amino acids 309-409 of SEQ ID NO: 91, at most 80% amino acid identity with amino acids 309-409 of SEQ ID NO: 91, at most 85% amino acid identity with amino acids 309-409 of SEQ ID NO: 91, at most 90% amino acid identity with amino acids 309-409 of SEQ ID NO: 91 or at most 95% amino acid identity with amino acids 309-409 of SEQ ID NO: 91.
[0258]In other aspects of this embodiment, a binding element comprising a BMP4 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 309-409 of SEQ ID NO: 91. In other aspects of this embodiment, a binding element comprising a BMP4 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 309-409 of SEQ ID NO: 91. In yet other aspects of this embodiment, a binding element comprising a BMP4 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 309-409 of SEQ ID NO: 91. In other aspects of this embodiment, a binding element comprising a BMP4 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 309-409 of SEQ ID NO: 91. In still other aspects of this embodiment, a binding element comprising a BMP4 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 309-409 of SEQ ID NO: 91. In other aspects of this embodiment, a binding element comprising a BMP4 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 309-409 of SEQ ID NO: 91.
[0259]In other aspects of this embodiment, a binding element comprising a BMP4 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 309-409 of SEQ ID NO: 91. In other aspects of this embodiment, a binding element comprising a BMP4 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 309-409 of SEQ ID NO: 91. In yet other aspects of this embodiment, a binding element comprising a BMP4 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 309-409 of SEQ ID NO: 91. In other aspects of this embodiment, a binding element comprising a BMP4 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 309-409 of SEQ ID NO: 91. In still other aspects of this embodiment, a binding element comprising a BMP4 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 309-409 of SEQ ID NO: 91. In other aspects of this embodiment, a binding element comprising a BMP4 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 309-409 of SEQ ID NO: 91.
[0260]In another embodiment, a binding element comprising a BMP5. In another embodiment, a binding element comprising a BMP5 comprises SEQ ID NO: 92. In an aspect of this embodiment, a binding element comprising a BMP5 comprises amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92.
[0261]In other aspects of this embodiment, a binding element comprising a BMP5 has, e.g., at least 70% amino acid identity with amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92, at least 75% amino acid identity with amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92, at least 80% amino acid identity with amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92, at least 85% amino acid identity with amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92, at least 90% amino acid identity with amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92 or at least 95% amino acid identity with amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92. In yet other aspects of this embodiment, a binding element comprising a BMP5 has, e.g., at most 70% amino acid identity with amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92, at most 75% amino acid identity with amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92, at most 80% amino acid identity with amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92, at most 85% amino acid identity with amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92, at most 90% amino acid identity with amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92 or at most 95% amino acid identity with amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92.
[0262]In other aspects of this embodiment, a binding element comprising a BMP5 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92. In other aspects of this embodiment, a binding element comprising a BMP5 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92. In yet other aspects of this embodiment, a binding element comprising a BMP5 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92. In other aspects of this embodiment, a binding element comprising a BMP5 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92. In still other aspects of this embodiment, a binding element comprising a BMP5 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92. In other aspects of this embodiment, a binding element comprising a BMP5 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92.
[0263]In other aspects of this embodiment, a binding element comprising a BMP5 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92. In other aspects of this embodiment, a binding element comprising a BMP5 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92. In yet other aspects of this embodiment, a binding element comprising a BMP5 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92. In other aspects of this embodiment, a binding element comprising a BMP5 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92. In still other aspects of this embodiment, a binding element comprising a BMP5 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92. In other aspects of this embodiment, a binding element comprising a BMP5 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92.
[0264]In another embodiment, a binding element comprising a BMP6. In another embodiment, a binding element comprising a BMP6 comprises SEQ ID NO: 93. In an aspect of this embodiment, a binding element comprising a BMP6 comprises amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93.
[0265]In other aspects of this embodiment, a binding element comprising a BMP6 has, e.g., at least 70% amino acid identity with amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93, at least 75% amino acid identity with amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93, at least 80% amino acid identity with amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93, at least 85% amino acid identity with amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93, at least 90% amino acid identity with amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93 or at least 95% amino acid identity with amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93. In yet other aspects of this embodiment, a binding element comprising a BMP6 has, e.g., at most 70% amino acid identity with amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93, at most 75% amino acid identity with amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93, at most 80% amino acid identity with amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93, at most 85% amino acid identity with amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93, at most 90% amino acid identity with amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93 or at most 95% amino acid identity with amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93.
[0266]In other aspects of this embodiment, a binding element comprising a BMP6 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93. In other aspects of this embodiment, a binding element comprising a BMP6 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93. In yet other aspects of this embodiment, a binding element comprising a BMP6 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93. In other aspects of this embodiment, a binding element comprising a BMP6 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93. In still other aspects of this embodiment, a binding element comprising a BMP6 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93. In other aspects of this embodiment, a binding element comprising a BMP6 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93.
[0267]In other aspects of this embodiment, a binding element comprising a BMP6 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93. In other aspects of this embodiment, a binding element comprising a BMP6 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93. In yet other aspects of this embodiment, a binding element comprising a BMP6 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93. In other aspects of this embodiment, a binding element comprising a BMP6 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93. In still other aspects of this embodiment, a binding element comprising a BMP6 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93. In other aspects of this embodiment, a binding element comprising a BMP6 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93.
[0268]In another embodiment, a binding element comprising a BMP7. In another embodiment, a binding element comprising a BMP7 comprises SEQ ID NO: 94. In an aspect of this embodiment, a binding element comprising a BMP7 comprises amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94.
[0269]In other aspects of this embodiment, a binding element comprising a BMP7 has, e.g., at least 70% amino acid identity with amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94, at least 75% amino acid identity with amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94, at least 80% amino acid identity with amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94, at least 85% amino acid identity with amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94, at least 90% amino acid identity with amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94 or at least 95% amino acid identity with amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94. In yet other aspects of this embodiment, a binding element comprising a BMP7 has, e.g., at most 70% amino acid identity with amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94, at most 75% amino acid identity with amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94, at most 80% amino acid identity with amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94, at most 85% amino acid identity with amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94, at most 90% amino acid identity with amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94 or at most 95% amino acid identity with amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94.
[0270]In other aspects of this embodiment, a binding element comprising a BMP7 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94. In other aspects of this embodiment, a binding element comprising a BMP7 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94. In yet other aspects of this embodiment, a binding element comprising a BMP7 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94. In other aspects of this embodiment, a binding element comprising a BMP7 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94. In still other aspects of this embodiment, a binding element comprising a BMP7 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94. In other aspects of this embodiment, a binding element comprising a BMP7 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94.
[0271]In other aspects of this embodiment, a binding element comprising a BMP7 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94. In other aspects of this embodiment, a binding element comprising a BMP7 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94. In yet other aspects of this embodiment, a binding element comprising a BMP7 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94. In other aspects of this embodiment, a binding element comprising a BMP7 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94. In still other aspects of this embodiment, a binding element comprising a BMP7 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94. In other aspects of this embodiment, a binding element comprising a BMP7 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94.
[0272]In another embodiment, a binding element comprising a BMP8. In another embodiment, a binding element comprising a BMP8 comprises SEQ ID NO: 95. In an aspect of this embodiment, a binding element comprising a BMP8 comprises amino acids 301-402 of SEQ ID NO: 95.
[0273]In other aspects of this embodiment, a binding element comprising a BMP8 has, e.g., at least 70% amino acid identity with amino acids 301-402 of SEQ ID NO: 95, at least 75% amino acid identity with amino acids 301-402 of SEQ ID NO: 95, at least 80% amino acid identity with amino acids 301-402 of SEQ ID NO: 95, at least 85% amino acid identity with amino acids 301-402 of SEQ ID NO: 95, at least 90% amino acid identity with amino acids 301-402 of SEQ ID NO: 95 or at least 95% amino acid identity with amino acids 301-402 of SEQ ID NO: 95. In yet other aspects of this embodiment, a binding element comprising a BMP8 has, e.g., at most 70% amino acid identity with amino acids 301-402 of SEQ ID NO: 95, at most 75% amino acid identity with amino acids 301-402 of SEQ ID NO: 95, at most 80% amino acid identity with amino acids 301-402 of SEQ ID NO: 95, at most 85% amino acid identity with amino acids 301-402 of SEQ ID NO: 95, at most 90% amino acid identity with amino acids 301-402 of SEQ ID NO: 95 or at most 95% amino acid identity with amino acids 301-402 of SEQ ID NO: 95.
[0274]In other aspects of this embodiment, a binding element comprising a BMP8 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 301-402 of SEQ ID NO: 95. In other aspects of this embodiment, a binding element comprising a BMP8 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 301-402 of SEQ ID NO: 95. In yet other aspects of this embodiment, a binding element comprising a BMP8 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 301-402 of SEQ ID NO: 95. In other aspects of this embodiment, a binding element comprising a BMP8 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 301-402 of SEQ ID NO: 95. In still other aspects of this embodiment, a binding element comprising a BMP8 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 301-402 of SEQ ID NO: 95. In other aspects of this embodiment, a binding element comprising a BMP8 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 301-402 of SEQ ID NO: 95.
[0275]In other aspects of this embodiment, a binding element comprising a BMP8 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 301-402 of SEQ ID NO: 95. In other aspects of this embodiment, a binding element comprising a BMP8 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 301-402 of SEQ ID NO: 95. In yet other aspects of this embodiment, a binding element comprising a BMP8 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 301-402 of SEQ ID NO: 95. In other aspects of this embodiment, a binding element comprising a BMP8 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 301-402 of SEQ ID NO: 95. In still other aspects of this embodiment, a binding element comprising a BMP8 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 301-402 of SEQ ID NO: 95. In other aspects of this embodiment, a binding element comprising a BMP8 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 301-402 of SEQ ID NO: 95.
[0276]In another embodiment, a binding element comprising a BMP10. In another embodiment, a binding element comprising a BMP10 comprises SEQ ID NO: 96. In an aspect of this embodiment, a binding element comprising a BMP10 comprises amino acids 323-424 of SEQ ID NO: 96.
[0277]In other aspects of this embodiment, a binding element comprising a BMP10 has, e.g., at least 70% amino acid identity with amino acids 323-424 of SEQ ID NO: 96, at least 75% amino acid identity with amino acids 323-424 of SEQ ID NO: 96, at least 80% amino acid identity with amino acids 323-424 of SEQ ID NO: 96, at least 85% amino acid identity with amino acids 323-424 of SEQ ID NO: 96, at least 90% amino acid identity with amino acids 323-424 of SEQ ID NO: 96 or at least 95% amino acid identity with amino acids 323-424 of SEQ ID NO: 96. In yet other aspects of this embodiment, a binding element comprising a BMP10 has, e.g., at most 70% amino acid identity with amino acids 323-424 of SEQ ID NO: 96, at most 75% amino acid identity with amino acids 323-424 of SEQ ID NO: 96, at most 80% amino acid identity with amino acids 323-424 of SEQ ID NO: 96, at most 85% amino acid identity with amino acids 323-424 of SEQ ID NO: 96, at most 90% amino acid identity with amino acids 323-424 of SEQ ID NO: 96 or at most 95% amino acid identity with amino acids 323-424 of SEQ ID NO: 96.
[0278]In other aspects of this embodiment, a binding element comprising a BMP10 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 323-424 of SEQ ID NO: 96. In other aspects of this embodiment, a binding element comprising a BMP10 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 323-424 of SEQ ID NO: 96. In yet other aspects of this embodiment, a binding element comprising a BMP10 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 323-424 of SEQ ID NO: 96. In other aspects of this embodiment, a binding element comprising a BMP10 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 323-424 of SEQ ID NO: 96. In still other aspects of this embodiment, a binding element comprising a BMP10 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 323-424 of SEQ ID NO: 96. In other aspects of this embodiment, a binding element comprising a BMP10 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 323-424 of SEQ ID NO: 96.
[0279]In other aspects of this embodiment, a binding element comprising a BMP10 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 323-424 of SEQ ID NO: 96. In other aspects of this embodiment, a binding element comprising a BMP10 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 323-424 of SEQ ID NO: 96. In yet other aspects of this embodiment, a binding element comprising a BMP10 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 323-424 of SEQ ID NO: 96. In other aspects of this embodiment, a binding element comprising a BMP10 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 323-424 of SEQ ID NO: 96. In still other aspects of this embodiment, a binding element comprising a BMP10 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 323-424 of SEQ ID NO: 96. In other aspects of this embodiment, a binding element comprising a BMP10 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 323-424 of SEQ ID NO: 96.
[0280]Another example of a binding element disclosed in the present specification is, e.g., a GDFs, such as, e.g., a GDF1, a GDF2, a GDF3, a GDF5, a GDF6, a GDF7, a GDF8, a GDF10, a GDF11 or a GDF15.
[0281]Thus, in an embodiment, a binding element comprising a GDF1. In another embodiment, a binding element comprising a GDF1 comprises SEQ ID NO: 97. In an aspect of this embodiment, a binding element comprising a GDF1 comprises amino acids 267-372 of SEQ ID NO: 97.
[0282]In other aspects of this embodiment, a binding element comprising a GDF1 has, e.g., at least 70% amino acid identity with amino acids 267-372 of SEQ ID NO: 97, at least 75% amino acid identity with amino acids 267-372 of SEQ ID NO: 97, at least 80% amino acid identity with amino acids 267-372 of SEQ ID NO: 97, at least 85% amino acid identity with amino acids 267-372 of SEQ ID NO: 97, at least 90% amino acid identity with amino acids 267-372 of SEQ ID NO: 97 or at least 95% amino acid identity with amino acids 267-372 of SEQ ID NO: 97. In yet other aspects of this embodiment, a binding element comprising a GDF1 has, e.g., at most 70% amino acid identity with amino acids 267-372 of SEQ ID NO: 97, at most 75% amino acid identity with amino acids 267-372 of SEQ ID NO: 97, at most 80% amino acid identity with amino acids 267-372 of SEQ ID NO: 97, at most 85% amino acid identity with amino acids 267-372 of SEQ ID NO: 97, at most 90% amino acid identity with amino acids 267-372 of SEQ ID NO: 97 or at most 95% amino acid identity with amino acids 267-372 of SEQ ID NO: 97.
[0283]In other aspects of this embodiment, a binding element comprising a GDF1 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 267-372 of SEQ ID NO: 97. In other aspects of this embodiment, a binding element comprising a GDF1 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 267-372 of SEQ ID NO: 97. In yet other aspects of this embodiment, a binding element comprising a GDF1 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 267-372 of SEQ ID NO: 97. In other aspects of this embodiment, a binding element comprising a GDF1 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 267-372 of SEQ ID NO: 97. In still other aspects of this embodiment, a binding element comprising a GDF1 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 267-372 of SEQ ID NO: 97. In other aspects of this embodiment, a binding element comprising a GDF1 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 267-372 of SEQ ID NO: 97.
[0284]In other aspects of this embodiment, a binding element comprising a GDF1 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 267-372 of SEQ ID NO: 97. In other aspects of this embodiment, a binding element comprising a GDF1 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 267-372 of SEQ ID NO: 97. In yet other aspects of this embodiment, a binding element comprising a GDF1 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 267-372 of SEQ ID NO: 97. In other aspects of this embodiment, a binding element comprising a GDF1 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 267-372 of SEQ ID NO: 97. In still other aspects of this embodiment, a binding element comprising a GDF1 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 267-372 of SEQ ID NO: 97. In other aspects of this embodiment, a binding element comprising a GDF1 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 267-372 of SEQ ID NO: 97.
[0285]In another embodiment, a binding element comprising a GDF2. In another embodiment, a binding element comprising a GDF2 comprises SEQ ID NO: 98. In an aspect of this embodiment, a binding element comprising a GDF2 comprises amino acids 327-429 of SEQ ID NO: 98. In other aspects of this embodiment, a binding element comprising a GDF2 has, e.g., at least 70% amino acid identity with amino acids 327-429 of SEQ ID NO: 98, at least 75% amino acid identity with amino acids 327-429 of SEQ ID NO: 98, at least 80% amino acid identity with amino acids 327-429 of SEQ ID NO: 98, at least 85% amino acid identity with amino acids 327-429 of SEQ ID NO: 98, at least 90% amino acid identity with amino acids 327-429 of SEQ ID NO: 98 or at least 95% amino acid identity with amino acids 327-429 of SEQ ID NO: 98. In yet other aspects of this embodiment, a binding element comprising a GDF2 has, e.g., at most 70% amino acid identity with amino acids 327-429 of SEQ ID NO: 98, at most 75% amino acid identity with amino acids 327-429 of SEQ ID NO: 98, at most 80% amino acid identity with amino acids 327-429 of SEQ ID NO: 98, at most 85% amino acid identity with amino acids 327-429 of SEQ ID NO: 98, at most 90% amino acid identity with amino acids 327-429 of SEQ ID NO: 98 or at most 95% amino acid identity with amino acids 327-429 of SEQ ID NO: 98.
[0286]In other aspects of this embodiment, a binding element comprising a GDF2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 327-429 of SEQ ID NO: 98. In other aspects of this embodiment, a binding element comprising a GDF2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 327-429 of SEQ ID NO: 98. In yet other aspects of this embodiment, a binding element comprising a GDF2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 327-429 of SEQ ID NO: 98. In other aspects of this embodiment, a binding element comprising a GDF2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 327-429 of SEQ ID NO: 98. In still other aspects of this embodiment, a binding element comprising a GDF2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 327-429 of SEQ ID NO: 98. In other aspects of this embodiment, a binding element comprising a GDF2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 327-429 of SEQ ID NO: 98.
[0287]In other aspects of this embodiment, a binding element comprising a GDF2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 327-429 of SEQ ID NO: 98. In other aspects of this embodiment, a binding element comprising a GDF2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 327-429 of SEQ ID NO: 98. In yet other aspects of this embodiment, a binding element comprising a GDF2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 327-429 of SEQ ID NO: 98. In other aspects of this embodiment, a binding element comprising a GDF2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 327-429 of SEQ ID NO: 98. In still other aspects of this embodiment, a binding element comprising a GDF2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 327-429 of SEQ ID NO: 98. In other aspects of this embodiment, a binding element comprising a GDF2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 327-429 of SEQ ID NO: 98.
[0288]In another embodiment, a binding element comprising a GDF3. In another embodiment, a binding element comprising a GDF3 comprises SEQ ID NO: 99. In an aspect of this embodiment, a binding element comprising a GDF3 comprises amino acids 264-364 of SEQ ID NO: 99.
[0289]In other aspects of this embodiment, a binding element comprising a GDF3 has, e.g., at least 70% amino acid identity with amino acids 264-364 of SEQ ID NO: 99, at least 75% amino acid identity with amino acids 264-364 of SEQ ID NO: 99, at least 80% amino acid identity with amino acids 264-364 of SEQ ID NO: 99, at least 85% amino acid identity with amino acids 264-364 of SEQ ID NO: 99, at least 90% amino acid identity with amino acids 264-364 of SEQ ID NO: 99 or at least 95% amino acid identity with amino acids 264-364 of SEQ ID NO: 99. In yet other aspects of this embodiment, a binding element comprising a GDF3 has, e.g., at most 70% amino acid identity with amino acids 264-364 of SEQ ID NO: 99, at most 75% amino acid identity with amino acids 264-364 of SEQ ID NO: 99, at most 80% amino acid identity with amino acids 264-364 of SEQ ID NO: 99, at most 85% amino acid identity with amino acids 264-364 of SEQ ID NO: 99, at most 90% amino acid identity with amino acids 264-364 of SEQ ID NO: 99 or at most 95% amino acid identity with amino acids 264-364 of SEQ ID NO: 99.
[0290]In other aspects of this embodiment, a binding element comprising a GDF3 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 264-364 of SEQ ID NO: 99. In other aspects of this embodiment, a binding element comprising a GDF3 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 264-364 of SEQ ID NO: 99. In yet other aspects of this embodiment, a binding element comprising a GDF3 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 264-364 of SEQ ID NO: 99. In other aspects of this embodiment, a binding element comprising a GDF3 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 264-364 of SEQ ID NO: 99. In still other aspects of this embodiment, a binding element comprising a GDF3 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 264-364 of SEQ ID NO: 99. In other aspects of this embodiment, a binding element comprising a GDF3 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 264-364 of SEQ ID NO: 99.
[0291]In other aspects of this embodiment, a binding element comprising a GDF3 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 264-364 of SEQ ID NO: 99. In other aspects of this embodiment, a binding element comprising a GDF3 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 264-364 of SEQ ID NO: 99. In yet other aspects of this embodiment, a binding element comprising a GDF3 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 264-364 of SEQ ID NO: 99. In other aspects of this embodiment, a binding element comprising a GDF3 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 264-364 of SEQ ID NO: 99. In still other aspects of this embodiment, a binding element comprising a GDF3 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 264-364 of SEQ ID NO: 99. In other aspects of this embodiment, a binding element comprising a GDF3 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 264-364 of SEQ ID NO: 99.
[0292]In another embodiment, a binding element comprising a GDF5. In another embodiment, a binding element comprising a GDF5 comprises SEQ ID NO: 100. In an aspect of this embodiment, a binding element comprising a GDF5 comprises amino acids 400-501 of SEQ ID NO: 100.
[0293]In other aspects of this embodiment, a binding element comprising a GDF5 has, e.g., at least 70% amino acid identity with amino acids 400-501 of SEQ ID NO: 100, at least 75% amino acid identity with amino acids 400-501 of SEQ ID NO: 100, at least 80% amino acid identity with amino acids 400-501 of SEQ ID NO: 100, at least 85% amino acid identity with amino acids 400-501 of SEQ ID NO: 100, at least 90% amino acid identity with amino acids 400-501 of SEQ ID NO: 100 or at least 95% amino acid identity with amino acids 400-501 of SEQ ID NO: 100. In yet other aspects of this embodiment, a binding element comprising a GDF5 has, e.g., at most 70% amino acid identity with amino acids 400-501 of SEQ ID NO: 100, at most 75% amino acid identity with amino acids 400-501 of SEQ ID NO: 100, at most 80% amino acid identity with amino acids 400-501 of SEQ ID NO: 100, at most 85% amino acid identity with amino acids 400-501 of SEQ ID NO: 100, at most 90% amino acid identity with amino acids 400-501 of SEQ ID NO: 100 or at most 95% amino acid identity with amino acids 400-501 of SEQ ID NO: 100.
[0294]In other aspects of this embodiment, a binding element comprising a GDF5 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 400-501 of SEQ ID NO: 100. In other aspects of this embodiment, a binding element comprising a GDF5 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 400-501 of SEQ ID NO: 100. In yet other aspects of this embodiment, a binding element comprising a GDF5 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 400-501 of SEQ ID NO: 100. In other aspects of this embodiment, a binding element comprising a GDF5 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 400-501 of SEQ ID NO: 100. In still other aspects of this embodiment, a binding element comprising a GDF5 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 400-501 of SEQ ID NO: 100. In other aspects of this embodiment, a binding element comprising a GDF5 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 400-501 of SEQ ID NO: 100.
[0295]In other aspects of this embodiment, a binding element comprising a GDF5 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 400-501 of SEQ ID NO: 100. In other aspects of this embodiment, a binding element comprising a GDF5 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 400-501 of SEQ ID NO: 100. In yet other aspects of this embodiment, a binding element comprising a GDF5 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 400-501 of SEQ ID NO: 100. In other aspects of this embodiment, a binding element comprising a GDF5 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 400-501 of SEQ ID NO: 100. In still other aspects of this embodiment, a binding element comprising a GDF5 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 400-501 of SEQ ID NO: 100. In other aspects of this embodiment, a binding element comprising a GDF5 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 400-501 of SEQ ID NO: 100.
[0296]In another embodiment, a binding element comprising a GDF6. In another embodiment, a binding element comprising a GDF6 comprises SEQ ID NO: 101. In an aspect of this embodiment, a binding element comprising a GDF6 comprises amino acids 354-455 of SEQ ID NO: 101.
[0297]In other aspects of this embodiment, a binding element comprising a GDF6 has, e.g., at least 70% amino acid identity with amino acids 354-455 of SEQ ID NO: 101, at least 75% amino acid identity with amino acids 354-455 of SEQ ID NO: 101, at least 80% amino acid identity with amino acids 354-455 of SEQ ID NO: 101, at least 85% amino acid identity with amino acids 354-455 of SEQ ID NO: 101, at least 90% amino acid identity with amino acids 354-455 of SEQ ID NO: 101 or at least 95% amino acid identity with amino acids 354-455 of SEQ ID NO: 101. In yet other aspects of this embodiment, a binding element comprising a GDF6 has, e.g., at most 70% amino acid identity with amino acids 354-455 of SEQ ID NO: 101, at most 75% amino acid identity with amino acids 354-455 of SEQ ID NO: 101, at most 80% amino acid identity with amino acids 354-455 of SEQ ID NO: 101, at most 85% amino acid identity with amino acids 354-455 of SEQ ID NO: 101, at most 90% amino acid identity with amino acids 354-455 of SEQ ID NO: 101 or at most 95% amino acid identity with amino acids 354-455 of SEQ ID NO: 101.
[0298]In other aspects of this embodiment, a binding element comprising a GDF6 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 354-455 of SEQ ID NO: 101. In other aspects of this embodiment, a binding element comprising a GDF6 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 354-455 of SEQ ID NO: 101. In yet other aspects of this embodiment, a binding element comprising a GDF6 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 354-455 of SEQ ID NO: 101. In other aspects of this embodiment, a binding element comprising a GDF6 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 354-455 of SEQ ID NO: 101. In still other aspects of this embodiment, a binding element comprising a GDF6 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 354-455 of SEQ ID NO: 101. In other aspects of this embodiment, a binding element comprising a GDF6 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 354-455 of SEQ ID NO: 101.
[0299]In other aspects of this embodiment, a binding element comprising a GDF6 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 354-455 of SEQ ID NO: 101. In other aspects of this embodiment, a binding element comprising a GDF6 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 354-455 of SEQ ID NO: 101. In yet other aspects of this embodiment, a binding element comprising a GDF6 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 354-455 of SEQ ID NO: 101. In other aspects of this embodiment, a binding element comprising a GDF6 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 354-455 of SEQ ID NO: 101. In still other aspects of this embodiment, a binding element comprising a GDF6 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 354-455 of SEQ ID NO: 101. In other aspects of this embodiment, a binding element comprising a GDF6 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 354-455 of SEQ ID NO: 101.
[0300]In another embodiment, a binding element comprising a GDF7. In another embodiment, a binding element comprising a GDF7 comprises SEQ ID NO: 102. In an aspect of this embodiment, a binding element comprising a GDF7 comprises amino acids 352-450 of SEQ ID NO: 102.
[0301]In other aspects of this embodiment, a binding element comprising a GDF7 has, e.g., at least 70% amino acid identity with amino acids 352-450 of SEQ ID NO: 102, at least 75% amino acid identity with amino acids 352-450 of SEQ ID NO: 102, at least 80% amino acid identity with amino acids 352-450 of SEQ ID NO: 102, at least 85% amino acid identity with amino acids 352-450 of SEQ ID NO: 102, at least 90% amino acid identity with amino acids 352-450 of SEQ ID NO: 102 or at least 95% amino acid identity with amino acids 352-450 of SEQ ID NO: 102. In yet other aspects of this embodiment, a binding element comprising a GDF7 has, e.g., at most 70% amino acid identity with amino acids 352-450 of SEQ ID NO: 102, at most 75% amino acid identity with amino acids 352-450 of SEQ ID NO: 102, at most 80% amino acid identity with amino acids 352-450 of SEQ ID NO: 102, at most 85% amino acid identity with amino acids 352-450 of SEQ ID NO: 102, at most 90% amino acid identity with amino acids 352-450 of SEQ ID NO: 102 or at most 95% amino acid identity with amino acids 352-450 of SEQ ID NO: 102.
[0302]In other aspects of this embodiment, a binding element comprising a GDF7 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 352-450 of SEQ ID NO: 102. In other aspects of this embodiment, a binding element comprising a GDF7 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 352-450 of SEQ ID NO: 102. In yet other aspects of this embodiment, a binding element comprising a GDF7 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 352-450 of SEQ ID NO: 102. In other aspects of this embodiment, a binding element comprising a GDF7 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 352-450 of SEQ ID NO: 102. In still other aspects of this embodiment, a binding element comprising a GDF7 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 352-450 of SEQ ID NO: 102. In other aspects of this embodiment, a binding element comprising a GDF7 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 352-450 of SEQ ID NO: 102.
[0303]In other aspects of this embodiment, a binding element comprising a GDF7 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 352-450 of SEQ ID NO: 102. In other aspects of this embodiment, a binding element comprising a GDF7 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 352-450 of SEQ ID NO: 102. In yet other aspects of this embodiment, a binding element comprising a GDF7 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 352-450 of SEQ ID NO: 102. In other aspects of this embodiment, a binding element comprising a GDF7 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 352-450 of SEQ ID NO: 102. In still other aspects of this embodiment, a binding element comprising a GDF7 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 352-450 of SEQ ID NO: 102. In other aspects of this embodiment, a binding element comprising a GDF7 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 352-450 of SEQ ID NO: 102.
[0304]In another embodiment, a binding element comprising a GDF8. In another embodiment, a binding element comprising a GDF8 comprises SEQ ID NO: 103. In an aspect of this embodiment, a binding element comprising a GDF8 comprises amino acids 281-375 of SEQ ID NO: 103.
[0305]In other aspects of this embodiment, a binding element comprising a GDF8 has, e.g., at least 70% amino acid identity with amino acids 281-375 of SEQ ID NO: 103, at least 75% amino acid identity with amino acids 281-375 of SEQ ID NO: 103, at least 80% amino acid identity with amino acids 281-375 of SEQ ID NO: 103, at least 85% amino acid identity with amino acids 281-375 of SEQ ID NO: 103, at least 90% amino acid identity with amino acids 281-375 of SEQ ID NO: 103 or at least 95% amino acid identity with amino acids 281-375 of SEQ ID NO: 103. In yet other aspects of this embodiment, a binding element comprising a GDF8 has, e.g., at most 70% amino acid identity with amino acids 281-375 of SEQ ID NO: 103, at most 75% amino acid identity with amino acids 281-375 of SEQ ID NO: 103, at most 80% amino acid identity with amino acids 281-375 of SEQ ID NO: 103, at most 85% amino acid identity with amino acids 281-375 of SEQ ID NO: 103, at most 90% amino acid identity with amino acids 281-375 of SEQ ID NO: 103 or at most 95% amino acid identity with amino acids 281-375 of SEQ ID NO: 103.
[0306]In other aspects of this embodiment, a binding element comprising a GDF8 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 281-375 of SEQ ID NO: 103. In other aspects of this embodiment, a binding element comprising a GDF8 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 281-375 of SEQ ID NO: 103. In yet other aspects of this embodiment, a binding element comprising a GDF8 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 281-375 of SEQ ID NO: 103. In other aspects of this embodiment, a binding element comprising a GDF8 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 281-375 of SEQ ID NO: 103. In still other aspects of this embodiment, a binding element comprising a GDF8 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 281-375 of SEQ ID NO: 103. In other aspects of this embodiment, a binding element comprising a GDF8 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 281-375 of SEQ ID NO: 103.
[0307]In other aspects of this embodiment, a binding element comprising a GDF8 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 281-375 of SEQ ID NO: 103. In other aspects of this embodiment, a binding element comprising a GDF8 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 281-375 of SEQ ID NO: 103. In yet other aspects of this embodiment, a binding element comprising a GDF8 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 281-375 of SEQ ID NO: 103. In other aspects of this embodiment, a binding element comprising a GDF8 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 281-375 of SEQ ID NO: 103. In still other aspects of this embodiment, a binding element comprising a GDF8 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 281-375 of SEQ ID NO: 103. In other aspects of this embodiment, a binding element comprising a GDF8 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 281-375 of SEQ ID NO: 103.
[0308]In another embodiment, a binding element comprising a GDF10. In another embodiment, a binding element comprising a GDF10 comprises SEQ ID NO: 104. In an aspect of this embodiment, a binding element comprising a GDF10 comprises amino acids 376-478 of SEQ ID NO: 104.
[0309]In other aspects of this embodiment, a binding element comprising a GDF10 has, e.g., at least 70% amino acid identity with amino acids 376-478 of SEQ ID NO: 104, at least 75% amino acid identity with amino acids 376-478 of SEQ ID NO: 104, at least 80% amino acid identity with amino acids 376-478 of SEQ ID NO: 104, at least 85% amino acid identity with amino acids 376-478 of SEQ ID NO: 104, at least 90% amino acid identity with amino acids 376-478 of SEQ ID NO: 104 or at least 95% amino acid identity with amino acids 376-478 of SEQ ID NO: 104. In yet other aspects of this embodiment, a binding element comprising a GDF10 has, e.g., at most 70% amino acid identity with amino acids 376-478 of SEQ ID NO: 104, at most 75% amino acid identity with amino acids 376-478 of SEQ ID NO: 104, at most 80% amino acid identity with amino acids 376-478 of SEQ ID NO: 104, at most 85% amino acid identity with amino acids 376-478 of SEQ ID NO: 104, at most 90% amino acid identity with amino acids 376-478 of SEQ ID NO: 104 or at most 95% amino acid identity with amino acids 376-478 of SEQ ID NO: 104.
[0310]In other aspects of this embodiment, a binding element comprising a GDF10 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 376-478 of SEQ ID NO: 104. In other aspects of this embodiment, a binding element comprising a GDF10 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 376-478 of SEQ ID NO: 104. In yet other aspects of this embodiment, a binding element comprising a GDF10 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 376-478 of SEQ ID NO: 104. In other aspects of this embodiment, a binding element comprising a GDF10 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 376-478 of SEQ ID NO: 104. In still other aspects of this embodiment, a binding element comprising a GDF10 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 376-478 of SEQ ID NO: 104. In other aspects of this embodiment, a binding element comprising a GDF10 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 376-478 of SEQ ID NO: 104.
[0311]In other aspects of this embodiment, a binding element comprising a GDF10 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 376-478 of SEQ ID NO: 104. In other aspects of this embodiment, a binding element comprising a GDF10 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 376-478 of SEQ ID NO: 104. In yet other aspects of this embodiment, a binding element comprising a GDF10 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 376-478 of SEQ ID NO: 104. In other aspects of this embodiment, a binding element comprising a GDF10 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 376-478 of SEQ ID NO: 104. In still other aspects of this embodiment, a binding element comprising a GDF10 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 376-478 of SEQ ID NO: 104. In other aspects of this embodiment, a binding element comprising a GDF10 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 376-478 of SEQ ID NO: 104.
[0312]In another embodiment, a binding element comprising a GDF11. In another embodiment, a binding element comprising a GDF11 comprises SEQ ID NO: 105. In an aspect of this embodiment, a binding element comprising a GDF11 comprises amino acids 313-407 of SEQ ID NO: 105.
[0313]In other aspects of this embodiment, a binding element comprising a GDF11 has, e.g., at least 70% amino acid identity with amino acids 313-407 of SEQ ID NO: 105, at least 75% amino acid identity with amino acids 313-407 of SEQ ID NO: 105, at least 80% amino acid identity with amino acids 313-407 of SEQ ID NO: 105, at least 85% amino acid identity with amino acids 313-407 of SEQ ID NO: 105, at least 90% amino acid identity with amino acids 313-407 of SEQ ID NO: 105 or at least 95% amino acid identity with amino acids 313-407 of SEQ ID NO: 105. In yet other aspects of this embodiment, a binding element comprising a GDF11 has, e.g., at most 70% amino acid identity with amino acids 313-407 of SEQ ID NO: 105, at most 75% amino acid identity with amino acids 313-407 of SEQ ID NO: 105, at most 80% amino acid identity with amino acids 313-407 of SEQ ID NO: 105, at most 85% amino acid identity with amino acids 313-407 of SEQ ID NO: 105, at most 90% amino acid identity with amino acids 313-407 of SEQ ID NO: 105 or at most 95% amino acid identity with amino acids 313-407 of SEQ ID NO: 105.
[0314]In other aspects of this embodiment, a binding element comprising a GDF11 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 313-407 of SEQ ID NO: 105. In other aspects of this embodiment, a binding element comprising a GDF11 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 313-407 of SEQ ID NO: 105. In yet other aspects of this embodiment, a binding element comprising a GDF11 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 313-407 of SEQ ID NO: 105. In other aspects of this embodiment, a binding element comprising a GDF11 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 313-407 of SEQ ID NO: 105. In still other aspects of this embodiment, a binding element comprising a GDF11 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 313-407 of SEQ ID NO: 105. In other aspects of this embodiment, a binding element comprising a GDF11 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 313-407 of SEQ ID NO: 105.
[0315]In other aspects of this embodiment, a binding element comprising a GDF11 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 313-407 of SEQ ID NO: 105. In other aspects of this embodiment, a binding element comprising a GDF11 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 313-407 of SEQ ID NO: 105. In yet other aspects of this embodiment, a binding element comprising a GDF11 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 313-407 of SEQ ID NO: 105. In other aspects of this embodiment, a binding element comprising a GDF11 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 313-407 of SEQ ID NO: 105. In still other aspects of this embodiment, a binding element comprising a GDF11 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 313-407 of SEQ ID NO: 105. In other aspects of this embodiment, a binding element comprising a GDF11 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 313-407 of SEQ ID NO: 105.
[0316]In another embodiment, a binding element comprising a GDF15. In another embodiment, a binding element comprising a GDF15 comprises SEQ ID NO: 106. In an aspect of this embodiment, a binding element comprising a GDF15 comprises amino acids 211-308 of SEQ ID NO: 106.
[0317]In other aspects of this embodiment, a binding element comprising a GDF15 has, e.g., at least 70% amino acid identity with amino acids 211-308 of SEQ ID NO: 106, at least 75% amino acid identity with amino acids 211-308 of SEQ ID NO: 106, at least 80% amino acid identity with amino acids 211-308 of SEQ ID NO: 106, at least 85% amino acid identity with amino acids 211-308 of SEQ ID NO: 106, at least 90% amino acid identity with amino acids 211-308 of SEQ ID NO: 106 or at least 95% amino acid identity with amino acids 211-308 of SEQ ID NO: 106. In yet other aspects of this embodiment, a binding element comprising a GDF15 has, e.g., at most 70% amino acid identity with amino acids 211-308 of SEQ ID NO: 106, at most 75% amino acid identity with amino acids 211-308 of SEQ ID NO: 106, at most 80% amino acid identity with amino acids 211-308 of SEQ ID NO: 106, at most 85% amino acid identity with amino acids 211-308 of SEQ ID NO: 106, at most 90% amino acid identity with amino acids 211-308 of SEQ ID NO: 106 or at most 95% amino acid identity with amino acids 211-308 of SEQ ID NO: 106.
[0318]In other aspects of this embodiment, a binding element comprising a GDF15 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 211-308 of SEQ ID NO: 106. In other aspects of this embodiment, a binding element comprising a GDF15 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 211-308 of SEQ ID NO: 106. In yet other aspects of this embodiment, a binding element comprising a GDF15 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 211-308 of SEQ ID NO: 106. In other aspects of this embodiment, a binding element comprising a GDF15 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 211-308 of SEQ ID NO: 106. In still other aspects of this embodiment, a binding element comprising a GDF15 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 211-308 of SEQ ID NO: 106. In other aspects of this embodiment, a binding element comprising a GDF15 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 211-308 of SEQ ID NO: 106.
[0319]In other aspects of this embodiment, a binding element comprising a GDF15 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 211-308 of SEQ ID NO: 106. In other aspects of this embodiment, a binding element comprising a GDF15 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 211-308 of SEQ ID NO: 106. In yet other aspects of this embodiment, a binding element comprising a GDF15 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 211-308 of SEQ ID NO: 106. In other aspects of this embodiment, a binding element comprising a GDF15 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 211-308 of SEQ ID NO: 106. In still other aspects of this embodiment, a binding element comprising a GDF15 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 211-308 of SEQ ID NO: 106. In other aspects of this embodiment, a binding element comprising a GDF15 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 211-308 of SEQ ID NO: 106.
[0320]Another example of a binding element disclosed in the present specification is, e.g., an activin, such as, e.g., an activin A, an activin B, an activin C, an activin E or an inhibin A.
[0321]In another embodiment, a binding element comprising an Activin A. In another embodiment, a binding element comprising an Activin A comprises SEQ ID NO: 107. In an aspect of this embodiment, a binding element comprising an Activin A comprises amino acids 321-426 of SEQ ID NO: 107.
[0322]In other aspects of this embodiment, a binding element comprising an activin A has, e.g., at least 70% amino acid identity with amino acids 321-426 of SEQ ID NO: 107, at least 75% amino acid identity with amino acids 321-426 of SEQ ID NO: 107, at least 80% amino acid identity with amino acids 321-426 of SEQ ID NO: 107, at least 85% amino acid identity with amino acids 321-426 of SEQ ID NO: 107, at least 90% amino acid identity with amino acids 321-426 of SEQ ID NO: 107 or at least 95% amino acid identity with amino acids 321-426 of SEQ ID NO: 107. In yet other aspects of this embodiment, a binding element comprising an activin A has, e.g., at most 70% amino acid identity with amino acids 321-426 of SEQ ID NO: 107, at most 75% amino acid identity with amino acids 321-426 of SEQ ID NO: 107, at most 80% amino acid identity with amino acids 321-426 of SEQ ID NO: 107, at most 85% amino acid identity with amino acids 321-426 of SEQ ID NO: 107, at most 90% amino acid identity with amino acids 321-426 of SEQ ID NO: 107 or at most 95% amino acid identity with amino acids 321-426 of SEQ ID NO: 107.
[0323]In other aspects of this embodiment, a binding element comprising an activin A has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 321-426 of SEQ ID NO: 107. In other aspects of this embodiment, a binding element comprising an activin A has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 321-426 of SEQ ID NO: 107. In yet other aspects of this embodiment, a binding element comprising an activin A has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 321-426 of SEQ ID NO: 107. In other aspects of this embodiment, a binding element comprising an activin A has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 321-426 of SEQ ID NO: 107. In still other aspects of this embodiment, a binding element comprising an activin A has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 321-426 of SEQ ID NO: 107. In other aspects of this embodiment, a binding element comprising an activin A has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 321-426 of SEQ ID NO: 107.
[0324]In other aspects of this embodiment, a binding element comprising an activin A has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 321-426 of SEQ ID NO: 107. In other aspects of this embodiment, a binding element comprising an activin A has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 321-426 of SEQ ID NO: 107. In yet other aspects of this embodiment, a binding element comprising an activin A has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 321-426 of SEQ ID NO: 107. In other aspects of this embodiment, a binding element comprising an activin A has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 321-426 of SEQ ID NO: 107. In still other aspects of this embodiment, a binding element comprising an activin A has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 321-426 of SEQ ID NO: 107. In other aspects of this embodiment, a binding element comprising an activin A has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 321-426 of SEQ ID NO: 107.
[0325]In another embodiment, a binding element comprising an Activin B. In another embodiment, a binding element comprising an Activin B comprises SEQ ID NO: 108. In an aspect of this embodiment, a binding element comprising an Activin B comprises amino acids 303-406 of SEQ ID NO: 108.
[0326]In other aspects of this embodiment, a binding element comprising an activin B has, e.g., at least 70% amino acid identity with amino acids 303-406 of SEQ ID NO: 108, at least 75% amino acid identity with amino acids 303-406 of SEQ ID NO: 108, at least 80% amino acid identity with amino acids 303-406 of SEQ ID NO: 108, at least 85% amino acid identity with amino acids 303-406 of SEQ ID NO: 108, at least 90% amino acid identity with amino acids 303-406 of SEQ ID NO: 108 or at least 95% amino acid identity with amino acids 303-406 of SEQ ID NO: 108. In yet other aspects of this embodiment, a binding element comprising an activin B has, e.g., at most 70% amino acid identity with amino acids 303-406 of SEQ ID NO: 108, at most 75% amino acid identity with amino acids 303-406 of SEQ ID NO: 108, at most 80% amino acid identity with amino acids 303-406 of SEQ ID NO: 108, at most 85% amino acid identity with amino acids 303-406 of SEQ ID NO: 108, at most 90% amino acid identity with amino acids 303-406 of SEQ ID NO: 108 or at most 95% amino acid identity with amino acids 303-406 of SEQ ID NO: 108.
[0327]In other aspects of this embodiment, a binding element comprising an activin B has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 303-406 of SEQ ID NO: 108. In other aspects of this embodiment, a binding element comprising an activin B has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 303-406 of SEQ ID NO: 108. In yet other aspects of this embodiment, a binding element comprising an activin B has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 303-406 of SEQ ID NO: 108. In other aspects of this embodiment, a binding element comprising an activin B has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 303-406 of SEQ ID NO: 108. In still other aspects of this embodiment, a binding element comprising an activin B has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 303-406 of SEQ ID NO: 108. In other aspects of this embodiment, a binding element comprising an activin B has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 303-406 of SEQ ID NO: 108.
[0328]In other aspects of this embodiment, a binding element comprising an activin B has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 303-406 of SEQ ID NO: 108. In other aspects of this embodiment, a binding element comprising an activin B has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 303-406 of SEQ ID NO: 108. In yet other aspects of this embodiment, a binding element comprising an activin B has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 303-406 of SEQ ID NO: 108. In other aspects of this embodiment, a binding element comprising an activin B has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 303-406 of SEQ ID NO: 108. In still other aspects of this embodiment, a binding element comprising an activin B has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 303-406 of SEQ ID NO: 108. In other aspects of this embodiment, a binding element comprising an activin B has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 303-406 of SEQ ID NO: 108.
[0329]In another embodiment, a binding element comprising an Activin C. In another embodiment, a binding element comprising an Activin C comprises SEQ ID NO: 109. In an aspect of this embodiment, a binding element comprising an Activin C comprises amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109.
[0330]In other aspects of this embodiment, a binding element comprising an activin C has, e.g., at least 70% amino acid identity with amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109, at least 75% amino acid identity with amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109, at least 80% amino acid identity with amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109, at least 85% amino acid identity with amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109, at least 90% amino acid identity with amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109 or at least 95% amino acid identity with amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109. In yet other aspects of this embodiment, a binding element comprising an activin C has, e.g., at most 70% amino acid identity with amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109, at most 75% amino acid identity with amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109, at most 80% amino acid identity with amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109, at most 85% amino acid identity with amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109, at most 90% amino acid identity with amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109 or at most 95% amino acid identity with amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109.
[0331]In other aspects of this embodiment, a binding element comprising an activin C has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109. In other aspects of this embodiment, a binding element comprising an activin C has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109. In yet other aspects of this embodiment, a binding element comprising an activin C has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109. In other aspects of this embodiment, a binding element comprising an activin C has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109. In still other aspects of this embodiment, a binding element comprising an activin C has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109. In other aspects of this embodiment, a binding element comprising an activin C has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109.
[0332]In other aspects of this embodiment, a binding element comprising an activin C has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109. In other aspects of this embodiment, a binding element comprising an activin C has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109. In yet other aspects of this embodiment, a binding element comprising an activin C has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109. In other aspects of this embodiment, a binding element comprising an activin C has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109. In still other aspects of this embodiment, a binding element comprising an activin C has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109. In other aspects of this embodiment, a binding element comprising an activin C has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109.
[0333]In another embodiment, a binding element comprising an Activin E. In another embodiment, a binding element comprising an Activin E comprises SEQ ID NO: 110. In an aspect of this embodiment, a binding element comprising an Activin E comprises amino acids 247-350 of SEQ ID NO: 110.
[0334]In other aspects of this embodiment, a binding element comprising an activin E has, e.g., at least 70% amino acid identity with amino acids 247-350 of SEQ ID NO: 110, at least 75% amino acid identity with amino acids 247-350 of SEQ ID NO: 110, at least 80% amino acid identity with amino acids 247-350 of SEQ ID NO: 110, at least 85% amino acid identity with amino acids 247-350 of SEQ ID NO: 110, at least 90% amino acid identity with amino acids 247-350 of SEQ ID NO: 110 or at least 95% amino acid identity with amino acids 247-350 of SEQ ID NO: 110. In yet other aspects of this embodiment, a binding element comprising an activin E has, e.g., at most 70% amino acid identity with amino acids 247-350 of SEQ ID NO: 110, at most 75% amino acid identity with amino acids 247-350 of SEQ ID NO: 110, at most 80% amino acid identity with amino acids 247-350 of SEQ ID NO: 110, at most 85% amino acid identity with amino acids 247-350 of SEQ ID NO: 110, at most 90% amino acid identity with amino acids 247-350 of SEQ ID NO: 110 or at most 95% amino acid identity with amino acids 247-350 of SEQ ID NO: 110.
[0335]In other aspects of this embodiment, a binding element comprising an activin E has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 247-350 of SEQ ID NO: 110. In other aspects of this embodiment, a binding element comprising an activin E has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 247-350 of SEQ ID NO: 110. In yet other aspects of this embodiment, a binding element comprising an activin E has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 247-350 of SEQ ID NO: 110. In other aspects of this embodiment, a binding element comprising an activin E has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 247-350 of SEQ ID NO: 110. In still other aspects of this embodiment, a binding element comprising an activin E has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 247-350 of SEQ ID NO: 110. In other aspects of this embodiment, a binding element comprising an activin E has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 247-350 of SEQ ID NO: 110.
[0336]In other aspects of this embodiment, a binding element comprising an activin E has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 247-350 of SEQ ID NO: 110. In other aspects of this embodiment, a binding element comprising an activin E has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 247-350 of SEQ ID NO: 110. In yet other aspects of this embodiment, a binding element comprising an activin E has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 247-350 of SEQ ID NO: 110. In other aspects of this embodiment, a binding element comprising an activin E has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 247-350 of SEQ ID NO: 110. In still other aspects of this embodiment, a binding element comprising an activin E has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 247-350 of SEQ ID NO: 110. In other aspects of this embodiment, a binding element comprising an activin E has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 247-350 of SEQ ID NO: 110.
[0337]In another embodiment, a binding element comprising an Inhibin A. In another embodiment, a binding element comprising an Inhibin A comprises SEQ ID NO: 111. In an aspect of this embodiment, a binding element comprising an Inhibin A comprises amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111.
[0338]In other aspects of this embodiment, a binding element comprising an inhibin A has, e.g., at least 70% amino acid identity with amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111, at least 75% amino acid identity with amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111, at least 80% amino acid identity with amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111, at least 85% amino acid identity with amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111, at least 90% amino acid identity with amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111 or at least 95% amino acid identity with amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111. In yet other aspects of this embodiment, a binding element comprising an inhibin A has, e.g., at most 70% amino acid identity with amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111, at most 75% amino acid identity with amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111, at most 80% amino acid identity with amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111, at most 85% amino acid identity with amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111, at most 90% amino acid identity with amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111 or at most 95% amino acid identity with amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111.
[0339]In other aspects of this embodiment, a binding element comprising an inhibin A has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111. In other aspects of this embodiment, a binding element comprising an inhibin A has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111. In yet other aspects of this embodiment, a binding element comprising an inhibin A has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111. In other aspects of this embodiment, a binding element comprising an inhibin A has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111. In still other aspects of this embodiment, a binding element comprising an inhibin A has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111. In other aspects of this embodiment, a binding element comprising an inhibin A has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111.
[0340]In other aspects of this embodiment, a binding element comprising an inhibin A has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111. In other aspects of this embodiment, a binding element comprising an inhibin A has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111. In yet other aspects of this embodiment, a binding element comprising an inhibin A has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111. In other aspects of this embodiment, a binding element comprising an inhibin A has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111. In still other aspects of this embodiment, a binding element comprising an inhibin A has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111. In other aspects of this embodiment, a binding element comprising an inhibin A has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111.
[0341]In another embodiment, a binding element comprising a VEGF. In another embodiment, a binding element comprising a VEGF comprises SEQ ID NO: 112. In aspects of this embodiment, a binding element comprising a VEGF has, e.g., at least 70% amino acid identity with the amino acid sequence of SEQ ID NO: 112, at least 75% amino acid identity with the amino acid sequence of SEQ ID NO: 112, at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 112, at least 85% amino acid identity with the amino acid sequence of SEQ ID NO: 112, at least 90% amino acid identity with the amino acid sequence of SEQ ID NO: 112 or at least 95% amino acid identity with the amino acid sequence of SEQ ID NO: 112. In yet other aspects of this embodiment, a binding element comprising a VEGF has, e.g., at most 70% amino acid identity with the amino acid sequence of SEQ ID NO: 112, at most 75% amino acid identity with the amino acid sequence of SEQ ID NO: 112, at most 80% amino acid identity with the amino acid sequence of SEQ ID NO: 112, at most 85% amino acid identity with the amino acid sequence of SEQ ID NO: 112, at most 90% amino acid identity with the amino acid sequence of SEQ ID NO: 112 or at most 95% amino acid identity with the amino acid sequence of SEQ ID NO: 112.
[0342]In other aspects of this embodiment, a binding element comprising a VEGF has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 112. In other aspects of this embodiment, a binding element comprising a VEGF has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 112. In yet other aspects of this embodiment, a binding element comprising a VEGF has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to the amino acid sequence of SEQ ID NO: 112. In other aspects of this embodiment, a binding element comprising a VEGF has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to the amino acid sequence of SEQ ID NO: 112. In still other aspects of this embodiment, a binding element comprising a VEGF has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to the amino acid sequence of SEQ ID NO: 112. In other aspects of this embodiment, a binding element comprising a VEGF has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to the amino acid sequence of SEQ ID NO: 112.
[0343]In other aspects of this embodiment, a binding element comprising a VEGF has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 112. In other aspects of this embodiment, a binding element comprising a VEGF has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 112. In yet other aspects of this embodiment, a binding element comprising a VEGF has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to the amino acid sequence of SEQ ID NO: 112. In other aspects of this embodiment, a binding element comprising a VEGF has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to the amino acid sequence of SEQ ID NO: 112. In still other aspects of this embodiment, a binding element comprising a VEGF has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to the amino acid sequence of SEQ ID NO: 112. In other aspects of this embodiment, a binding element comprising a VEGF has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to the amino acid sequence of SEQ ID NO: 112.
[0344]In another embodiment, a binding element comprising an IGF-1. In another embodiment, a binding element comprising an IGF-1 comprises SEQ ID NO: 113. In an aspect of this embodiment, a binding element comprising an IGF-1 comprises amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113.
[0345]In other aspects of this embodiment, a binding element comprising an IGF-1 has, e.g., at least 70% amino acid identity with amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113, at least 75% amino acid identity with amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113, at least 80% amino acid identity with amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113, at least 85% amino acid identity with amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113, at least 90% amino acid identity with amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113 or at least 95% amino acid identity with amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113. In yet other aspects of this embodiment, a binding element comprising an IGF-1 has, e.g., at most 70% amino acid identity with amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113, at most 75% amino acid identity with amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113, at most 80% amino acid identity with amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113, at most 85% amino acid identity with amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113, at most 90% amino acid identity with amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113 or at most 95% amino acid identity with amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113.
[0346]In other aspects of this embodiment, a binding element comprising an IGF-1 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113. In other aspects of this embodiment, a binding element comprising an IGF-1 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113. In yet other aspects of this embodiment, a binding element comprising an IGF-1 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113. In other aspects of this embodiment, a binding element comprising an IGF-1 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113. In still other aspects of this embodiment, a binding element comprising an IGF-1 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113. In other aspects of this embodiment, a binding element comprising an IGF-1 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113.
[0347]In other aspects of this embodiment, a binding element comprising an IGF-1 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113. In other aspects of this embodiment, a binding element comprising an IGF-1 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113. In yet other aspects of this embodiment, a binding element comprising an IGF-1 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113. In other aspects of this embodiment, a binding element comprising an IGF-1 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113. In still other aspects of this embodiment, a binding element comprising an IGF-1 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113. In other aspects of this embodiment, a binding element comprising an IGF-1 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113.
[0348]In another embodiment, a binding element comprising an IGF-2. In another embodiment, a binding element comprising an IGF-2 comprises SEQ ID NO: 114. In an aspect of this embodiment, a binding element comprising an IGF-2 comprises amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114.
[0349]In other aspects of this embodiment, a binding element comprising an IGF-2 has, e.g., at least 70% amino acid identity with amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114, at least 75% amino acid identity with amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114, at least 80% amino acid identity with amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114, at least 85% amino acid identity with amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114, at least 90% amino acid identity with amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114 or at least 95% amino acid identity with amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114. In yet other aspects of this embodiment, a binding element comprising an IGF-2 has, e.g., at most 70% amino acid identity with amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114, at most 75% amino acid identity with amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114, at most 80% amino acid identity with amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114, at most 85% amino acid identity with amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114, at most 90% amino acid identity with amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114 or at most 95% amino acid identity with amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114.
[0350]In other aspects of this embodiment, a binding element comprising an IGF-2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114. In other aspects of this embodiment, a binding element comprising an IGF-2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114. In yet other aspects of this embodiment, a binding element comprising an IGF-2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114. In other aspects of this embodiment, a binding element comprising an IGF-2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114. In still other aspects of this embodiment, a binding element comprising an IGF-2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114. In other aspects of this embodiment, a binding element comprising an IGF-2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114.
[0351]In other aspects of this embodiment, a binding element comprising an IGF-2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114. In other aspects of this embodiment, a binding element comprising an IGF-2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114. In yet other aspects of this embodiment, a binding element comprising an IGF-2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114. In other aspects of this embodiment, a binding element comprising an IGF-2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114. In still other aspects of this embodiment, a binding element comprising an IGF-2 has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114. In other aspects of this embodiment, a binding element comprising an IGF-2 has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114.
[0352]In another embodiment, a binding element comprising an EGF. In another embodiment, a binding element comprising an EGF comprises SEQ ID NO: 115. In aspects of this embodiment, a binding element comprising an EGF has, e.g., at least 70% amino acid identity with the amino acid sequence of SEQ ID NO: 115, at least 75% amino acid identity with the amino acid sequence of SEQ ID NO: 115, at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 115, at least 85% amino acid identity with the amino acid sequence of SEQ ID NO: 115, at least 90% amino acid identity with the amino acid sequence of SEQ ID NO: 115 or at least 95% amino acid identity with the amino acid sequence of SEQ ID NO: 115. In yet other aspects of this embodiment, a binding element comprising an EGF has, e.g., at most 70% amino acid identity with the amino acid sequence of SEQ ID NO: 115, at most 75% amino acid identity with the amino acid sequence of SEQ ID NO: 115, at most 80% amino acid identity with the amino acid sequence of SEQ ID NO: 115, at most 85% amino acid identity with the amino acid sequence of SEQ ID NO: 115, at most 90% amino acid identity with the amino acid sequence of SEQ ID NO: 115 or at most 95% amino acid identity with the amino acid sequence of SEQ ID NO: 115.
[0353]In other aspects of this embodiment, a binding element comprising an EGF has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 115. In other aspects of this embodiment, a binding element comprising an EGF has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 115. In yet other aspects of this embodiment, a binding element comprising an EGF has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to the amino acid sequence of SEQ ID NO: 115. In other aspects of this embodiment, a binding element comprising an EGF has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to the amino acid sequence of SEQ ID NO: 115. In still other aspects of this embodiment, a binding element comprising an EGF has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to the amino acid sequence of SEQ ID NO: 115. In other aspects of this embodiment, a binding element comprising an EGF has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to the amino acid sequence of SEQ ID NO: 115.
[0354]In other aspects of this embodiment, a binding element comprising an EGF has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 115. In other aspects of this embodiment, a binding element comprising an EGF has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 115. In yet other aspects of this embodiment, a binding element comprising an EGF has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to the amino acid sequence of SEQ ID NO: 115. In other aspects of this embodiment, a binding element comprising an EGF has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to the amino acid sequence of SEQ ID NO: 115. In still other aspects of this embodiment, a binding element comprising an EGF has, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to the amino acid sequence of SEQ ID NO: 115. In other aspects of this embodiment, a binding element comprising an EGF has, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to the amino acid sequence of SEQ ID NO: 115.
[0355]It is envisioned that a modified Clostridial toxin disclosed in the present specification can comprise a binding element in any and all locations with the proviso that modified Clostridial toxin is capable of performing the intoxication process. Non-limiting examples include, locating a binding element at the amino terminus of a modified Clostridial toxin; locating a binding element between a Clostridial toxin therapeutic element and a translocation element of a modified Clostridial toxin; and locating a binding element at the carboxyl terminus of a modified Clostridial toxin. Other non-limiting examples include, locating a binding element between a Clostridial toxin enzymatic domain and a Clostridial toxin translocation domain of a modified Clostridial toxin. The enzymatic domain of naturally-occurring Clostridial toxins contains the native start methionine. Thus, in domain organizations where the enzymatic domain is not in the amino-terminal location an amino acid sequence comprising the start methionine should be placed in front of the amino-terminal domain. Likewise, where a binding element is in the amino-terminal position, an amino acid sequence comprising a start methionine and a protease cleavage site may be operably-linked in situations in which a binding element requires a free amino terminus, see, e.g., Shengwen Li et al., Degradable Clostridial Toxins, U.S. patent application Ser. No. 11/572,512 (Jan. 23, 2007), which is hereby incorporated by reference in its entirety. In addition, it is known in the art that when adding a polypeptide that is operably-linked to the amino terminus of another polypeptide comprising the start methionine that the original methionine residue can be deleted.
[0356]Thus, in an embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a binding element, a translocation element, an exogenous protease cleavage site and a therapeutic element (FIG. 20A). In an aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a binding element, a Clostridial toxin translocation domain, an exogenous protease cleavage site and a Clostridial toxin enzymatic domain.
[0357]In another embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a binding element, a therapeutic element, an exogenous protease cleavage site, and a translocation element (FIG. 20B). In an aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a binding element, a Clostridial toxin enzymatic domain, an exogenous protease cleavage site, a Clostridial toxin translocation domain.
[0358]In yet another embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a therapeutic element, an exogenous protease cleavage site, a binding element, and a translocation element (FIG. 21A). In an aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a Clostridial toxin enzymatic domain, an exogenous protease cleavage site, a binding element, and a Clostridial toxin translocation domain.
[0359]In yet another embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a translocation element, an exogenous protease cleavage site, a binding element, and a therapeutic element (FIG. 21B). In an aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a Clostridial toxin translocation domain, a binding element, an exogenous protease cleavage site and a Clostridial toxin enzymatic domain.
[0360]In another embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a therapeutic element, a binding element, an exogenous protease cleavage site, and a translocation element (FIG. 21C). In an aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a Clostridial toxin enzymatic domain, a binding element, an exogenous protease cleavage site, a Clostridial toxin translocation domain.
[0361]In yet another embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a translocation element, a binding element, an exogenous protease cleavage site and a therapeutic element (FIG. 21D). In an aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a Clostridial toxin translocation domain, a binding element, an exogenous protease cleavage site and a Clostridial toxin enzymatic domain.
[0362]In still another embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a therapeutic element, an exogenous protease cleavage site, a translocation element, and a binding element (FIG. 22A). In an aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a Clostridial toxin enzymatic domain, an exogenous protease cleavage site, a Clostridial toxin translocation domain, and a binding element.
[0363]In still another embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a translocation element, an exogenous protease cleavage site, a therapeutic element and a binding element, (FIG. 22B). In an aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a Clostridial toxin translocation domain, a binding element, an exogenous protease cleavage site and a Clostridial toxin enzymatic domain.
[0364]In a particularly preferred embodiment, the single-chain neurotoxin or neurotoxin derivative of the invention, altered as indicated above, is further modified to remove other incidental endogenous proteolytic sites such as those cleaved by trypsin, Arg C protease, chymotrypsin, or host cell proteases. As indicated below, modification of the primary amino acid sequences in these regions to confer protease resistance can increase the yield of the neurotoxin and reduce the toxicity of the single-chain neurotoxin prior to cleavage and activation.
[0365]In another preferred embodiment, the recombinant modified single-chain neurotoxin is further modified by joining the chain to a binding tag comprising one member of a specific binding complex. By "specific binding complex" is meant two or more chemical or biochemical entities that will bind each other under defined environmental conditions and which will not significantly bind other chemical or biochemical entities present in the environment under the same conditions. Examples of members of a specific binding complex include, without limitation, an antibody and its antigen, a lectin and its target carbohydrate, a nucleic acid strand and its complementary nucleic acid strand, a cell surface receptor and its ligand, a metal and a compound able to form a coordination or chelation complex with that metal, and the like.
[0366]In this embodiment, the binding tag may be joined to the single-chain toxin through a linker, preferably a cleavable linker. Examples of possible linkers, while not an exhaustive list, include 1) aliphatic dicarboxylic acids of the formula HOOC--(CH2)n--COOH, where n=1-12 (may be linked at a free amino group); 2) HO--(CH2)n--COOH, where n>10 (suitable for attachment at the amino terminus of the polypeptide), 3) substituted polybenzene structures, and 4) a N-hydroxysuccinimide (NHS) ester linker. The use of an linker containing an ester permits cleavage of the ester linker following use in the purification of the single-chain neurotoxin under relatively mild acidic conditions.
[0367]Alternatively, and most preferably, the binding tag may comprise some or all of the amino acid sequence of an appropriately chosen polypeptide coexpressed with the single-chain toxin as a fusion protein; such polypeptides may comprise, without limitation, the maltose binding domain of maltose binding protein (MBP), a polyhistidine peptide like HIS6, the calmodilin binding domain of calmodulin binding protein, the glutathione binding domain of glutathione-S-transferase, FLAG, human Influenza virus hemagluttinin (HA), human p62c-Myc protein (c MYC), Vesicular Stomatitis Virus Glycoprotein (VSV-G), Substance P, glycoprotein-D precursor of Herpes simplex virus (HSV), V5, AU1 and AU5, streptavidin binding peptide (strep), and biotin or a biotinylation sequence. Non-limiting examples of specific protocols for selecting, making and using an appropriate binding peptide are described in, e.g., Epitope Tagging, pp. 17.90-17.93 (Sambrook and Russell, eds., Molecular Cloning A Laboratory Manual, Vol. 3, 3rd ed. 2001); Antibodies: A Laboratory Manual (Edward Harlow & David Lane, eds., Cold Spring Harbor Laboratory Press, 2nd ed. 1998); and Using Antibodies: A Laboratory Manual Portable Protocol No. I (Edward Harlow & David Lane, Cold Spring Harbor Laboratory Press, 1998). In addition, non-limiting examples of binding tags as well as well-characterized reagents, conditions and protocols are readily available from commercial vendors that include, without limitation, BD Biosciences-Clontech, Palo Alto, Calif.; BD Biosciences Pharmingen, San Diego, Calif.; Invitrogen, Inc, Carlsbad, Calif.; QIAGEN, Inc., Valencia, Calif.; and Stratagene, La Jolla, Calif. These protocols are routine procedures well within the scope of one skilled in the art and from the teaching herein.
[0368]Thus, in an embodiment, a modified Clostridial toxin disclosed in the present specification can further comprise a binding tag. In another embodiment, a modified Clostridial toxin disclosed in the present specification can further comprises a plurality of binding tags. In aspects of this embodiment, a modified Clostridial toxin can comprise, e.g., at least 1 binding tag, at least 2 binding tags, at least 3 binding tags, at least 4 binding tags or at least 5 binding tags. In other aspects of this embodiment, a modified Clostridial toxin can comprise, e.g., at most 1 binding tag, at most 2 binding tags, at most 3 binding tags, at most 4 binding tags or at most 5 binding tags. In another aspect of this embodiment, a modified Clostridial toxin can comprise one or more copies of the same binding tag, one or more copies of different binding tag, or any combination thereof.
[0369]The location of a binding tag can be in various positions, including, without limitation, at the amino terminus of a modified Clostridial toxin, within a modified Clostridial toxin, or at the carboxyl terminus of a modified Clostridial toxin. Thus, in an embodiment, a binding tag is located at the amino-terminus of a modified Clostridial toxin. In such a location, a start methionine should be placed in front of the binding tag. In addition, it is known in the art that when adding a polypeptide that is operably-linked to the amino terminus of another polypeptide comprising the start methionine that the original methionine residue can be deleted. This is due to the fact that the added polypeptide will contain a new start methionine and that the original start methionine may reduce optimal expression of the fusion protein. In aspects of this embodiment, a binding tag located at the amino-terminus of a modified Clostridial toxin disclosed in the present specification can be, e.g., a FLAG Express® binding tag, a human Influenza virus hemagluttinin (HA) binding tag, a human p62c-Myc protein (c MYC) binding tag, a Vesicular Stomatitis Virus Glycoprotein (VSV-G) binding tag, a Substance P binding tag, a glycoprotein-D precursor of Herpes simplex virus (HSV) binding tag, a V5 binding tag, a AU1 binding tag, a AU5 binding tag, a polyhistidine binding tag, a streptavidin binding peptide binding tag, a biotin binding tag, a biotinylation binding tag, a glutathione binding domain of glutathione-S-transferase, a calmodulin binding domain of the calmodulin binding protein or a maltose binding domain of the maltose binding protein.
[0370]In another embodiment, an epitope-binding region is located at the carboxyl-terminus of a modified Clostridial toxin. In aspects of this embodiment, an epitope-binding region located at the carboxyl-terminus of a modified Clostridial toxin disclosed in the present specification can be, e.g., a FLAG Express® binding tag, a human Influenza virus hemagluttinin (HA) binding tag, a human p62c-Myc protein (c MYC) binding tag, a Vesicular Stomatitis Virus Glycoprotein (VSV-G) binding tag, a Substance P binding tag, a glycoprotein-D precursor of Herpes simplex virus (HSV) binding tag, a V5 binding tag, a AU1 binding tag, a AU5 binding tag, a polyhistidine binding tag, a streptavidin binding peptide binding tag, a biotin binding tag, a biotinylation binding tag, a glutathione binding domain of glutathione-S-transferase, a calmodulin binding domain of the calmodulin binding protein or a maltose binding domain of the maltose binding protein.
[0371]Additionally, the binding tag may be constructed to have a protease cleavage site between itself and either the amino terminus or the carboxyl terminus of the single-chain toxin so as be removable following purification of the peptide. The proteolytic cleavage site may be designed to be cleaved by the same activator protease chosen to nick the single-chain toxin between the H and L chains.
[0372]It is therefore an object of the invention to provide a recombinant activatible single-chain neurotoxin molecule that has reduced toxicity compared to the native neurotoxin until activated by reaction with a non-clostridial protease. The single-chain neurotoxin is more easily purified, is less dangerous to handle in the purification process, and can be optionally modified to give the toxin more desirable properties.
[0373]It is also an object of the invention to provide an method of making a recombinant activatable single-chain neurotoxin by modifying the nucleotide sequence encoding the neurotoxin to replace the native amino acid proteolytic cleavage sequence separating the H and L chain with an amino acid sequence stable to indigenous clostridial or host cell proteases but susceptible to cleavage by chosen protease in vitro.
[0374]It is further an object of the present invention to provide more stable neurotoxin polypeptides through modification of the nucleotide sequence of the coding region of the H and L chains thereof, removing incidental proteolytic cleavage sites by causing the replacement of labile amino acids with other amino acid residues which confer upon the toxin resistance to undesired proteolytic degradation.
[0375]Additionally, it is an object of the invention to provide methods of purifying recombinant neurotoxins as a single-chain by joining the expressed single-chain neurotoxin to a binding moiety comprising partner of a specific binding complex which can be used in the affinity purification with the binding partner comprising the other half of the binding complex. Purification can be performed batch-wise or in a chromatography column. The binding moiety may then be removed following the affinity step, and separated from the neurotoxin.
[0376]It is also an object of the invention to provide single-chain recombinant modified neurotoxin molecules for use as therapeutic agents. The modified neurotoxin molecules may have an altered target specificity or an altered activity compared to the native neurotoxin from which it is derived, or both.
[0377]Another aspect of the present invention provides a method of activating an activatable polypeptide disclosed in the present specification, such method comprising the step of incubating the activatable polypeptide with an exogenous protease, wherein the exogenous protease can cleave the exogenous protease cleavage site present in the polypeptide and wherein cleavage of the activatable polypeptide by the exogenous protease converts the activatable polypeptide from its single-chain polypeptide form into its di-chain form, thereby activating the polypeptide.
[0378]Aspects of the present invention provide, in part, an exogenous protease. As used herein, the term "exogenous protease" means any protease capable of selectively cleaving the P1-P1' scissile bond comprising the exogenous protease cleavage site, with the proviso that the exogenous protease is not a human protease or a protease being expressed by the host cell expressing a construct encoding an activatable polypeptide disclosed in the present specification. As used herein, the term "selectively" means having a highly preferred activity or effect. Thus, with reference to an exogenous protease, there is a discriminatory proteolytic cleavage of the P1-P1' scissile bond comprising the exogenous protease cleavage site. It is envisioned that any and all proteases capable of selectively cleaving the P1-P1' scissile bond comprising the exogenous protease cleavage site can be useful in the disclosed methods. As a non-limiting example, a bovine enterokinse can selectively cleave a bovine enterokinse cleavage site, a tobacco etch virus protease can selectively cleave a tobacco etch virus protease cleavage site, a human rhinovirus 3C protease can selectively cleave a human rhinovirus 3C protease cleavage site, a subtilisin can selectively cleave a subtilisin cleavage site, a hydroxylamine can selectively cleave a hydroxylamine cleavage site, and a SUMO/ULP-1 protease can selectively cleave a SUMO/ULP-1 protease cleavage site.
[0379]A therapeutic agent useful in the invention generally is administered as a pharmaceutical acceptable composition comprising a modified neurotoxin as disclosed in the present specification. As used herein, the term "pharmaceutically acceptable" means any molecular entity or composition that does not produce an adverse, allergic or other untoward or unwanted reaction when administered to an individual. As used herein, the term "pharmaceutically acceptable composition" is synonymous with "pharmaceutical composition" and means a therapeutically effective concentration of an active ingredient, such as, e.g., any of the modified neurotoxins disclosed in the present specification. A pharmaceutical composition comprising a modified neurotoxin is useful for medical and veterinary applications. A pharmaceutical composition may be administered to a patient alone, or in combination with other supplementary active ingredients, agents, drugs or hormones. The pharmaceutical compositions may be manufactured using any of a variety of processes, including, without limitation, conventional mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping, and lyophilizing. The pharmaceutical composition can take any of a variety of forms including, without limitation, a sterile solution, suspension, emulsion, lyophilizate, tablet, pill, pellet, capsule, powder, syrup, elixir or any other dosage form suitable for administration.
[0380]It is also envisioned that a pharmaceutical composition comprising a modified neurotoxin can optionally include a pharmaceutically acceptable carriers that facilitate processing of an active ingredient into pharmaceutically acceptable compositions. As used herein, the term "pharmacologically acceptable carrier" is synonymous with "pharmacological carrier" and means any carrier that has substantially no long term or permanent detrimental effect when administered and encompasses terms such as "pharmacologically acceptable vehicle, stabilizer, diluent, additive, auxiliary or excipient." Such a carrier generally is mixed with an active compound, or permitted to dilute or enclose the active compound and can be a solid, semi-solid, or liquid agent. It is understood that the active ingredients can be soluble or can be delivered as a suspension in the desired carrier or diluent. Any of a variety of pharmaceutically acceptable carriers can be used including, without limitation, aqueous media such as, e.g., water, saline, glycine, hyaluronic acid and the like; solid carriers such as, e.g., mannitol, lactose, starch, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, magnesium carbonate, and the like; solvents; dispersion media; coatings; antibacterial and antifungal agents; isotonic and absorption delaying agents; or any other inactive ingredient. Selection of a pharmacologically acceptable carrier can depend on the mode of administration. Except insofar as any pharmacologically acceptable carrier is incompatible with the active ingredient, its use in pharmaceutically acceptable compositions is contemplated. Non-limiting examples of specific uses of such pharmaceutical carriers can be found in PHARMACEUTICAL DOSAGE FORMS AND DRUG DELIVERY SYSTEMS (Howard C. Ansel et al., eds., Lippincott Williams & Wilkins Publishers, 7 ed. 1999); REMINGTON: THE SCIENCE AND PRACTICE OF PHARMACY (Alfonso R. Gennaro ed., Lippincott, Williams & Wilkins, 20 ed. 2000); GOODMAN & GILMAN'S THE PHARMACOLOGICAL BASIS OF THERAPEUTICS (Joel G. Hardman et al., eds., McGraw-Hill Professional, 10th ed. 2001); and HANDBOOK OF PHARMACEUTICAL EXCIPIENTS (Raymond C. Rowe et al., APhA Publications, 4 edition 2003). These protocols are routine procedures and any modifications are well within the scope of one skilled in the art and from the teaching herein.
[0381]It is further envisioned that a pharmaceutical composition disclosed in the present specification can optionally include, without limitation, other pharmaceutically acceptable components (or pharmaceutical components), including, without limitation, buffers, preservatives, tonicity adjusters, salts, antioxidants, osmolality adjusting agents, physiological substances, pharmacological substances, bulking agents, emulsifying agents, wetting agents, sweetening or flavoring agents, and the like. Various buffers and means for adjusting pH can be used to prepare a pharmaceutical composition disclosed in the present specification, provided that the resulting preparation is pharmaceutically acceptable. Such buffers include, without limitation, acetate buffers, citrate buffers, phosphate buffers, neutral buffered saline, phosphate buffered saline and borate buffers. It is understood that acids or bases can be used to adjust the pH of a composition as needed. Pharmaceutically acceptable antioxidants include, without limitation, sodium metabisulfite, sodium thiosulfate, acetylcysteine, butylated hydroxyanisole and butylated hydroxytoluene. Useful preservatives include, without limitation, benzalkonium chloride, chlorobutanol, thimerosal, phenylmercuric acetate, phenylmercuric nitrate, a stabilized oxy chloro composition, such as, e.g., PURITE® and chelants, such as, e.g., DTPA or DTPA-bisamide, calcium DTPA, and CaNaDTPA-bisamide. Tonicity adjustors useful in a pharmaceutical composition include, without limitation, salts such as, e.g., sodium chloride, potassium chloride, mannitol or glycerin and other pharmaceutically acceptable tonicity adjustor. The pharmaceutical composition may be provided as a salt and can be formed with many acids, including but not limited to, hydrochloric, sulfuric, acetic, lactic, tartaric, malic, succinic, etc. Salts tend to be more soluble in aqueous or other protonic solvents than are the corresponding free base forms. It is understood that these and other substances known in the art of pharmacology can be included in a pharmaceutical composition useful in the invention.
[0382]In an embodiment, a therapeutic agent is a pharmaceutical composition comprising a modified neurotoxin. In an aspect of this embodiment, a pharmaceutical composition comprises an unactivated, single-chain for of the modified toxin. In another aspect of this embodiment, a pharmaceutical composition comprises an activated di-chain form of the modified toxin. In other aspects of this embodiment, a pharmaceutical composition comprising a modified neurotoxin further comprises a pharmacological carrier, a pharmaceutical component, or both a pharmacological carrier and a pharmaceutical component. In other aspects of this embodiment, a pharmaceutical composition comprising a modified neurotoxin further comprises at least one pharmacological carrier, at least one pharmaceutical component, or at least one pharmacological carrier and at least one pharmaceutical component.
[0383]It is also an object of the invention to provide a single-chain activatable recombinant neurotoxin that may be more easily purified than the wild type neurotoxin. Such a neurotoxin permits the large scale preparation of properly folded highly pure toxin for clinical use.
EXAMPLES
[0384]The following Examples serve to illustrate particular embodiments of the invention, and do not limit the scope of the invention defined in the claims in any way.
Example 1
Construction of an Expression Vector Containing a Single-Chain TeNT Coding Region
[0385]The present invention can be exemplified describing the construction of a plasmid that will express TeNT in E. coli as a single protein that is readily purified, i.e., by affinity chromatography. TeNT can be chosen as a pilot system because (i) the availability of an excellent vaccine greatly reduces the risk of its handling and (ii) it is the most comprehensively studied of the toxins in terms of expressing HC and LC domains. However, those of skill in the art will understand that the same or similar strategies may be employed using any di-chain or binary toxin or other bioactive molecule expressed as a single polypeptide and activated by proteolytic cleavage. Single chain molecules were constructed containing the wild type TeNT L chain and a mutated version of the TeNT light chain wherein a glutamic acid residue at position 234 is changed to an alanine (termed "E234A", Ala234, or "the E234A mutant light chain"), respectively. This latter mutation results in an inactive TeNT light chain, and a plasmid encoding the E234A mutant light chain (pMAL-E234A) was constructed as described in Li et al., Biochemistry 33:7014-7020 (1994)(hereby incorporated by reference herein). The following protocol is used for the construction of each single-chain toxin.
[0386]The vector pTrcHisA, purchased from Invitrogen, is modified using a Stratagene QuickChange® site-directed mutagenesis kit (for site-directed mutagenesis techniques, see e.g., Smith et al., J. Biol. Chem. 253:6651-6560 (1979); incorporated by reference herein in its entirety) to create two extra restriction sites (SalI and HindIII) upstream of the nucleotides encoding a pre-existing enterokinase (EK) cleavage site. The plasmid also contains a translational start codon (ATG) followed by a run of codons encoding 6 histidine residues immediately upstream of the enterokinase cleavage site. A multiple cloning site containing Bam HI, XhoI, Bgl II, Pst I, Kpn I, Eco RI BstB I and Hind III cleavage sites is located immediately downstream of the EK site; the Hind III site is removed by site-directed mutagenesis. The following primers are employed to insert the restriction sites (underlined) upstream of the EK cleavage site:
TABLE-US-00003 (SEQ ID NO: 67) GACTGGTGGACAGCAAGTCGACCGGAAGCTTTACGACGATGACG, Sal I Hind III and (SEQ ID NO: 68) CGTCATCGTCGTAAAGCTTCCGGTCGACTTGCTGTCCACCAGTC Hind III Sal I
[0387]The resulting plasmid contains both Sal I and Hind III sites located at the 5' side of the nucleotide sequence encoding the bovine enterokinase (EK) cleavage site.
[0388]The nucleotide sequence encoding the wild-type TeNT L chain is obtained from plasmid pMAL-LC, described in Li et al., Biochemistry 33, 7014-7020 (1994), incorporated by reference herein. The plasmid encodes the TeNT light chain as a fusion protein with maltose binding protein (MBP) located immediately upstream of the coding sequence for the L chain. The MBP and L chain portions of the fusion protein are designed to contain the cleavage site for human blood coagulation factor Xa (Ile-Glu-Gly-Arg) to facilitate removal of the MBP once affinity purification has been performed.
[0389]The DNA fragment containing the coding sequence of the L chain is excised from plasmid pMAL-LC by digesting the plasmid with Sal I and Hind III, gel purifying the resulting DNA fragment containing the L chain, and ligating this fragment into plasmid pTrcHisA at the newly created Sal I and Hind III sites upstream of the EK site. This fragment results in the excission of the maltose binding protein sequences from the N terminus of the L chain.
[0390]An identical procedure is used to subclone the DNA fragment containing a mutant L chain from plasmid pMAL-LC-Ala234, in which a single amino acid change is made at amino acid 234 of the L chain, substituting the native glutamic acid with alanine. This change is sufficient to abrogate the zinc endopeptidase activity of the L chain, and to render non-toxic a reconstituted tetanus toxin containing native H chain and the Ala234 L chain.
[0391]The DNA fragment containing the H chain is obtained from plasmid PMAL-HC; construction of this vector is described in Li et al., J. Biochem. 125:1200-1208 (1999), hereby incorporated by reference herein. Briefly, the gene encoding the H chain is constructed by assembling three DNA fragments containing different portions of the H chain coding sequence which had been cloned into separate plasmids. The fragments comprising the amino terminal half of the H are first amplified using standard polymerase chain reaction methods (see, e.g., Mullis, U.S. Pat. No. 4,683,202 and Mullis et al., U.S. Pat. No. 4,800,159, both incorporated by reference herein in their entirety) and the following primers: PCR primers a (containing a Xba I cleavage site) and b (containing a Bgl II cleavage site) (SEQ ID NO: 113 and 114, respectively) are used to amplify the H chain fragment contained in a plasmid termed pTet8; PCR primers c (containing a Bgl II cleavage site) and d (containing both a Hind III and a Sal I cleavage site) (SEQ ID NO: 115 and 116, respectively) are used to amplify the H chain fragment contained in a plasmid termed pTet14. The nucleotide sequences of these primer are provided below, with restriction sites underlined.
TABLE-US-00004 (SEQ ID NO: 69) AATAGATCTAGATCATTAACAGATTTAGGA (a) (SEQ ID NO: 70) TTCTAAAGATCTATACATTTGATAACT (b) (SEQ ID NO: 71) ATGTATAGATCTTTAGAATATCAAGTA (c) (SEQ ID NO: 72) ATCGATAAGCTTTTATCAGTCGACCCAACAATCCAGATTTTTAGA (d)
[0392]Following PCR amplification and gel purification of the amplified H chain fragments, each fragment is digested with Bgl II and ligated to yield the complete N terminal half of the H chain coding region. This ligation product is then digested with Xba I and Hind III and subcloned into the multiple cloning site of pMAL-c2-T (the plasmid being also cut with Xba I and Hind III), which is located downstream of the coding region for MBP and the factor Xa site. pMAL-c2 is a commecially available vector well known to those of skill in the art. The resulting plasmid is PMAL-HN.
[0393]The entire H chain coding region is assembled as follows. The PMAL-HN plasmid is digested with Sac I and Sal I to yield the DNA fragment encoding the N-terminus of the H chain. Plasmid pTet215 is digested with Sal I and Bam HI to yield the DNA fragment encoding the H chain carboxyl terminus. The vector pMAL-c2-T is digested with Sac I and Bam HI, and ligated to the digested H chain fragments, which will assemble in the proper orientation due to the use of distinct endonucleases. The resulting plasmid is pMAL-HC.
[0394]The DNA fragments encoding the H and L chains (including Ala234 L chain) are cut and purified directly from pMAL-LC or pMALE234A and pMAL-HC constructs and subcloned into the modified pTrcHisA vector described above. The H chain was first ligated into the modified vector at the Bam HI site immediately downstream of the EK site, and the resulting plasmid was gel purified. Following digestion of this plasmid with Hind III and Sal I, the L chain was ligated at a position just upstream of the EK cleavage site.
[0395]The resulting plasmid construct contains the nucleotide sequence encoding the single-chain toxin protein, comprising (from amino to carboxyl terminus): six histidine residues (the His tag), followed by the L chain, an enterokinase cleavage site, and the H chain. The translated junction between the L and H chains containing the EK cleavage site (SEQ ID NO: 21) is shown below (in the direction from N-terminus to C-terminus) and in FIG. 1.
TABLE-US-00005 SEQ ID NO: 73 EK site SKLIGLCKKIIPPTNIRENLYNRTA-GEKLYDDDDKDRWGSSR-SLTDLGGELCIKNEDLTFIAEKN L chain interchain loop H chain
[0396]To allow expression of the two chains as a single unit, a nucleotide sequence comprising a stop codon present at the 3' end of the L chain coding sequence in the pMAL-LC is removed by site-directed mutagenesis using two primers (SEQ ID NO: 74 and 75), resulting in a single reading frame containing both H and L chains.
TABLE-US-00006 (SEQ ID NO: 74) AATAGAACTGCAGGAGAAAAGCTTTACGACGATGAC, and TGATAA (deleted stop codon; coding strand) (SEQ ID NO: 75) GTCATCGTCGTAAAGCTTTTCTCCTGCAGTTCTATT TTATCA (deleted stop codon; non-coding strand)
[0397]The resulting pTrcHisA-based construct is transformed into E. coli strain JM109 by heat shock using the method of Hanahan, and transformant colonies are isolated on Luria agar plates containing 100 μg/ml ampicillin. Plasmids are purified from these transformants and the insertions are confirmed by analytical restriction endonuclease digestion and agarose gel electrophoresis.
Example 2
Expression and Physical Characterization of Single-Chain TeNT
[0398]Expression of the pTrcHisA-based single-chain TeNT construct (under control of a hybrid trp/lac promoter) is induced by addition of 1 mM IPTG (isopropyl thio-galactopyranoside) to a confluent culture of a representative transformant clone in 200 ml Luria broth containing 100 μg/ml ampicillin and incubating further at 37° C. for 16 hours before cell harvest by centrifugation.
[0399]The cell pellets are resuspended in 30 ml Buffer A (20 mM Na2PO4, 500 mM NaCl (pH 7.8)), then lysed by ultrasonication at 4° C., using 10-second bursts at a medium setting. Insoluble debris is removed by centrifugation at 9,000×g for 30 min at 4° C., and the supernatant recovered by centrifugation.
[0400]The supernatant containing each single-chain construct is incubated for 20 minutes at 22° C. with 2 ml of nickel-ion resin (Invitrogen Corp.) for affinity purification by means of chelation between the histidine residues at the amino terminus of the single-chain toxin molecule and the nickel. The resins were then load onto mini columns and washed with 200 ml of washing buffer (20 mM Na2PO4, 500 mM NaCl (pH 6.0)) to remove any non-specifically bound material, the recombinant single-chain proteins are eluted on 0.5 ml fractions with 8-15 ml of 100 mM imidazole in Buffer A. The concentration of the eluted single-chains was measured by Bradford's protein assay (Bio-Rad Laboratories); approximately 1 milligram of the fusion protein was recovered.
Example 3
SDS-PAGE and Western Blot Analysis of Recombinant Single-Chain TeNT
[0401]The single-chain TeNT constructs are grown in Luria broth containing ampicillin at 37° C., and aliquots taken both before and after induction of protein expression with IPTG. Crude cell extracts are prepared for SDS-PAGE by dilution in sample buffer under reducing conditions in the presence of β-mercaptoethanol (BME). Following SDS-PAGE electrophoresis, the separated proteins are Western-blotted as follows: the proteins are electrophoretically transferred to a polyvinylidenedifluoride (PVDF) membrane using standard methods (see, e.g., Sambrook et al., Molecular Cloning, A Laboratory Manual (2d ed. Cold Spring Harbor Laboratory Press 1989), hereby incorporated by reference in its entirety), the membrane treated to reduce background Ig binding, and then probed using an anti-His6 antibody, followed by detection using an alkaline phosphatase-conjugated secondary antibody and development with a 5-bromo-4-chloro-3-indolyl-phosphate/nitro blue tetrazolium substrate.
[0402]As shown in lanes 1 and 2 of FIG. 2A, the Western blot revealed no detectable TeNT expression before induction of protein synthesis; by contrast, a single band of approximate molecular weight 150 kDa was revealed in the aliquots taken following protein induction (See lanes 3 and 4.) In FIG. 2A, lanes 1 and 3 are the WT light chain construct and lanes 2 and 4 contain the E234A mutant construct.
[0403]FIG. 2B is a Western blot of IPTG-induced cell extracts from cells transformed with the E234A construct. Significantly, no discernable lower molecular weight proteolytic cleavage products of the light chain were observed, providing evidence for the relative stability of the single-chain toxin following expression and purification.
[0404]FIG. 3 shows the results of a second experiment, in which affinity purified recombinant single-chain (SC) TeNT is nicked with enterokinase as follows. Thirty micrograms of purified single-chain toxin are incubated with 1 unit of enterokinase in a solution containing 50 mM Tris-HCl (pH 8.0), 1 mM CaCl2 and 0.1% Tween-20(v/v). As a control, the recombinant protein is incubated in the same reaction mixture containing no EK. These samples, plus an aliquot of native (non-recombinant) TeNT are subjected to SDS-PAGE in an 8% polyacrylamide gel under either reducing (+BME) or non-reducing (-BME) conditions. The resulting gel is used both for a Western blot and subsequent detection using anti-H claim antibodies (FIG. 3B), and direct staining with Coomassie Blue (FIG. 3A).
[0405]As indicated by FIG. 3, under non-reducing conditions all three samples (Native TeNT (Lane 1), unnicked recombinant toxin (Lane 2), and enterokinase nicked recombinant toxin (Lane 3)) will migrate as doublets (apparently different conformers that resolve into a single band upon reduction) with essentially indistinguishable apparent molecular weights of about 150 kDa. The non-reducing gel confirms that 1) high levels of expression are obtained, 2) the disulfide bonds linking the light and heavy chains are fully formed, and 3) the recombinant single-chain toxin is not subject to observable proteolytic degradation.
[0406]By contrast, under reducing conditions wild-type and nicked recombinant toxin yield an H chain having a molecular weight of about 100 kDa by both Western blot and Coomassie staining. Additionally, in the Coomassie stained gel, both of these samples also show a lower molecular weight species of about 50 kDa, corresponding to the L chain. The wild-type L chain will migrate with a lower apparent molecular weight than that of the recombinant L chain, which has 22 additional amino acid residues due to the presence of the His6 moiety and a modified EK cleavage site-containing interchain junction region. The unnicked recombinant toxin (Lane 2) migrates as a single band with an apparent molecular weight of about 150 kDa. Notably, no trace of the unnicked toxin is seen in lane 3, indicating the effectiveness of enterokinase treatment.
Example 4
In Vitro Toxin-induced Paralysis by Recombinant Single-Chain TeNT
[0407]The biological activity of the recombinant TeNT is also examined and compared to wild-type toxin using mouse phrenic nerve hemi-diaphragm, since the native toxin is known to cause neuromuscular paralysis, albeit at higher concentrations than act in the CNS. For this experiment, mouse left phrenic nerve-hemidiaphragm is dissected from mice (T/O strain, 4-week old and ˜20 g in weight) and immediately transferred into a closed circulatory superfusion system containing 10 ml of Krebs-Ringer solution (118 mM NaCl, 4.7 mM KCl, 1.2 mM MgSO4, 2.5 mM CaCl2, 23.8 mM NaHCO4, 1.2 mM KH2PO4, 11.7 mM glucose (pH 7.4)), bubbled with 95% O2 and 5% CO2 and supplemented with 0.1% (w/v) bovine serum albumin to diminish non-specific adsorption of the toxins (Li et al., Biochemistry 33:7014-7020 (1994)). The hemidiaphragms are kept in a bath containing 10 ml Krebs-Ringer buffer at 37° C. for 10 minutes before being exposed to 4 or 10 nM native TeNT ( and ∇, respectively) or 10 nM nicked recombinant TeNT ( ) or 10 nM un-nicked recombinant TeNT (◯), respectively. (See FIG. 4).
[0408]Muscle twitch is evoked by supra-maximal stimulation of the phrenic nerve with bipolar electrodes and recorded via a force-displacement transducer (Lectromed, UK) connected to an amplifier and computer system (MacLab, AD Instruments, UK). Parameters of nerve stimulation are 0.2 Hz square waves of 0.1 msec duration with 1.5-2.5 V amplitude. Toxin-induced paralysis of neuromuscular transmission is quantified as the time required for nerve-evoked muscle contraction to decrease to 10% (90% reduction) of the original value.
[0409]As shown in FIG. 4, 10 nM recombinant nicked TeNT was found to be as potent as 10 nM native toxin in blocking nerve-induced muscle twitch, with the preparations yielding a 90% reduction in muscle tension in approximately 170 minutes. Thus, this novel preparation of TeNT expressed in E. coli at high level as a single-chain, activatable polypeptide and purified by a simple affinity chromatography step proved to be fully active by all the criteria examined.
[0410]By contrast, 10 nM of the unnicked TeNT preparation require approximately twice as long to reduce muscle tension, and was approximately as active as 4 nM of the wild-type TeNT. As a control, hemidiaphragms incubated with KR buffer and the trace amount of enterokinase present in the experimental samples were found to show negligible decrease in muscle tension over 5 hrs.
[0411]Thus, this experiment indicates that the unnicked TeNT is considerably less toxic that either the wild type or recombinant nicked protein in vitro.
Example 5
Further Modification of Single-Chain TeNT to Remove Proteolytic Cleavage Sites Reduces Toxicity of Unnicked Recombinant Toxin
[0412]While the unnicked recombinant single-chain form of TeNT displays reduced toxicity as compared to the nicked form, the residual toxin activity probably arises from activation of the toxin by additional proteases in vivo. To test this possibility, sites in the single-chain toxin molecule susceptible to proteolytic cleavage by trypsin and Arg C protease are identified by incubation of single-chain TeNT with these enzymes as follows. Fifty micrograms μg of recombinant single-chain TeNT is incubated with 4 μg of Arg-C at 37° C. for 4 h; 0.1 μg of trypsin at 37° C. for 0.5 h; or buffer without protease as a control. These reactions are terminated by the addition of SDS-PAGE sample buffer containing 0.1% SDS followed by boiling for 5 minutes; then the samples are subjected to SDS-PAGE, followed by a Western electrophoretic transfer to a polyvinylidenedifluoride (PVDF) membrane. The membrane is blotted with IgG specific for the His6-tag and detected using a horseradish peroxidase staining system.
[0413]As shown in FIG. 5, the Western blot reveals that trypsin and Arg C protease yielded a L chain (and thus a H chain) fragment of the same size. Additionally, the transfer of a duplicate gel was stained for protein with Ponceau red and the H chain band of approximate molecular weight 100 kDa was excised from each lane and analysed by N-terminal sequencing.
[0414]In the recombinant single-chain TeNT, the LC and HC are linked by 17 amino acids (GEKLYDDDDKDRWGSSR), followed by the beginning of the H chain sequence (SLTDLGGEL . . . ). N-terminal amino acid sequencing of the larger fragment produced by both trypsin and Arg C protease reveal that first 5 amino acids of the 100 kDa trypsin and Arg C protease cleavage product protein are SLTDL; thus, these proteases appear to cleave the single-chain toxin between the R--S bond (see FIG. 1) so as to liberate the H chain and the L chain containing the EK linker at its C terminus, with this variant therefore yielding a di-chain toxin essentially identical to the EK nicked toxin.
[0415]The arginine at the carboxy terminus of the EK linker sequence is mutated by site-directed mutagenesis to a glycine (R496G), and the resulting single-chain toxin polypeptide is expressed and purified as above.
[0416]Titration of the 6 micrograms of the R496G mutated single-chain (WT LC) toxin and the SC TeNT lacking such a mutation against 0, 0.01, 0.1, 1, 10 μg/ml of trypsin, followed by SDS-PAGE and staining with Coomassie Brilliant Blue, yields the cleavage pattern seen in FIG. 6. As can be seen, both single-chain molecules are susceptible to typsin cleavage; however the R496G mutant yields fewer fragments than the SC toxin not containing a mutation in the loop region between the chains. For example, while three trypsin peptide bands can clearly be seen near the light chain band upon trypsin cleavage of the SC WT toxin, only two such bands are seen in the R496G digests.
[0417]The fact that there exist remaining trypsin sites in the R496G mutant SC toxin probably accounts for the fact that this mutant does not cause the lowering of toxicity as compared to the un-nicked SC toxin; both preparations give similar values in the mouse lethality and neuromuscular paralysis assays described above.
[0418]A different assay system is used to measure neurotoxin activity toward CNS neurons, the cells naturally affected by TeNT. The cells used are cerebellar neurons; these cells are disassociated from the cerebella of 7 day old rats. Neurons are suspended at 1-2×106/mL in medium consisting of 3 parts Basal Eagle Medium and 1 part of a buffer consisting of 40 mM HEPES-NaOH (pH 7.3), 78.4 mM KCl, 37.6 mM D-glucose, 2.8 mM CaCl2, 1.6 mM MgSO4 and 1.0 mM NaH2PO4, as well as 1×N2 supplement, 1.0 mM L-glutamine, 60 units/mL penicillin, 60 μg/mL streptomycin and 5% (v/v) dialysed horse serum. One milliliter of this cell suspension is added to 22 mm diameter poly-D-lysine coated wells. Cytosine β-D-arabinofuranoside (Ara-C, 40 μM) is added after 20-24 hours in 5% (v/v)CO2 culture, and neurons are maintained by weekly replacement of the above-noted medium containing 40 μM Ara-C.
[0419]For each assay, neurons are cultured for at least 10 days in vitro are washed four times with O2-gassed Krebs-Ringer HEPES buffer (KRH, mM: 20 HEPES.NaOH pH7.4, 128 NaCl, 5 KCl, 1 NaH2PO4, 1.4 CaCl2, 1.2 mM MgSO4, 10 D-glucose and 0.05 mg/mL BSA), and 0.5 mL of the latter buffer containing 0.25 μCi/mL [14C]-glutamine (i.e. the glutamate precursor) is added. All steps are performed at 37° C. After a 45 minute labeling period, the medium is removed and the neurons washed four times as before. Control and toxin-treated neurons are incubated for 5 minutes at 37° C. in KRH buffer containing either 1.4 mM Ca2+ or 0.5 mM EGTA (i.e. to assess Ca2+-independent release); aliquots are then removed and retained for assessment of [14C]-glutamate content by scintillation counting. Immediately after removal of the above basal medium, a modified KRH buffer containing 50 mM KCl (containing a lowered 83 mM NaCl content in order to maintain a normal osmotic potential) and either 1.4 Ca2+ or 0.5 mM EGTA are added for a 5 minute stimulation period. Finally, neurons were solubilized with 20 mM EGTA.NaOH pH 7.5 containing 1% (w/v) SDS, and aliquots subjected to scintillation counting in order to calculate their remaining radioactive contents. The amounts of 14C-glutamate in basal and stimulated samples are expressed as percentages relative to the calculated total cell content. The percentage [14C]-glutamate contents in EGTA-containing buffer are subtracted from the values recorded in Ca2+-containing samples in order to calculate the relevant Ca2+-dependent component of release and in turn the latter basal readings are subtracted from values obtained for 50 mM KCl samples to yield the K+-evoked Ca2+-dependent glutamate release component.
[0420]FIG. 8 demonstrates the ability of the recombinant toxin to inhibit neurotransmitter release. Cerebellar neurons, maintained for 10 days in vitro, were washed twice with ice-cold KRH buffer containing 5 mM Mg2+ and 0.5 mM Ca2+, then exposed in this buffer to the specified concentrations of ( ) native TeNT, (∘) EK-nicked TeNT R496G, () single-chain unnicked TeNT, or (∇) EK-nicked TeNT E234A for 60 min at 4° C. (see FIG. 8). Native TeNT (0.2 nM) was then added to the wells specified and, after an additional 30 min, the neurons were washed three times with ice-cold KRH buffer and incubated for 30 min at 37° C. Subsequent assessment of K+-evoked Ca2+-dependent neurotransmitter release was performed as detailed above. The results of this assay are shown in FIG. 8.
[0421]When cerebellar neurons are exposed to nicked recombinant TeNT, a dose-dependent inhibition of Ca++ dependent transmitter release is seen with a potency similar to the native toxin. Nicked recombinant SC TeNT, both WT and R496G, gave similar values in this assay. Thus, while toxin activity in the unnicked single-chain molecule is not abrogated through the removal of a single trypsin cleavage site, the removal of additional such sites is feasible in regions of the single-chain toxin to achieve an activatable single-chain proform of the toxin that exhibits even lower toxicity unless activated in vitro, when its full activity can be achieved.
Example 7
Protease-Deficient TeNT Mutant Antagonises the Actions of TeNT on Peripheral and Central Neurons
[0422]Table 3 shows the tabulated results of the indicated TeNT constructs tested in three assays of toxin activity: ability to cleave the HV62 peptide (which measures proteolytic activity only); neuromuscular paralysis (which is an indication of the toxin molecules' ability to enter the cell and thence to inhibit neurotransmitter release), and mouse lethality upon intraperitoneal injection of the various toxin constructs. The first two of these assays was performed as described above.
[0423]The mouse lethality assay was performed essentially as follows: Samples of recombinant purified single-chain TeNT, R496G mutant TeNT, and E234A mutant TeNT are each divided into two aliquots and one aliquot treated with enterokinase to nick the toxin. All samples are serially diluted into 50 mM phosphate buffer (pH 7.0), 150 mM NaCl and 0.25% (w/v) bovine serum albumin (BSA), and the toxin preparations are injected into mice intraperitoneally.
[0424]As shown in Table 3, the native and nicked TeNT preparations were comparably active in the mouse lethality assay, having an LD50 of about 1×108/mg. The unnicked recombinant toxin and unnicked R496G mutant were both about half as active. Finally, the nicked E234A proteolytically inactive toxin was less than 5×107 fold less active.
TABLE-US-00007 TABLE 3 Biological Activity of SC TeNT wild type and mutants (E234A and R496G) before and after nicking with enterokinase Initial rate of cleavagea of Time (min.) HV62 (nmol. for 10 nM min-1 mg-1) Mouse to cause 90% Purified TeNT [Relative lethalityb neuromuscular preparations rate (%)] (LD50/mg) paralysis Native 20.3 ± 0.91 1 × 108 145 Un-nicked SC WT 8.0 ± 0.03 0.5 × 108 260 Nickedc SC WT 22.7 ± 3.37 1 × 108 150 Un-nicked SC R496G 11.7 ± 0.6 0.5 × 108 250 ± 15 Nickedc SC R496G 52.3 ± 4.9 1 × 108 135 ± 10 Un-nicked SC E234A <0.01d Not tested Not tested Nickedc SC E234A <0.01d <50 No detectable activity aInitial rates of proteolysis were measured using the RP-HPLC-based method detailed in Foran et al. (1994). Incubations with 15 μM of a synthetic peptide corresponding to residues 33 to 94 of human VAMP-2 (HV62) were performed at 37° C. in 50 mM HEPES, NaOH pH 7.5 containing 2 mM DTT 0.2 mg ml-1 BSA and 50 μM ZnCl2, using the appropriate concentration of each reduced toxin preparation required to proteolyze 10-15% of the substrate during a 30 min period. Data are means (±S.D.; n = 4). bLD50 is the amount of toxin that killed 50% of the injected mice within 4 days. cToxin preparations were nicked with EK (1 unit/30 μg) at 22° C. for 1 h. dThis v° value represents the detection limits of the RP-HPLC assay; no proteolysis of HV62 was observed using prolonged incubations.
[0425]Purified SC E234A TeNT, in which the catalytic E at position 234 was replaced by an A, failed to show any detectable proteolysis of a peptide containing residues 33 to 94 of human VAMP-2 (termed HV62), either before or after nicking with EK. Accordingly, nicked TeNT E234A proved to be devoid of toxicity in mice and unable to inhibit transmitter release at the neuromuscular junction or from cerebellar neurons.
[0426]Importantly, however, this mutant toxin retained the ability to bind to the cell surface receptors on peripheral and central neurons. Pre-incubation of cerebellar neurons with nicked (10-60 nM) or unnicked (7-40 nM) TeNT E234A at 4° C. followed by the addition of 0.2 nM native toxin, antagonized the native toxin's inhibition of transmitter release at 37° C. to similar extents (FIG. 7).
[0427]As demonstrated in FIG. 9, exposure of mouse diaphragm to 100 nM TeNT E234A at 4° C. for 60 minutes prior to adding 1 nM native toxin prolonged the time taken to cause neuromuscular paralysis.
[0428]Mouse phrenic-nerve hemi-diaphragm was incubated in KR at 37° C. with 20 nM recombinant TeNT E234A (Δ) whilst stimulating the nerve (0.2 Hz, 1.5-2.5v) and recording muscle tension. For assessing competition, hemi-diaphragms were incubated for 60 minutes at 4° C. with MKR containing 0.1% BSA only (quadrature), or the latter plus 100 nM nicked TeNT E234A (∘), before the addition of 1 nM native TeNT. Following 30 minutes exposure to the latter, the tissues were washed three times with MKR and twice with KR. The temperature was raised to 37° C. and the nerve stimulated with recording of the evoked muscle twitch, as outlined above. This apparent competition for toxin binding by the mutant seen with both tissues demonstrates that the recombinant di-chain TeNT exhibits much higher affinity for the cell surface receptors than the heavy chain or Hc of TeNT alone. These results suggest that the conformation of the recombinant di-chain TeNT has high affinity to the cell surface receptor.
[0429]Moreover, and very significantly, these data demonstrate that recombinant molecules can be made according to the inventive methods of the present patent application having specific binding for the same cellular receptor as TeNT. However, such molecules may, like the E234A mutant, be inactive as toxin molecules but will retain the ability to be taken up by the target cell; thus serving as potential transporter molecules.
Example 8
Expression of Single-Chain BoNT/A
[0430]Using methods similar to those described above, DNA fragments containing the BoNT subtype A neurotoxin H and L chains were ligated together, separated by the EK cleavage site. This single-chain toxin coding sequence was inserted into a variety of expression vectors containing different N terminal sequences and promoters, as shown in Table 4, below.
TABLE-US-00008 TABLE 4 Tag Size Fusion (amino Size E. coli Vector Promoter Fusion Tag acids) (kDa) strain pTrcSCPHY trc Poly His 18 150 JM109 pCalSOPHY T7 Calmodulin 31 154 BL21 binding (DE3) protein pETSCPHY T7 Poly His 32 154 BL21 (DE3) pGEXSCPHY tac Glutathione-S- 224 177 JM109 tranferase pMALPHY tac Maltose 390 193 JM109 Binding Protein
[0431]The "fusion tags" each comprised a member of a specific binding complex as a purification aid and to improve the solubility and stability of the expressed protein. These plasmids were transformed into the E. coli strains indicated in Table 4 and expression of the single-chain toxin was monitored.
[0432]In another experiment, the single-chain BoNT/A construct was inserted into plasmid pMAL-c2 between the Bam HI and Hind III restriction sites, resulting in a coding sequence for a fusion polypeptide containing the maltose binding protein at the N terminus, followed by a Factor Xa cleavage site. Transformant JM 109 colonies were selected in Luria broth containing ampicillin. Expression was induced by the addition of IPTG to a final concentration of 0.3 mM. As for the TeNT construct, aliquots of the cell culture were collected before and after induction, the cells in each sample lysed by sonication, and the supernatant prepared for SDS-PAGE under both reducing and non-reducing conditions. Following electrophoresis to separate the proteins according to apparent molecular weight, the gel was subjected to a Western blot using an antibody raised against the H chain of BoNT/A. The Western blot resulted in the appearance of an immunologically reactive single-chain toxin band of apparent molecular weight approximately 200 kDa. Further modifications of the single-chain BoNT molecule to eliminate fortuitous protease cleavage sites (similar to those modifications made at the TeNT site labile to trypsin and Arg C protease, described above) will result in even greater stability of the single-chain BoNT/A molecule.
Example 9
Construction of a Plasmid Vector Expressing BoNT/E
[0433]A plasmid expressing a single-chain recombinant version of the neurotoxin from Clostridium botulinum subtype E(strain Beluga) (BoNT/E) was constructed as follows. PCR primers were designed based on the EMBL database cDNA sequence of the BoNT/E neurotoxin (Genbank accession number X62089) This nucleotide sequence is represented herein as SEQ ID NO: 76.
TABLE-US-00009 gaattcaagt agtagataat aaaaataatg ccacagattt ttattattaa taatgatata tttatctcta actgtttaac tttaacttat aacaatgtaa atatatattt gtctataaaa aatcaagatt acaattgggt tatatgtgat cttaatcatg atataccaaa aaagtcatat ctatggatat taaaaaatat ataaatttaa aattaggaga tgctgtatat gccaaaaatt aatagtttta attataatga tcctgttaat gatagaacaa ttttatatat taaaccaggc ggttgtcaag aattttataa atcatttaat attatgaaaa atatttggat aattccagag agaaatgtaa ttggtacaac cccccaagat tttcatccgc ctacttcatt aaaaaatgga gatagtagtt attatgaccc taattattta caaagtgatg aagaaaagga tagattttta aaaatagtca caaaaatatt taatagaata aataataatc tttcaggagg gattttatta gaagaactgt caaaagctaa tccatattta gggaatgata atactccaga taatcaattc catattggtg atgcatcagc agttgagatt aaattctcaa atggtagcca agacatacta ttacctaatg ttattataat gggagcagag cctgatttat ttgaaactaa cagttccaat atttctctaa gaaataatta tatgccaagc aatcaccgtt ttggatcaat agctatagta acattctcac ctgaatattc ttttagattt aatgataatt gtatgaatga atttattcaa gatcctgctc ttacattaat gcatgaatta atacattcat tacatggact atatggggct aaagggatta ctacaaagta tactataaca caaaaacaaa atcccctaat aacaaatata agaggtacaa atattgaaga attcttaact tttggaggta ctgatttaaa cattattact agtgctcagt ccaatgatat ctatactaat cttctagctg attataaaaa aatagcgtct aaacttagca aagtacaagt atctaatcca ctacttaatc cttataaaga tgtttttgaa gcaaagtatg gattagataa agatgctagc ggaatttatt cggtaaatat aaacaaattt aatgatattt ttaaaaaatt atacagcttt acggaatttg atttacgaac taaatttcaa gttaaatgta ggcaaactta tattggacag tataaatact tcaaactttc aaacttgtta aatgattcta tttataatat atcagaaggc tataatataa ataatttaaa ggtaaatttt agaggacaga atgcaaattt aaatcctaga attattacac caattacagg tagaggacta gtaaaaaaaa tcattagatt ttgtaaaaat attgtttctg taaaaggcat aaggaaatca atatgtatcg aaataaataa tggtgagtta ttttttgtgg cttccgagaa tagttataat gatgataata taaatactcc taaagaaatt gacgatacag taacttcaaa taataattat gaaaatgatt tagatcaggt tattttaaat tttaatagtg aatcagcacc tggactttca gatgaaaaat taaatttaac tatccaaaat gatgcttata taccaaaata tgattctaat ggaacaagtg atatagaaca acatgatgtt aatgaactta atgtattttt ctatttagat gcacagaaag tgcccgaagg tgaaaataat gtcaatctca cctcttcaat tgatacagca ttattagaac aacctaaaat atatacattt ttttcatcag aatttattaa taatgtcaat aaacctgtgc aagcagcatt atttgtaagc tggatacaac aagtgttagt agattttact actgaagcta accaaaaaag tactgttgat aaaattgcag atatttctat agttgttcca tatataggtc ttgctttaaa tataggaaat gaagcacaaa aaggaaattt taaagatgca cttgaattat taggagcagg tattttatta gaatttgaac ccgagctttt aattcctaca attttagtat tcacgataaa atctttttta ggttcatctg ataataaaaa taaagttatt aaagcaataa ataatgcatt gaaagaaaga gatgaaaaat ggaaagaagt atatagtttt atagtatcga attggatgac taaaattaat acacaattta ataaaagaaa agaacaaatg tatcaagctt tacaaaatca agtaaatgca attaaaacaa taatagaatc taagtataat agttatactt tagaggaaaa aaatgagctt acaaataaat atgatattaa gcaaatagaa aatgaactta atcaaaaggt ttctatagca atgaataata tagacaggtt cttaactgaa agttctatat cctatttaat gaaaataata aatgaagtaa aaattaataa attaagagaa tatgatgaga atgtcaaaac gtatttattg aattatatta tacaacatgg atcaatcttg ggagagagtc agcaagaact aaattctatg gtaactgata ccctaaataa tagtattcct tttaagcttt cttcttatac agatgataaa attttaattt catattttaa taaattcttt aagagaatta aaagtagttc agttttaaat atgagatata aaaatgataa atacgtagat acttcaggat atgattcaaa tataaatatt aatggagatg tatataaata tccaactaat aaaaatcaat ttggaatata taatgataaa cttagtgaag ttaatatatc tcaaaatgat tacattatat atgataataa atataaaaat tttagtatta gtttttgggt aagaattcct aactatgata ataagatagt aaatgttaat aatgaataca ctataataaa ttgtatgaga gataataatt caggatggaa agtatctctt aatcataatg aaataatttg gacattcgaa gataatcgag gaattaatca aaaattagca tttaactatg gtaacgcaaa tggtatttct gattatataa ataagtggat ttttgtaact ataactaatg atagattagg agattctaaa ctttatatta atggaaattt aatagatcaa aaatcaattt taaatttagg taatattcat gttagtgaca atatattatt taaaatagtt aattgtagtt atacaagata tattggtatt agatatttta atatttttga taaagaatta gatgaaacag aaattcaaac tttatatagc aatgaaccta atacaaatat tttgaaggat ttttggggaa attatttgct ttatgacaaa gaatactatt tattaaatgt gttaaaacca aataacttta ttgataggag aaaagattct actttaagca ttaataatat aagaagcact attcttttag ctaatagatt atatagtgga ataaaagtta aaatacaaag agttaataat agtagtacta acgataatct tgttagaaag aatgatcagg tatatattaa ttttgtagcc agcaaaactc acttatttcc attatatgct gatacagcta ccacaaataa agagaaaaca ataaaaatat catcatctgg caatagattt aatcaagtag tagttatgaa ttcagtagga aattgtacaa tgaattttaa aaataataat ggaaataata ttgggttgtt aggtttcaag gcagatactg tcgttgctag tacttggtat tatacacata tgagagatca tacaaacagc aatggatgtt tttggaactt tatttctgaa gaacatggat ggcaagaaaa ataaaaatta gattaaacgg ctaaagtcat aaattc
[0434]The forward primer had the following nucleotide base sequence:
TABLE-US-00010 (SEQ ID NO: 77) CCCGGATCC CCA AAA ATT AAT AGT TTT AAT TAT AAT G
[0435]where the BamHI endonuclease site is underlined and the sequence of the light chain minus the start codon is in bold. The inverse primer had the sequence:
TABLE-US-00011 (SEQ ID NO: 78) CCCCTGCAG tca TTT TTC TTG CCA TCC ATG TTC TTC
[0436]where the PstI endonuclease site is underlined, the end of the coding region of the heavy chain is in bold, and the stop codon is in lower case. These primers were made using standard DNA synthesis methodology.
[0437]The two primers were used in a PCR reaction containing different amounts of Clostridium botulinum type E (strain beluga) chromosomal DNA. The PCR reaction employed a DNA polymerase with proofreading activity (Pfx DNA polymerase, obtained from Life Technology) in order to avoid sequence errors in the amplified gene. The amplification reaction conditions were as follows: 30 cycles of: a 45 second denaturation at 95° C., followed by a 45 second annealing step at 56° C., followed by a primer extension reaction for 3 minutes 48 seconds at 68° C.
[0438]The PCR product was digested with BamHI and HindIII, and the digest subjected to agarose gel electrophoresis. Staining of the agarose gel with ethidium bromide revealed a major DNA fragment of approximately 3.5 kilobases (see FIG. 10). The band containing this frangment was excised from the gel, and the DNA purified from the agarose and ligated to BamHI and HindIII-cut pQE30 vector (Qiagen). The resulting ligated plasmid was used to transform E. coli strain JM 109 as described above, and the transformants plated onto selective LB agar plates. Several clones were recovered and the presence of the correct BoNT/E DNA insert checked by restriction digest. The resultant construct contains the BoNT/E gene (minus the first methionine) fused to the His6 tag of the pQE30 vector, and contains 2 extra amino acid residues (glycine, serine), which are contributed by the engineered BamHI site.
Example 10
Construction of a Proteolytically-Inactive Mutant of BoNT/E by Site Directed Mutagenesis
[0439]By mutating the glutamic acid at position 212 (within the active site) of the BoNT/E polypeptide construct to glutamine, a proteolytically-inactive and non-toxic single-chain BoNT/E polypeptide was obtained.
[0440]The glutamine replacement was introduced on the forward primer using routine site directed mutagenesis methods. The mutagenic DNA primer had the sequence cagTTAATACATTCATTA CATGGACTATATG (SEQ ID NO: 79), where the codon encoding glutamine at position 212 is indicated in small letters. An inverse PCR reaction was performed using the above primer, along with the reverse primer ATGCATTAATGTAAGAGCAGGATCTT (SEQ ID NO: 80) and Pfx DNA polymerase (Life Technology) as above. The PCR template was the wild-type single-chain BoNT/E construct (termed pQEESCwt). The cycling parameters (30 cycles) were as follows: 1) a 45 second denaturation step at 95° C.; 2) a 45 second annealing step at 56° C.; and 3) a 7 minute 10 second extension step at 68° C.
[0441]At the end of the amplification reaction, the DNA template was digested by the restriction enzyme DpnI to permit selection of mutated clones only. After subjecting the PCR product to agarose gel electrophoresis, a band of approximately 7 kilobases was removed and the DNA purified and used for self-ligation in the presence of T4 DNA ligase (Promega) and polynucleotide kinase (Promega) to permit phosphorylation of the PCR product. The ligation mixture was used to transform E. coli strain DH10B, and the transformants plated onto selective agar plates. The presence of the correct plasmide construct was verified in several representative transformants by restriction digest and the mutation confirmed also by DNA sequencing. FIG. 11 shows the protocol for construction of the mutant BoNT/E plasmid, and an ethidium bromide-stained agarose gel of the PCR reaction mixture (lanes 2 and 3) versus molecular weight markers (lane 1).
Example 11
Purification of Single-Chain Recombinant BoNT/E
[0442]The presence of the histidine tag at the N-terminus of the expressed protein allowed a single-step purification of the recombinant neurotoxin by metal-affinity chromatography.
[0443]The E. coli strain M15 (Qiagen) was used for expression of the BoNT/E single-chain construct. This strain carries an endogenous plasmid (pREP4, kanamycin resistant) containing a region encoding the lac Iq repressor gene in order to prevent transcription of the neurotoxin gene prior to induction with IPTG. The pQE30 vector contain a T5 bacteriophage RNA polymerase promoter, which is also recognized by E. coli RNA polymerase.
[0444]A colony of M15 cells containing pQEESCwt was grown at 37° C. overnight in 5 ml of 2TY medium containing 0.1 mg/ml ampicillin; 0.025 mg/ml kanamycin and 0.2% glucose (w/v), and the resultant culture used to inoculate 500 ml of the same medium. When this second culture reached an optical density of 0.5-0.8 at 600 nm, IPTG was added to a final concentration of 0.3 mM and the culture incubated at 25° C. overnight to permit expression of the neurotoxin.
[0445]Subsequent centrifugation of the culture yielded ˜2.3 g of wet cell pellet which was resuspended in 10 ml of extraction buffer (20 mM Hepes pH 7.0, 300 mM NaCl, 5 mM benzamidine, 2 μM pepstatin and 2 μM E-64). Lysozyme was added to a final concentration of 0.25 mg/ml, and the cell suspension incubated on ice for 60 minutes. Approximately 0.5 ml of glass beads (0.1 mm diameter from Biospec) was added to the cell suspension, followed by vortexing for 2 minutes to break the cells. Cell-free extracts was obtained by centrifugation at 10,000×g for 30 minutes at 4° C. The supernatant was incubated with 0.5 ml of Talone cobalt metal affinity resin (Clontech) pre-washed with extraction buffer in a rocking platform for 45 minutes at 4° C. The resin was then loaded into a disposable chromatography column and washed twice with 10 bed volumes of wash buffer (20 mM Hepes pH 7.0, 300 mM NaCl, 2 mM imidazole) before eluting the bound neurotoxin in 6 bed volumes of elution buffer (20 mM Hepes pH 7.0, 300 mM NaCl, 150 mM imidazole).
[0446]The elute was dialyzed overnight at 4° C. against 10 mM Hepes (pH 7.0) containing 150 mM NaCl and concentrated by centrifugal filtration (MW cutoff 10 KDa) to a final concentration of 1 mg/ml protein.
[0447]As shown in FIG. 12, the purity of the affinity-purified toxin was demonstrated by SDS-PAGE under reducing conditions, followed by Coomassie staining and Western-blotting, detecting the N-terminus with a mouse monoclonal anti-His antibody from Quiagen (diluted 2000 fold). Enhanced Chemiluminescence solutions (Santa Cruz) and mouse secondary horseradish peroxidase (affinity purified from Sigma) were used for detection of bound antibody. Approximately 2 μg of protein samples were loaded per well.
Example 12
Trypsin activation of Purified Recombinant BoNT/E Single-Chain Polypeptide
[0448]Purified BoNT/E single-chain neurotoxin polypeptide samples were activated by nicking the single-chain with trypsin (1.5 μg/ml final concentration) for 60 minutes at a concentration of 1 mg toxin/ml in 10 mm Hepes (pH 7.0), 150 mM NaCl. Following the reaction, the trypsin was inactivated using 0.5 mM PMSF and 10 μg trypsin inhibitor/ml. The quality of the trypsinization was assessed and verified by SDS-PAGE under both reducing and non-reducing conditions, then staining with Coomassie staining and Western blotting the polyacrylamide gel using a mouse monoclonal anti-His antibody (Quiagen, diluted 2000-fold) and a mouse monoclonal anti-HC IgG (diluted 26-fold). As shown in FIG. 13, the Commassie-stained nicked protein resolves into two bands under reducing conditions, while the heavy and light chains remain disulfide-linked under non-reducing conditions, similar to the native toxin. The antibody-detected recombinant heavy chain is of approximately identical size as its wild-type Clostridium counterpart, whereas the recombinant light chain migrates at a slightly higher molecular weight compared to the native protein. This latter characteristic is due to the extra residues provided by the His6 tag at the N-terminus.
Example 13
Recombinant BoNT/E is Proteolytically Active
[0449]Stock solutions (1 μM) of native nicked BoNT/E toxin, un-nicked single-chain recombinant toxin, nicked di-chain recombinant toxin, and nicked mutant (E212Q) BoNT/E were prepared in HEPES-buffered saline (HBS, 150 mM NaCl, 10 mM HEPES, pH 7.4, 10 μg/ml BSA). These samples were incubated for 30 minutes at 37° C. in the absence or presence of 20 mM DTT, and then serially diluted in 0.02 ml of HBS to the final concentrations shown in FIG. 14.
[0450]A recombinant peptide containing amino acids 140-205 of SNAP-25 fused to glutathione-S-transferase (termed GST-SNAP-25 [140-205]) was used as a protease substrate to test the proteolytic activity of the recombinant BoNT/E polypeptides. Ten micrograms this protease substrate was incubated with the toxin samples. The digestion reaction was allowed to proceed for 30 minutes at 37° C. in the absence or presence of 2 mM DTT, and stopped by addition of SDS-PAGE sample buffer followed by boiling for 5 minutes.
[0451]The resultant samples were analyzed by SDS-PAGE (3 μg of GST-SNAP-25 [140-205] per lane) and silver staining. As FIG. 14 demonstrates, even unnicked recombinant single-chain toxin retains proteolytic activity. As expected, the mutant E212Q BoNT/E construct has no detectable proteolytic activity. FIG. 14 shows only the GST-SNAP-25[140-205] bands.
Example 14
Nicking Makes Recombinant BoNT/E Fully Functional
[0452]Cerebellar neurons maintained for 10 days in culture (2×106/22 mm diameter well) were washed with Krebs-Ringer HEPES (KRH) buffer, then exposed to the specified concentrations of BoNT/E native ( ), trypsin-nicked recombinant (◯), or un-nicked single-chain () BoNT/E. (See FIG. 15). After 60 minutes at 37° C., the toxin-containing buffer was removed and the cells were washed twice, then incubated with KRH buffer containing 0.25 μCi/ml [14C]-labeled glutamine (i.e. the glutamate precursor). After 45 minutes, the latter medium was removed and the neurons were washed four times at 37° C. prior to assessment of transmitter glutamate release. Control and toxin-treated neurons were incubated for 5 minutes at 37° C. in KRH buffer containing either 1.4 mM Ca2+ or 0.5 mM EGTA to assess Ca2+-independent release; aliquots were then removed for determination of their [14C]-glutamate content (see below).
[0453]Immediately after removal of the basal medium, KRH buffer containing 50 mM KCl and either 1.4 mM Ca2+ or 0.5 mM EGTA was added; as before, aliquots were removed for [14C]-glutamate assay after a 5 minute stimulation period. Finally, neurons were solubilized with 20 mM EGTA.NaOH pH 7.5 containing 1% (w/v) SDS and aliquots were removed to determine the amounts of radioactivity remaining within the cells. The amount of [14C]-glutamate in each of the samples was assayed by scintillation counting and the levels released under basal and stimulated conditions were expressed as percentages relative to the calculated total cell content.
[0454]The percent [14C]-glutamate content in the EGTA-containing buffer for each sample was subtracted from the values recorded in Ca2+-containing KRH samples in order to obtain the Ca2+-dependent component of release, and the latter basal readings were subtracted from values obtained for 50 mM KCl samples to yield K+-evoked Ca2+-dependent release. The values, thus, obtained from toxin-treated neurons are expressed relative to toxin-free controls.
[0455]FIG. 15 shows that, despite retaining proteolytic activity, the un-nicked recombinant BoNT/E has markedly less activity than either the native BoNT/E or the nicked recombinant version. This finding may reflect the inability of the un-nicked toxin to adequately enter the target cell. Additionally, the nicked recombinant version appears to be more effective in inhibiting glutamate release than the native toxin.
Example 15
Recombinant BoNT/E has a Neuromuscular Paralytic Activity Equivalent to that of the Native Toxin at Mouse Neuromuscular Endplates: Nicking Increases Potency
[0456]Mouse phrenic-nerve hemi-diaphragms were bathed in KR supplemented with 0.1% BSA and saturated with 95% O2/5% CO2. The phrenic nerves were stimulated (0.2 Hz, 1.5-2.5 mV) and nerve evoked muscle tension was recorded before and after the addition of (FIG. 16A) 0.2 nM recombinant nicked BoNT/E (◯) or 0.2 nM native BoNT/E (quadrature), and (FIG. 16B) 1 nM recombinant un-nicked (◯), 1 nM recombinant nicked (◯) or 0.05 nM recombinant nicked (∇) BoNT/E. As shown in FIGS. 6A and 16B, the recombinant nicked BoNT/E is an effective paralytic agent, displaying greater activity in this assay that the native toxin. The un-nicked toxin displays significantly lower activity than the nicked toxin in this assay.
[0457]The neuromuscular paralytic activity of recombinant nicked BoNT/E was also demonstrated in mice by intra-muscular injection into hind-limb muscles. This resulted in paralysis, as assessed by the toe spread reflex assay, with a pattern of symptoms typical of botulism.
[0458]The in vivo neurotoxicity of the nicked, recombinant neurotoxin was established, by injecting the toxin into mice, to have a specific neurotoxicity of less than 107 mouse LD50 units per mg.
Example 16
The BoNT/E E212Q Protease Inactive Mutant Antagonises BoNT/E-induced Neuroparalysis
[0459]A mouse phrenic-nerve hemi-diaphragm was exposed to 10 nM BoNT/E E212Q in KR medium, the nerve was stimulated and evoked muscle tension was recorded. As indicated by FIG. 17, the BoNT E212Q mutant does not inhibit neurotransmission, as determined by its failure to reduce nerve-evoked muscle tension (◯). To assess the ability of this non-toxic mutant to antagonise the activity of the native toxin, mouse phrenic-nerve hemi-diaphragms were bathed for 60 minutes at 4° C. in MKR supplemented with 0.1% BSA and saturated with 95% O2/5% CO2, without (∇) or with (Δ) the inclusion of 5 nM BoNT/E E212Q. Native nicked BoNT/E was added to each bath (0.05 nM final) and the tissues were incubated for a further 30 min. The nerve-muscles were then washed three times each with MKR followed by KR, before the temperature was raised to 37° C., the nerve stimulated and evoked muscle tension recorded.
[0460]As shown in FIG. 17, the onset of native BoNT/E activity in this assay was delayed and antagonized when the phrenic-nerve hemi-diaphragms are preincubated with the E212Q protease inactive mutant, thereby indicating that the recombinant mutant faithfully binds to the same cell surface receptor as does the native toxin. Thus, the methods of the present patent application can be used to produce recombinant and modified toxins having fully functional receptor binding domains, and BoNT-related transported molecules for the intracellular delivery of therapeutic agents.
Example 17
Construction of an Activatable Clostridial Toxin Comprising an Amino-Terminally Presented Binding Element
[0461]This example illustrates how to make an activatable Clostridial toxin disclosed in the present specification comprising a binding element located at the amino terminus of the modified toxin.
17a. A binding element-translocation element-exogenous protease cleavage site-therapeutic element organization.
[0462]A polynucleotide molecule based on BoNT/A-TEV-GDNFAP4A (SEQ ID NO: 116) will be synthesized using standard procedures (BlueHeron® Biotechnology, Bothell, Wash.). This polynucleotide molecule encodes a BoNT/A modified to replace amino acids 872-1296 of SEQ ID NO: 1, a BoNT/A HC binding element, with amino acids 118-211 of SEQ ID NO: 81, a GDNF peptide, and to incorporate a TEV protease site of SEQ ID NO: 24 within the di-chain loop region, arranged in an amino to carboxyl linear organization as depicted in FIG. 20A. The In addition, the altered binding element further comprises at its amino terminus, a PAR 1 leader sequence ending in an enterokinse cleavage site, which, upon cleavage, results in exposing the first amino acid of the GDNF binding element. Oligonucleotides of 20 to 50 bases in length are synthesized using standard phosphoramidite synthesis. These oligonucleotides will be hybridized into double stranded duplexes that are ligated together to assemble the full-length polynucleotide molecule. This polynucleotide molecule will be cloned using standard molecular biology methods into a pUCBHB1 vector at the SmaI site to generate pUCBHB1/BoNT/A-TEV-GDNFAP4A. The synthesized polynucleotide molecule is verified by sequencing using Big Dye Terminator® Chemistry 3.1 (Applied Biosystems, Foster City, Calif.) and an ABI 3100 sequencer (Applied Biosystems, Foster City, Calif.).
[0463]If desired, an expression optimized polynucleotide molecule based on BoNT/A-TEV-GDNFAP4A can be synthesized in order to improve expression in an Escherichia coli strain. The polynucleotide molecule encoding the BoNT/A-TEV-GDNFAP4A will be modified to 1) contain synonymous codons typically present in native polynucleotide molecules of an Escherichia coli strain; 2) contain a G+C content that more closely matches the average G+C content of native polynucleotide molecules found in an Escherichia coli strain; 3) reduce polymononucleotide regions found within the polynucleotide molecule; and/or 4) eliminate internal regulatory or structural sites found within the polynucleotide molecule, see, e.g., Lance E. Steward et al., Optimizing Expression of Active Botulinum Toxin Type E, International Patent Publication WO 2006/011966 (Feb. 2, 2006); Lance E. Steward et al., Optimizing Expression of Active Botulinum Toxin Type A, International Patent Publication WO 2006/017749 (Feb. 16, 2006). Once sequence optimization is complete, oligonucleotides of 20 to 50 bases in length are synthesized using standard phosphoramidite synthesis. These oligonucleotides are hybridized into double stranded duplexes that are ligated together to assemble the full-length polynucleotide molecule. This polynucleotide molecule is cloned using standard molecular biology methods into a pUCBHB1 vector at the SmaI site to generate pUCBHB1/BoNT/A-TEV-GDNFAP4A. The synthesized polynucleotide molecule is verified by sequencing using Big Dye Terminator® Chemistry 3.1 (Applied Biosystems, Foster City, Calif.) and an ABI 3100 sequencer (Applied Biosystems, Foster City, Calif.). If so desired, expression optimization to a different organism, such as, e.g., a yeast strain, an insect cell-line or a mammalian cell line, can be done, see, e.g., Steward, supra, (Feb. 2, 2006); and Steward, supra, (Feb. 16, 2006).
[0464]A similar cloning strategy will be used to make pUCBHB1 cloning constructs for BoNT/B-TEV-GDNFAP4A, a modified BoNT/B where amino acids 861-1291 of SEQ ID NO: 2 are replaced with amino acids 118-211 of SEQ ID NO: 81; BoNT/C1-TEV-GDNFAP4A, a modified BoNT/C1 where amino acids 869-1291 of SEQ ID NO: 3 are replaced with amino acids 118-211 of SEQ ID NO: 81; BoNT/D-TEV-GDNFAP4A, a modified BoNT/D where amino acids 865-1276 of SEQ ID NO: 4 are replaced with amino acids 118-211 of SEQ ID NO: 81; BoNT/E-TEV-GDNFAP4A, a modified BoNT/E where amino acids 848-1252 of SEQ ID NO: 5 are replaced with amino acids 118-211 of SEQ ID NO: 81; BoNT/F-TEV-GDNFAP4A, a modified BoNT/F where amino acids 867-1274 of SEQ ID NO: 6 are replaced with amino acids 118-211 of SEQ ID NO: 81; BoNT/G-TEV-GDNFAP4A, a modified BoNT/G where amino acids 866-1297 of SEQ ID NO: 7 are replaced with amino acids 118-211 of SEQ ID NO: 81; TeNT-TEV-GDNFAP4A, a modified TeNT where amino acids 882-1315 of SEQ ID NO: 8 are replaced with amino acids 118-211 of SEQ ID NO: 81; BaNT-TEV-GDNFAP4A, a modified BaNT where amino acids 858-1268 of SEQ ID NO: 9 are replaced with amino acids 118-211 of SEQ ID NO: 81; and BuNT-TEV-GDNFAP4A, a modified BuNT where amino acids 848-1251 of SEQ ID NO: 10 are replaced with amino acids 118-211 of SEQ ID NO: 81.
[0465]Likewise, a similar cloning strategy will be used to make pUCBHB1 cloning constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-TEV-AP4A that will replace the HC binding element from a Clostridial toxin the with an binding element comprising, e.g., a Neurturin binding element comprising amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82; a Persephrin binding element comprising amino acids 66-155 of SEQ ID NO: 83; an Artemin binding element comprising amino acids 123-218 of SEQ ID NO: 84; a TGFβ1 binding element comprising amino acids 293-390 of SEQ ID NO: 85; a TGFβ2 binding element comprising amino acids 317-414 of SEQ ID NO: 86; a TGFβ3 binding element comprising amino acids 315-412 of SEQ ID NO: 87; a TGFβ4 binding element comprising amino acids 276-373 of SEQ ID NO: 88; a BMP2 binding element comprising amino acids 296-396 of SEQ ID NO: 89; a BMP3 binding element comprising amino acids 370-472 of SEQ ID NO: 90; a BMP4 binding element comprising amino acids 309-409 of SEQ ID NO: 91; a BMP5 binding element comprising amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92; a BMP6 binding element comprising amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93; a BMP7 binding element comprising amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94; a BMP8 binding element comprising amino acids 301-402 of SEQ ID NO: 95; a BMP10 binding element comprising amino acids 323-424 of SEQ ID NO: 96; a GDF1 binding element comprising amino acids 267-372 of SEQ ID NO: 97; a GDF2 binding element comprising amino acids 327-429 of SEQ ID NO: 98; a GDF3 binding element comprising amino acids 264-364 of SEQ ID NO: 99; a GDF5 binding element comprising amino acids 400-501 of SEQ ID NO: 100; a GDF6 binding element comprising amino acids 354-455 of SEQ ID NO: 101; a GDF7 binding element comprising amino acids 352-450 of SEQ ID NO: 102; a GDF8 binding element comprising amino acids 281-375 of SEQ ID NO: 103; a GDF10 binding element comprising amino acids 376-478 of SEQ ID NO: 104; a GDF11 binding element comprising amino acids 313-407 of SEQ ID NO: 105; a GDF15 binding element comprising amino acids 211-308 of SEQ ID NO: 106; an Activin A binding element comprising amino acids 321-426 of SEQ ID NO: 107; an Activin B binding element comprising amino acids 303-406 of SEQ ID NO: 108; an Activin C binding element comprising amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109; an Activin E binding element comprising amino acids 247-350 of SEQ ID NO: 110; an Inhibin A binding element comprising amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111; a VEGF binding element comprising SEQ ID NO: 112; an IGF-1 binding element comprising amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113; an IGF-2 binding element comprising amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114; an EGF binding element comprising SEQ ID NO: 115.
[0466]Likewise, a similar cloning strategy will be used to make pUCBHB1 cloning constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin AP4A comprising an exogenous protease cleavage site incorporated within the di-chain loop region, e.g, a bovine enterokinase protease cleavage site comprising SEQ ID NO: 21; a Tobacco Etch Virus protease cleavage site comprising SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32 or SEQ ID NO: 33; a Tobacco Vein Mottling Virus protease cleavage site comprising SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, or SEQ ID NO: 39; a human rhinovirus 3C protease cleavage site comprising SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45 or SEQ ID NO: 46; a subtilisin cleavage site comprising SEQ ID NO: 49, SEQ ID NO: 50, or SEQ ID NO: 51; a hydroxylamine cleavage site comprising SEQ ID NO: 52, SEQ ID NO: 53, or SEQ ID NO: 54; a SUMO/ULP-1 protease cleavage site comprising SEQ ID NO: 56; a non-human Caspase 3 protease cleavage site comprising SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62 or SEQ ID NO: 63.
[0467]To construct pET29/BoNT/A-TEV-GDNFAP4A, a pUCBHB1/BoNT/A-TEV-GDNFAP4A construct will be digested with restriction endonucleases that 1) will excise the polynucleotide molecule encoding the open reading frame of BoNT/A-TEV-GDNFAP4A; and 2) will enable this polynucleotide molecule to be operably-linked to a pET29 vector (EMD Biosciences-Novagen, Madison, Wis.). This insert will be subcloned using a T4 DNA ligase procedure into a pET29 vector that is digested with appropriate restriction endonucleases to yield pET29/BoNT/A-TEV-GDNFAP4A. The ligation mixture will be transformed into chemically competent E. coli DH5α cells (Invitrogen, Inc, Carlsbad, Calif.) using a heat shock method, will be plated on 1.5% Luria-Bertani agar plates (pH 7.0) containing 50 μg/mL of Kanamycin, and will be placed in a 37° C. incubator for overnight growth. Bacteria containing expression constructs will be identified as Kanamycin resistant colonies. Candidate constructs will be isolated using an alkaline lysis plasmid mini-preparation procedure and will be analyzed by restriction endonuclease digest mapping to determine the presence and orientation of the insert. This cloning strategy will yield a pET29 expression construct comprising the polynucleotide molecule encoding the BoNT/A-TEV-GDNFAP4A operably-linked to a carboxyl terminal polyhistidine affinity binding peptide.
[0468]A similar cloning strategy will be used to make pET29 expression constructs for other modified Clostridial toxin-TEV-GDNFAP4A toxins, such as, e.g., BoNT/B-TEV-GDNFAP4A, BoNT/C1-TEV-GDN FAP4A, BoNT/D-TEV-GD N FAP4A, BoNT/E-TEV-G D N FAP4A, BoNT/F-TEV-G DN FAP4A, BoNT/G-TEV-GDNFAP4A TeNT-TEV-GDNFAP4AB, BaNT-TEV-GDNFAP4A, or BuNT-TEV-GDNFAP4A. Likewise, a similar cloning strategy will be used to make pET29 expression constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-TEV-AP4B comprising a binding element such as, e.g, a Neurturin binding element comprising amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82; a Persephrin binding element comprising amino acids 66-155 of SEQ ID NO: 83; an Artemin binding element comprising amino acids 123-218 of SEQ ID NO: 84; a TGFβ1 binding element comprising amino acids 293-390 of SEQ ID NO: 85; a TGFβ2 binding element comprising amino acids 317-414 of SEQ ID NO: 86; a TGFβ3 binding element comprising amino acids 315-412 of SEQ ID NO: 87; a TGFβ4 binding element comprising amino acids 276-373 of SEQ ID NO: 88; a BMP2 binding element comprising amino acids 296-396 of SEQ ID NO: 89; a BMP3 binding element comprising amino acids 370-472 of SEQ ID NO: 90; a BMP4 binding element comprising amino acids 309-409 of SEQ ID NO: 91; a BMP5 binding element comprising amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92; a BMP6 binding element comprising amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93; a BMP7 binding element comprising amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94; a BMP8 binding element comprising amino acids 301-402 of SEQ ID NO: 95; a BMP10 binding element comprising amino acids 323-424 of SEQ ID NO: 96; a GDF1 binding element comprising amino acids 267-372 of SEQ ID NO: 97; a GDF2 binding element comprising amino acids 327-429 of SEQ ID NO: 98; a GDF3 binding element comprising amino acids 264-364 of SEQ ID NO: 99; a GDF5 binding element comprising amino acids 400-501 of SEQ ID NO: 100; a GDF6 binding element comprising amino acids 354-455 of SEQ ID NO: 101; a GDF7 binding element comprising amino acids 352-450 of SEQ ID NO: 102; a GDF8 binding element comprising amino acids 281-375 of SEQ ID NO: 103; a GDF10 binding element comprising amino acids 376-478 of SEQ ID NO: 104; a GDF11 binding element comprising amino acids 313-407 of SEQ ID NO: 105; a GDF15 binding element comprising amino acids 211-308 of SEQ ID NO: 106; an Activin A binding element comprising amino acids 321-426 of SEQ ID NO: 107; an Activin B binding element comprising amino acids 303-406 of SEQ ID NO: 108; an Activin C binding element comprising amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109; an Activin E binding element comprising amino acids 247-350 of SEQ ID NO: 110; an Inhibin A binding element comprising amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111; a VEGF binding element comprising SEQ ID NO: 112; an IGF-1 binding element comprising amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113; an IGF-2 binding element comprising amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114; an EGF binding element comprising SEQ ID NO: 115.
[0469]Furthermore, a similar cloning strategy will be used to make pET29 expression constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-AP4A comprising an exogenous protease cleavage site incorporated within the di-chain loop region such as, e.g, a bovine enterokinase protease cleavage site comprising SEQ ID NO: 21; a Tobacco Etch Virus protease cleavage site comprising SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32 or SEQ ID NO: 33; a Tobacco Vein Mottling Virus protease cleavage site comprising SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, or SEQ ID NO: 39; a human rhinovirus 3C protease cleavage site comprising SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45 or SEQ ID NO: 46; a subtilisin cleavage site comprising SEQ ID NO: 49, SEQ ID NO: 50, or SEQ ID NO: 51; a hydroxylamine cleavage site comprising SEQ ID NO: 52, SEQ ID NO: 53, or SEQ ID NO: 54; a SUMO/ULP-1 protease cleavage site comprising SEQ ID NO: 56; a non-human Caspase 3 protease cleavage site comprising SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62 or SEQ ID NO: 63.
17b. A binding element-therapeutic element-exogenous protease cleavage site-translocation element organization.
[0470]A polynucleotide molecule based on BoNT/A-TEV-GDNFAP4B (SEQ ID NO: 117) will be synthesized and cloned into a pUCBHB1 vector as described in Example 17a. This polynucleotide molecule encodes a BoNT/A modified to replace amino acids 872-1296 of SEQ ID NO: 1, a BoNT/A HC binding element, with amino acids 118-211 of SEQ ID NO: 81, a GDNF peptide and to incorporate a TEV protease site of SEQ ID NO: 24 within the di-chain loop region, arranged in an amino to carboxyl linear organization as depicted in FIG. 20B. In addition, the altered binding element further comprises at its amino terminus, a PAR 1 leader sequence ending in an enterokinse cleavage site, which upon cleavage, results in exposing the first amino acid of the GDNF binding element. If so desired, expression optimization to a different organism, such as, e.g., a bacteria, a yeast strain, an insect cell-line or a mammalian cell line, can be done as described above, see, e.g., Steward, supra, (Feb. 2, 2006); and Steward, supra, (Feb. 16, 2006).
[0471]A similar cloning strategy will be used to make pUCBHB1 cloning constructs for BoNT/B-TEV-GDNFAP4B, a modified BoNT/B where amino acids 861-1291 of SEQ ID NO: 2 are replaced with amino acids 118-211 of SEQ ID NO: 81; BoNT/C1-TEV-GDNFAP4B, a modified BoNT/C1 where amino acids 869-1291 of SEQ ID NO: 3 are replaced with amino acids 118-211 of SEQ ID NO: 81; BoNT/D-TEV-GDNFAP4B, a modified BoNT/D where amino acids 865-1276 of SEQ ID NO: 4 are replaced with amino acids 118-211 of SEQ ID NO: 81; BoNT/E-TEV-GDNFAP4B, a modified BoNT/E where amino acids 848-1252 of SEQ ID NO: 5 are replaced with amino acids 118-211 of SEQ ID NO: 81; BoNT/F-TEV-GDNFAP4B, a modified BoNT/F where amino acids 867-1274 of SEQ ID NO: 6 are replaced with amino acids 118-211 of SEQ ID NO: 81; BoNT/G-TEV-GDNFAP4B, a modified BoNT/G where amino acids 866-1297 of SEQ ID NO: 7 are replaced with amino acids 118-211 of SEQ ID NO: 81; TeNT-TEV-GDNFAP4B, a modified TeNT where amino acids 882-1315 of SEQ ID NO: 8 are replaced with amino acids 118-211 of SEQ ID NO: 81; BaNT-TEV-GDNFAP4B, a modified BaNT where amino acids 858-1268 of SEQ ID NO: 9 are replaced with amino acids 118-211 of SEQ ID NO: 81; and BuNT-TEV-GDNFAP4B, a modified BuNT where amino acids 848-1251 of SEQ ID NO: 10 are replaced with amino acids 118-211 of SEQ ID NO: 81.
[0472]Likewise, a similar cloning strategy will be used to make pUCBHB1 cloning constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-TEV-AP4B that will replace the HC binding element from a Clostridial toxin the with an binding element comprising, e.g, a Neurturin binding element comprising amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82; a Persephrin binding element comprising amino acids 66-155 of SEQ ID NO: 83; an Artemin binding element comprising amino acids 123-218 of SEQ ID NO: 84; a TGFβ1 binding element comprising amino acids 293-390 of SEQ ID NO: 85; a TGFβ2 binding element comprising amino acids 317-414 of SEQ ID NO: 86; a TGFβ3 binding element comprising amino acids 315-412 of SEQ ID NO: 87; a TGFβ4 binding element comprising amino acids 276-373 of SEQ ID NO: 88; a BMP2 binding element comprising amino acids 296-396 of SEQ ID NO: 89; a BMP3 binding element comprising amino acids 370-472 of SEQ ID NO: 90; a BMP4 binding element comprising amino acids 309-409 of SEQ ID NO: 91; a BMP5 binding element comprising amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92; a BMP6 binding element comprising amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93; a BMP7 binding element comprising amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94; a BMP8 binding element comprising amino acids 301-402 of SEQ ID NO: 95; a BMP10 binding element comprising amino acids 323-424 of SEQ ID NO: 96; a GDF1 binding element comprising amino acids 267-372 of SEQ ID NO: 97; a GDF2 binding element comprising amino acids 327-429 of SEQ ID NO: 98; a GDF3 binding element comprising amino acids 264-364 of SEQ ID NO: 99; a GDF5 binding element comprising amino acids 400-501 of SEQ ID NO: 100; a GDF6 binding element comprising amino acids 354-455 of SEQ ID NO: 101; a GDF7 binding element comprising amino acids 352-450 of SEQ ID NO: 102; a GDF8 binding element comprising amino acids 281-375 of SEQ ID NO: 103; a GDF10 binding element comprising amino acids 376-478 of SEQ ID NO: 104; a GDF11 binding element comprising amino acids 313-407 of SEQ ID NO: 105; a GDF15 binding element comprising amino acids 211-308 of SEQ ID NO: 106; an Activin A binding element comprising amino acids 321-426 of SEQ ID NO: 107; an Activin B binding element comprising amino acids 303-406 of SEQ ID NO: 108; an Activin C binding element comprising amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109; an Activin E binding element comprising amino acids 247-350 of SEQ ID NO: 110; an Inhibin A binding element comprising amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111; a VEGF binding element comprising SEQ ID NO: 112; an IGF-1 binding element comprising amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113; an IGF-2 binding element comprising amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114; an EGF binding element comprising SEQ ID NO: 115.
[0473]Likewise, a similar cloning strategy will be used to make pUCBHB1 cloning constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-AP4B comprising an exogenous protease cleavage site incorporated within the di-chain loop region, e.g, a bovine enterokinase protease cleavage site comprising SEQ ID NO: 21; a Tobacco Etch Virus protease cleavage site comprising SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32 or SEQ ID NO: 33; a Tobacco Vein Mottling Virus protease cleavage site comprising SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, or SEQ ID NO: 39; a human rhinovirus 3C protease cleavage site comprising SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45 or SEQ ID NO: 46; a subtilisin cleavage site comprising SEQ ID NO: 49, SEQ ID NO: 50, or SEQ ID NO: 51; a hydroxylamine cleavage site comprising SEQ ID NO: 52, SEQ ID NO: 53, or SEQ ID NO: 54; a SUMO/ULP-1 protease cleavage site comprising SEQ ID NO: 56; a non-human Caspase 3 protease cleavage site comprising SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62 or SEQ ID NO: 63.
[0474]To construct pET29/BoNT/A-TEV-GDNFAP4B, a pUCBHB1/BoNT/A-TEV-GDNFAP4B construct will be digested with restriction endonucleases that 1) will excise the polynucleotide molecule encoding the open reading frame of BoNT/A-TEV-GDNFAP4B; and 2) will enable this polynucleotide molecule to be operably-linked to a pET29 vector (EMD Biosciences-Novagen, Madison, Wis.). This insert will be subcloned using a T4 DNA ligase procedure into a pET29 vector that is digested with appropriate restriction endonucleases to yield pET29/BoNT/A-TEV-GDNFAP4B. The ligation mixture will be transformed into chemically competent E. coli DH5α cells (Invitrogen, Inc, Carlsbad, Calif.) using a heat shock method, will be plated on 1.5% Luria-Bertani agar plates (pH 7.0) containing 50 μg/mL of Kanamycin, and will be placed in a 37° C. incubator for overnight growth. Bacteria containing expression constructs will be identified as Kanamycin resistant colonies. Candidate constructs will be isolated using an alkaline lysis plasmid mini-preparation procedure and will be analyzed by restriction endonuclease digest mapping to determine the presence and orientation of the insert. This cloning strategy will yield a pET29 expression construct comprising the polynucleotide molecule encoding the BoNT/A-TEV-GDNFAP4B operably-linked to a carboxyl terminal polyhistidine affinity binding peptide.
[0475]A similar cloning strategy will be used to make pET29 expression constructs for other modified Clostridial toxin-TEV-GDNFAP4B toxins, such as, e.g., BoNT/B-TEV-GDNFAP4B, BoNT/C1-TEV-GDNFAP4B, BoNT/D-TEV-GDNFAP4B, BoNT/E-TEV-GDNFAP4B, BoNT/F-TEV-GDNFAP4B, BoNT/G-TEV-GDNFAP4B, TeNT-TEV-GDNFAP4B, BaNT-TEV-GDNFAP4B, or BuNT-TEV-GDNFAP4B. Likewise, a similar cloning strategy will be used to make pET29 expression constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-TEV-AP4B comprising a binding element such as, e.g, a Neurturin binding element comprising amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82; a Persephrin binding element comprising amino acids 66-155 of SEQ ID NO: 83; an Artemin binding element comprising amino acids 123-218 of SEQ ID NO: 84; a TGFβ1 binding element comprising amino acids 293-390 of SEQ ID NO: 85; a TGFβ2 binding element comprising amino acids 317-414 of SEQ ID NO: 86; a TGFβ3 binding element comprising amino acids 315-412 of SEQ ID NO: 87; a TGFβ4 binding element comprising amino acids 276-373 of SEQ ID NO: 88; a BMP2 binding element comprising amino acids 296-396 of SEQ ID NO: 89; a BMP3 binding element comprising amino acids 370-472 of SEQ ID NO: 90; a BMP4 binding element comprising amino acids 309-409 of SEQ ID NO: 91; a BMP5 binding element comprising amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92; a BMP6 binding element comprising amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93; a BMP7 binding element comprising amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94; a BMP8 binding element comprising amino acids 301-402 of SEQ ID NO: 95; a BMP10 binding element comprising amino acids 323-424 of SEQ ID NO: 96; a GDF1 binding element comprising amino acids 267-372 of SEQ ID NO: 97; a GDF2 binding element comprising amino acids 327-429 of SEQ ID NO: 98; a GDF3 binding element comprising amino acids 264-364 of SEQ ID NO: 99; a GDF5 binding element comprising amino acids 400-501 of SEQ ID NO: 100; a GDF6 binding element comprising amino acids 354-455 of SEQ ID NO: 101; a GDF7 binding element comprising amino acids 352-450 of SEQ ID NO: 102; a GDF8 binding element comprising amino acids 281-375 of SEQ ID NO: 103; a GDF10 binding element comprising amino acids 376-478 of SEQ ID NO: 104; a GDF11 binding element comprising amino acids 313-407 of SEQ ID NO: 105; a GDF15 binding element comprising amino acids 211-308 of SEQ ID NO: 106; an Activin A binding element comprising amino acids 321-426 of SEQ ID NO: 107; an Activin B binding element comprising amino acids 303-406 of SEQ ID NO: 108; an Activin C binding element comprising amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109; an Activin E binding element comprising amino acids 247-350 of SEQ ID NO: 110; an Inhibin A binding element comprising amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111; a VEGF binding element comprising SEQ ID NO: 112; an IGF-1 binding element comprising amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113; an IGF-2 binding element comprising amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114; an EGF binding element comprising SEQ ID NO: 115.
[0476]Furthermore, a similar cloning strategy will be used to make pET29 expression constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-AP4B comprising an exogenous protease cleavage site incorporated within the di-chain loop region such as, e.g, a bovine enterokinase protease cleavage site comprising SEQ ID NO: 21; a Tobacco Etch Virus protease cleavage site comprising SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32 or SEQ ID NO: 33; a Tobacco Vein Mottling Virus protease cleavage site comprising SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, or SEQ ID NO: 39; a human rhinovirus 3C protease cleavage site comprising SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45 or SEQ ID NO: 46; a subtilisin cleavage site comprising SEQ ID NO: 49, SEQ ID NO: 50, or SEQ ID NO: 51; a hydroxylamine cleavage site comprising SEQ ID NO: 52, SEQ ID NO: 53, or SEQ ID NO: 54; a SUMO/ULP-1 protease cleavage site comprising SEQ ID NO: 56; a non-human Caspase 3 protease cleavage site comprising SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62 or SEQ ID NO: 63.
Example 18
Construction of an Activatable Clostridial Toxin Comprising a Centrally Presented Altered Targeting Domain
[0477]This example illustrates how to make an activatable Clostridial toxin disclosed in the present specification comprising a binding element located between two other domains of the modified toxin.
18a. A therapeutic element-exogenous protease cleavage site-binding element-translocation element organization.
[0478]A polynucleotide molecule based on BoNT/A-ENT-BMP2CP5A (SEQ ID NO: 118) will be synthesized and cloned into a pUCBHB1 vector as described in Example 17a. This polynucleotide molecule encodes a BoNT/A modified to replace amino acids 872-1296 of SEQ ID NO: 1, a BoNT/A HC binding element, with amino acids 296-396 of SEQ ID NO: 89, a BMP2 peptide, and to incorporate a bovine enterokinse protease site of SEQ ID NO: 21 within the di-chain loop region, arranged in an amino to carboxyl linear organization as depicted in FIG. 21A. Cleavage of an enterokinse cleavage site used to form the di-chain toxin also exposes the first amino acid of the BMP2 binding element. If so desired, expression optimization to a different organism, such as, e.g., a bacteria, a yeast strain, an insect cell-line or a mammalian cell line, can be done as described above, see, e.g., Steward, supra, (Feb. 2, 2006); and Steward, supra, (Feb. 16, 2006).
[0479]A similar cloning strategy will be used to make pUCBHB1 cloning constructs for BoNT/B-ENT-BMP2CP5A, a modified BoNT/B where amino acids 861-1291 of SEQ ID NO: 2 are replaced with amino acids 296-396 of SEQ ID NO: 89; BoNT/C1-ENT-BMP2CP5A, a modified BoNT/C1 where amino acids 869-1291 of SEQ ID NO: 3 are replaced with amino acids 296-396 of SEQ ID NO: 89; BoNT/D-ENT-BMP2CP5A, a modified BoNT/D where amino acids 865-1276 of SEQ ID NO: 4 are replaced with amino acids 296-396 of SEQ ID NO: 89; BoNT/E-ENT-BMP2CP5A, a modified BoNT/E where amino acids 848-1252 of SEQ ID NO: 5 are replaced with amino acids 296-396 of SEQ ID NO: 89; BoNT/F-ENT-BMP2CP5A, a modified BoNT/F where amino acids 867-1274 of SEQ ID NO: 6 are replaced with amino acids 296-396 of SEQ ID NO: 89; BoNT/G-ENT-BMP2CP5A, a modified BoNT/G where amino acids 866-1297 of SEQ ID NO: 7 are replaced with amino acids 296-396 of SEQ ID NO: 89; TeNT-ENT-BMP2CP5A, a modified TeNT where amino acids 882-1315 of SEQ ID NO: 8 are replaced with amino acids 296-396 of SEQ ID NO: 89; BaNT-ENT-BMP2CP5A, a modified BaNT where amino acids 858-1268 of SEQ ID NO: 9 are replaced with amino acids 296-396 of SEQ ID NO: 89; and BuNT-ENT-BMP2CP5A, a modified BuNT where amino acids 848-1251 of SEQ ID NO: 10 are replaced with amino acids 296-396 of SEQ ID NO: 89.
[0480]Likewise, a similar cloning strategy will be used to make pUCBHB1 cloning constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-ENT-CP5A that will replace the HC binding element from a Clostridial toxin the with an binding element comprising, e.g, a GDNF binding element comprising amino acids 118-211 of SEQ ID NO: 81; a Neurturin binding element comprising amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82; a Persephrin binding element comprising amino acids 66-155 of SEQ ID NO: 83; an Artemin binding element comprising amino acids 123-218 of SEQ ID NO: 84; a TGFβ1 binding element comprising amino acids 293-390 of SEQ ID NO: 85; a TGFβ2 binding element comprising amino acids 317-414 of SEQ ID NO: 86; a TGFβ3 binding element comprising amino acids 315-412 of SEQ ID NO: 87; a TGFβ4 binding element comprising amino acids 276-373 of SEQ ID NO: 88; a BMP3 binding element comprising amino acids 370-472 of SEQ ID NO: 90; a BMP4 binding element comprising amino acids 309-409 of SEQ ID NO: 91; a BMP5 binding element comprising amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92; a BMP6 binding element comprising amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93; a BMP7 binding element comprising amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94; a BMP8 binding element comprising amino acids 301-402 of SEQ ID NO: 95; a BMP10 binding element comprising amino acids 323-424 of SEQ ID NO: 96; a GDF1 binding element comprising amino acids 267-372 of SEQ ID NO: 97; a GDF2 binding element comprising amino acids 327-429 of SEQ ID NO: 98; a GDF3 binding element comprising amino acids 264-364 of SEQ ID NO: 99; a GDF5 binding element comprising amino acids 400-501 of SEQ ID NO: 100; a GDF6 binding element comprising amino acids 354-455 of SEQ ID NO: 101; a GDF7 binding element comprising amino acids 352-450 of SEQ ID NO: 102; a GDF8 binding element comprising amino acids 281-375 of SEQ ID NO: 103; a GDF10 binding element comprising amino acids 376-478 of SEQ ID NO: 104; a GDF11 binding element comprising amino acids 313-407 of SEQ ID NO: 105; a GDF15 binding element comprising amino acids 211-308 of SEQ ID NO: 106; an Activin A binding element comprising amino acids 321-426 of SEQ ID NO: 107; an Activin B binding element comprising amino acids 303-406 of SEQ ID NO: 108; an Activin C binding element comprising amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109; an Activin E binding element comprising amino acids 247-350 of SEQ ID NO: 110; an Inhibin A binding element comprising amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111; a VEGF binding element comprising SEQ ID NO: 112; an IGF-1 binding element comprising amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113; an IGF-2 binding element comprising amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114; an EGF binding element comprising SEQ ID NO: 115.
[0481]Likewise, a similar cloning strategy will be used to make pUCBHB1 cloning constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-CP5A comprising an exogenous protease cleavage site incorporated within the di-chain loop region, e.g, a Tobacco Etch Virus protease cleavage site comprising SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32 or SEQ ID NO: 33; a Tobacco Vein Mottling Virus protease cleavage site comprising SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, or SEQ ID NO: 39; a human rhinovirus 3C protease cleavage site comprising SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45 or SEQ ID NO: 46; a subtilisin cleavage site comprising SEQ ID NO: 49, SEQ ID NO: 50, or SEQ ID NO: 51; a hydroxylamine cleavage site comprising SEQ ID NO: 52, SEQ ID NO: 53, or SEQ ID NO: 54; a SUMO/ULP-1 protease cleavage site comprising SEQ ID NO: 56; a non-human Caspase 3 protease cleavage site comprising SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62 or SEQ ID NO: 63. In addition, a similar cloning strategy will be used to make pUCBHB1 cloning constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-CP5A comprising an exogenous protease cleavage site incorporated within the di-chain loop region, cleavage of which converts the single-chain polypeptide of the toxin into its di-chain form and also exposes the first amino acid of the binding element.
[0482]To construct pET29/BoNT/A-ENT-BMP2CP5A, a pUCBHB1/BoNT/A-ENT-BMP2CP5A construct will be digested with restriction endonucleases that 1) will excise the polynucleotide molecule encoding the open reading frame of BoNT/A-ENT-BMP2CP5A; and 2) will enable this polynucleotide molecule to be operably-linked to a pET29 vector (EMD Biosciences-Novagen, Madison, Wis.). This insert will be subcloned using a T4 DNA ligase procedure into a pET29 vector that is digested with appropriate restriction endonucleases to yield pET29/BoNT/A-ENT-BMP2CP5A. The ligation mixture will be transformed into chemically competent E. coli DH5a cells (Invitrogen, Inc, Carlsbad, Calif.) using a heat shock method, will be plated on 1.5% Luria-Bertani agar plates (pH 7.0) containing 50 μg/mL of Kanamycin, and will be placed in a 37° C. incubator for overnight growth. Bacteria containing expression constructs will be identified as Kanamycin resistant colonies. Candidate constructs will be isolated using an alkaline lysis plasmid mini-preparation procedure and will be analyzed by restriction endonuclease digest mapping to determine the presence and orientation of the insert. This cloning strategy will yield a pET29 expression construct comprising the polynucleotide molecule encoding the BoNT/A-TEV-BMP2CP5A operably-linked to a carboxyl terminal polyhistidine affinity binding peptide.
[0483]A similar cloning strategy will be used to make pET29 expression constructs for other modified Clostridial toxin-ENT-BMP2CP5A toxins, such as, e.g., BoNT/B-ENT-BMP2CP5A, BoNT/C1-ENT-BMP2CP5A, BoNT/D-ENT-BMP2CP5A, BoNT/E-ENT-BMP2CP5A, BoNT/F-ENT-BMP2CP5A, BoNT/G-ENT-BMP2CP5A, TeNT-ENT-BMP2CP5A, BaNT-ENT-BMP2CP5A, or BuNT-ENT-BMP2CP5A. Likewise, a similar cloning strategy will be used to make pET29 expression constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-ENT-CP5B comprising a binding element such as, e.g, a GDNF binding element comprising amino acids 118-211 of SEQ ID NO: 81; a Neurturin binding element comprising amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82; a Persephrin binding element comprising amino acids 66-155 of SEQ ID NO: 83; an Artemin binding element comprising amino acids 123-218 of SEQ ID NO: 84; a TGFβ1 binding element comprising amino acids 293-390 of SEQ ID NO: 85; a TGFβ2 binding element comprising amino acids 317-414 of SEQ ID NO: 86; a TGFβ3 binding element comprising amino acids 315-412 of SEQ ID NO: 87; a TGFβ4 binding element comprising amino acids 276-373 of SEQ ID NO: 88; a BMP3 binding element comprising amino acids 370-472 of SEQ ID NO: 90; a BMP4 binding element comprising amino acids 309-409 of SEQ ID NO: 91; a BMP5 binding element comprising amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92; a BMP6 binding element comprising amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93; a BMP7 binding element comprising amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94; a BMP8 binding element comprising amino acids 301-402 of SEQ ID NO: 95; a BMP10 binding element comprising amino acids 323-424 of SEQ ID NO: 96; a GDF1 binding element comprising amino acids 267-372 of SEQ ID NO: 97; a GDF2 binding element comprising amino acids 327-429 of SEQ ID NO: 98; a GDF3 binding element comprising amino acids 264-364 of SEQ ID NO: 99; a GDF5 binding element comprising amino acids 400-501 of SEQ ID NO: 100; a GDF6 binding element comprising amino acids 354-455 of SEQ ID NO: 101; a GDF7 binding element comprising amino acids 352-450 of SEQ ID NO: 102; a GDF8 binding element comprising amino acids 281-375 of SEQ ID NO: 103; a GDF10 binding element comprising amino acids 376-478 of SEQ ID NO: 104; a GDF11 binding element comprising amino acids 313-407 of SEQ ID NO: 105; a GDF15 binding element comprising amino acids 211-308 of SEQ ID NO: 106; an Activin A binding element comprising amino acids 321-426 of SEQ ID NO: 107; an Activin B binding element comprising amino acids 303-406 of SEQ ID NO: 108; an Activin C binding element comprising amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109; an Activin E binding element comprising amino acids 247-350 of SEQ ID NO: 110; an Inhibin A binding element comprising amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111; a VEGF binding element comprising SEQ ID NO: 112; an IGF-1 binding element comprising amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113; an IGF-2 binding element comprising amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114; an EGF binding element comprising SEQ ID NO: 115. If required for function, the selected binding element will be engineered to expose the free amino terminal amino acid of the binding element.
[0484]Furthermore, a similar cloning strategy will be used to make pET29 expression constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-CP5A comprising an exogenous protease cleavage site incorporated within the di-chain loop region such as, e.g, a Tobacco Etch Virus protease cleavage site comprising SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32 or SEQ ID NO: 33; a Tobacco Vein Mottling Virus protease cleavage site comprising SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, or SEQ ID NO: 39; a human rhinovirus 3C protease cleavage site comprising SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45 or SEQ ID NO: 46; a subtilisin cleavage site comprising SEQ ID NO: 49, SEQ ID NO: 50, or SEQ ID NO: 51; a hydroxylamine cleavage site comprising SEQ ID NO: 52, SEQ ID NO: 53, or SEQ ID NO: 54; a SUMO/ULP-1 protease cleavage site comprising SEQ ID NO: 56; a non-human Caspase 3 protease cleavage site comprising SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62 or SEQ ID NO: 63. In addition, a similar cloning strategy will be used to make pET29 expression constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-CP5A comprising an exogenous protease cleavage site incorporated within the di-chain loop region such as, e.g, an exogenous protease cleavage site which upon cleavage converts the single-chain polypeptide of the toxin into its di-chain form and also exposes the first amino acid of the binding element.
18b. A translocation element-exogenous protease cleavage site-binding element-therapeutic element organization.
[0485]A polynucleotide molecule based on BoNT/A-ENT-BMP2CP5B (SEQ ID NO: 119) will be synthesized and cloned into a pUCBHB1 vector as described in Example 17a. This polynucleotide molecule encodes a BoNT/A modified to replace amino acids 872-1296 of SEQ ID NO: 1, a BoNT/A HC binding element, with amino acids 296-396 of SEQ ID NO: 89, a BMP2 peptide and to incorporate a bovine enterokinse protease site of SEQ ID NO: 21 within the di-chain loop region, arranged in an amino to carboxyl linear organization as depicted in FIG. 21B. Cleavage of an enterokinse cleavage site used to form the di-chain toxin also exposes the first amino acid of the BMP2 binding element. If so desired, expression optimization to a different organism, such as, e.g., a bacteria, a yeast strain, an insect cell-line or a mammalian cell line, can be done as described above, see, e.g., Steward, supra, (Feb. 2, 2006); and Steward, supra, (Feb. 16, 2006).
[0486]A similar cloning strategy will be used to make pUCBHB1 cloning constructs for BoNT/B-ENT-BMP2CP5B, a modified BoNT/B where amino acids 861-1291 of SEQ ID NO: 2 are replaced with amino acids 296-396 of SEQ ID NO: 89; BoNT/C1-ENT-BMP2CP5B, a modified BoNT/C1 where amino acids 869-1291 of SEQ ID NO: 3 are replaced with amino acids 296-396 of SEQ ID NO: 89; BoNT/D-ENT-BMP2CP5B, a modified BoNT/D where amino acids 865-1276 of SEQ ID NO: 4 are replaced with amino acids 296-396 of SEQ ID NO: 89; BoNT/E-ENT-BMP2CP5B, a modified BoNT/E where amino acids 848-1252 of SEQ ID NO: 5 are replaced with amino acids 296-396 of SEQ ID NO: 89; BoNT/F-ENT-BMP2CP5B, a modified BoNT/F where amino acids 867-1274 of SEQ ID NO: 6 are replaced with amino acids 296-396 of SEQ ID NO: 89; BoNT/G-ENT-BMP2CP5B, a modified BoNT/G where amino acids 866-1297 of SEQ ID NO: 7 are replaced with amino acids 296-396 of SEQ ID NO: 89; TeNT-ENT-BMP2CP5B, a modified TeNT where amino acids 882-1315 of SEQ ID NO: 8 are replaced with amino acids 296-396 of SEQ ID NO: 89; BaNT-ENT-BMP2CP5B, a modified BaNT where amino acids 858-1268 of SEQ ID NO: 9 are replaced with amino acids 296-396 of SEQ ID NO: 89; and BuNT-ENT-BMP2CP5B, a modified BuNT where amino acids 848-1251 of SEQ ID NO: 10 are replaced with amino acids 296-396 of SEQ ID NO: 89.
[0487]Likewise, a similar cloning strategy will be used to make pUCBHB1 cloning constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-ENT-CP5B that will replace the HC binding element from a Clostridial toxin the with an binding element comprising, e.g, a GDNF binding element comprising amino acids 118-211 of SEQ ID NO: 81; a Neurturin binding element comprising amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82; a Persephrin binding element comprising amino acids 66-155 of SEQ ID NO: 83; an Artemin binding element comprising amino acids 123-218 of SEQ ID NO: 84; a TGFβ1 binding element comprising amino acids 293-390 of SEQ ID NO: 85; a TGFβ2 binding element comprising amino acids 317-414 of SEQ ID NO: 86; a TGFβ3 binding element comprising amino acids 315-412 of SEQ ID NO: 87; a TGFβ4 binding element comprising amino acids 276-373 of SEQ ID NO: 88; a BMP3 binding element comprising amino acids 370-472 of SEQ ID NO: 90; a BMP4 binding element comprising amino acids 309-409 of SEQ ID NO: 91; a BMP5 binding element comprising amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92; a BMP6 binding element comprising amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93; a BMP7 binding element comprising amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94; a BMP8 binding element comprising amino acids 301-402 of SEQ ID NO: 95; a BMP10 binding element comprising amino acids 323-424 of SEQ ID NO: 96; a GDF1 binding element comprising amino acids 267-372 of SEQ ID NO: 97; a GDF2 binding element comprising amino acids 327-429 of SEQ ID NO: 98; a GDF3 binding element comprising amino acids 264-364 of SEQ ID NO: 99; a GDF5 binding element comprising amino acids 400-501 of SEQ ID NO: 100; a GDF6 binding element comprising amino acids 354-455 of SEQ ID NO: 101; a GDF7 binding element comprising amino acids 352-450 of SEQ ID NO: 102; a GDF8 binding element comprising amino acids 281-375 of SEQ ID NO: 103; a GDF10 binding element comprising amino acids 376-478 of SEQ ID NO: 104; a GDF11 binding element comprising amino acids 313-407 of SEQ ID NO: 105; a GDF15 binding element comprising amino acids 211-308 of SEQ ID NO: 106; an Activin A binding element comprising amino acids 321-426 of SEQ ID NO: 107; an Activin B binding element comprising amino acids 303-406 of SEQ ID NO: 108; an Activin C binding element comprising amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109; an Activin E binding element comprising amino acids 247-350 of SEQ ID NO: 110; an Inhibin A binding element comprising amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111; a VEGF binding element comprising SEQ ID NO: 112; an IGF-1 binding element comprising amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113; an IGF-2 binding element comprising amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114; an EGF binding element comprising SEQ ID NO: 115.
[0488]Likewise, a similar cloning strategy will be used to make pUCBHB1 cloning constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-CP5B comprising an exogenous protease cleavage site incorporated within the di-chain loop region, e.g, a Tobacco Etch Virus protease cleavage site comprising SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32 or SEQ ID NO: 33; a Tobacco Vein Mottling Virus protease cleavage site comprising SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, or SEQ ID NO: 39; a human rhinovirus 3C protease cleavage site comprising SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45 or SEQ ID NO: 46; a subtilisin cleavage site comprising SEQ ID NO: 49, SEQ ID NO: 50, or SEQ ID NO: 51; a hydroxylamine cleavage site comprising SEQ ID NO: 52, SEQ ID NO: 53, or SEQ ID NO: 54; a SUMO/ULP-1 protease cleavage site comprising SEQ ID NO: 56; a non-human Caspase 3 protease cleavage site comprising SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62 or SEQ ID NO: 63. In addition, a similar cloning strategy will be used to make pUCBHB1 cloning constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-CP5B comprising an exogenous protease cleavage site incorporated within the di-chain loop region, cleavage of which converts the single-chain polypeptide of the toxin into its di-chain form and also exposes the first amino acid of the binding element.
[0489]To construct pET29/BoNT/A-ENT-BMP2CP5B, a pUCBHB1/BoNT/A-ENT-BMP2CP5B construct will be digested with restriction endonucleases that 1) will excise the polynucleotide molecule encoding the open reading frame of BoNT/A-ENT-BMP2CP5B; and 2) will enable this polynucleotide molecule to be operably-linked to a pET29 vector (EMD Biosciences-Novagen, Madison, Wis.). This insert will be subcloned using a T4 DNA ligase procedure into a pET29 vector that is digested with appropriate restriction endonucleases to yield pET29/BoNT/A-ENT-BMP2CP5B. The ligation mixture will be transformed into chemically competent E. coli DH5α cells (Invitrogen, Inc, Carlsbad, Calif.) using a heat shock method, will be plated on 1.5% Luria-Bertani agar plates (pH 7.0) containing 50 μg/mL of Kanamycin, and will be placed in a 37° C. incubator for overnight growth. Bacteria containing expression constructs will be identified as Kanamycin resistant colonies. Candidate constructs will be isolated using an alkaline lysis plasmid mini-preparation procedure and will be analyzed by restriction endonuclease digest mapping to determine the presence and orientation of the insert. This cloning strategy will yield a pET29 expression construct comprising the polynucleotide molecule encoding the BoNT/A-ENT-BMP2CP5B operably-linked to a carboxyl terminal polyhistidine affinity binding peptide.
[0490]A similar cloning strategy will be used to make pET29 expression constructs for other modified Clostridial toxin-ENT-BMP2CP5B toxins, such as, e.g., BoNT/B-ENT-BMP2CP5B, BoNT/C1-ENT-BMP2CP5B, BoNT/D-ENT-BMP2CP5B, BoNT/E-ENT-BMP2CP5B, BoNT/F-ENT-BMP2CP5B, BoNT/G-ENT-BMP2CP5B, TeNT-ENT-BMP2CP5B, BaNT-ENT-BMP2CP5B, or BuNT-ENT-BMP2CP5B. Likewise, a similar cloning strategy will be used to make pET29 expression constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-ENT-CP5B comprising a binding element such as, e.g, a GDNF binding element comprising amino acids 118-211 of SEQ ID NO: 81; a Neurturin binding element comprising amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82; a Persephrin binding element comprising amino acids 66-155 of SEQ ID NO: 83; an Artemin binding element comprising amino acids 123-218 of SEQ ID NO: 84; a TGFβ1 binding element comprising amino acids 293-390 of SEQ ID NO: 85; a TGFβ2 binding element comprising amino acids 317-414 of SEQ ID NO: 86; a TGFβ3 binding element comprising amino acids 315-412 of SEQ ID NO: 87; a TGFβ4 binding element comprising amino acids 276-373 of SEQ ID NO: 88; a BMP3 binding element comprising amino acids 370-472 of SEQ ID NO: 90; a BMP4 binding element comprising amino acids 309-409 of SEQ ID NO: 91; a BMP5 binding element comprising amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92; a BMP6 binding element comprising amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93; a BMP7 binding element comprising amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94; a BMP8 binding element comprising amino acids 301-402 of SEQ ID NO: 95; a BMP10 binding element comprising amino acids 323-424 of SEQ ID NO: 96; a GDF1 binding element comprising amino acids 267-372 of SEQ ID NO: 97; a GDF2 binding element comprising amino acids 327-429 of SEQ ID NO: 98; a GDF3 binding element comprising amino acids 264-364 of SEQ ID NO: 99; a GDF5 binding element comprising amino acids 400-501 of SEQ ID NO: 100; a GDF6 binding element comprising amino acids 354-455 of SEQ ID NO: 101; a GDF7 binding element comprising amino acids 352-450 of SEQ ID NO: 102; a GDF8 binding element comprising amino acids 281-375 of SEQ ID NO: 103; a GDF10 binding element comprising amino acids 376-478 of SEQ ID NO: 104; a GDF11 binding element comprising amino acids 313-407 of SEQ ID NO: 105; a GDF15 binding element comprising amino acids 211-308 of SEQ ID NO: 106; an Activin A binding element comprising amino acids 321-426 of SEQ ID NO: 107; an Activin B binding element comprising amino acids 303-406 of SEQ ID NO: 108; an Activin C binding element comprising amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109; an Activin E binding element comprising amino acids 247-350 of SEQ ID NO: 110; an Inhibin A binding element comprising amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111; a VEGF binding element comprising SEQ ID NO: 112; an IGF-1 binding element comprising amino acids 52-109 or amino acids 49-118 of SEQ ID NO: 113; an IGF-2 binding element comprising amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114; an EGF binding element comprising SEQ ID NO: 115. If required for function, the selected binding element will be engineered to expose the free amino terminal amino acid of the binding element.
[0491]Furthermore, a similar cloning strategy will be used to make pET29 expression constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-CP5B comprising an exogenous protease cleavage site incorporated within the di-chain loop region such as, e.g, a Tobacco Etch Virus protease cleavage site comprising SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32 or SEQ ID NO: 33; a Tobacco Vein Mottling Virus protease cleavage site comprising SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, or SEQ ID NO: 39; a human rhinovirus 3C protease cleavage site comprising SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45 or SEQ ID NO: 46; a subtilisin cleavage site comprising SEQ ID NO: 49, SEQ ID NO: 50, or SEQ ID NO: 51; a hydroxylamine cleavage site comprising SEQ ID NO: 52, SEQ ID NO: 53, or SEQ ID NO: 54; a SUMO/ULP-1 protease cleavage site comprising SEQ ID NO: 56; a non-human Caspase 3 protease cleavage site comprising SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62 or SEQ ID NO: 63. In addition, a similar cloning strategy will be used to make pET29 expression constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-CP5B comprising an exogenous protease cleavage site incorporated within the di-chain loop region such as, e.g, an exogenous protease cleavage site which upon cleavage converts the single-chain polypeptide of the toxin into its di-chain form and also exposes the first amino acid of the binding element.
Example 19
Construction of an Activatable Clostridial Toxin Comprising a Carboxyl-Terminally Presented Altered Targeting Domain
[0492]This example illustrates how to make an activatable Clostridial toxin disclosed in the present specification comprising a binding element located at the carboxyl terminus of the modified toxin.
19a. A therapeutic element-exogenous pro tease cleavage site-translocation element-binding element organization.
[0493]A polynucleotide molecule based on BoNT/A-TEV-IGF1XP6A (SEQ ID NO: 120) will be synthesized and cloned into a pUCBHB1 vector as described in Example 17a. This polynucleotide molecule encodes a BoNT/A modified to replace amino acids 872-1296 of SEQ ID NO: 1, a BoNT/A HC binding element, with amino acids 52-109 of SEQ ID NO: 113, an IGF-1 peptide and to incorporate a TEV protease site of SEQ ID NO: 24 within the di-chain loop region, arranged in an amino to carboxyl linear organization as depicted in FIG. 22A. If so desired, expression optimization to a different organism, such as, e.g., a bacteria, a yeast strain, an insect cell-line or a mammalian cell line, can be done as described above, see, e.g., Steward, supra, (Feb. 2, 2006); and Steward, supra, (Feb. 16, 2006).
[0494]A similar cloning strategy will be used to make pUCBHB1 cloning constructs for BoNT/B-TEV-IGF1XP6A, a modified BoNT/B where amino acids 861-1291 of SEQ ID NO: 2 are replaced with amino acids 52-109 of SEQ ID NO: 113; BoNT/C1-TEV-IGF1XP6A, a modified BoNT/C1 where amino acids 869-1291 of SEQ ID NO: 3 are replaced with amino acids 52-109 of SEQ ID NO: 113; BoNT/D-TEV-IGF1XP6A, a modified BoNT/D where amino acids 865-1276 of SEQ ID NO: 4 are replaced with amino acids 52-109 of SEQ ID NO: 113; BoNT/E-TEV-IGF1XP6A, a modified BoNT/E where amino acids 848-1252 of SEQ ID NO: 5 are replaced with amino acids 52-109 of SEQ ID NO: 113; BoNT/F-TEV-IGF1 XP6A, a modified BoNT/F where amino acids 867-1274 of SEQ ID NO: 6 are replaced with amino acids 52-109 of SEQ ID NO: 113; BoNT/G-TEV-IGF1XP6A, a modified BoNT/G where amino acids 866-1297 of SEQ ID NO: 7 are replaced with amino acids 52-109 of SEQ ID NO: 113; TeNT-TEV-IGF1XP6A, a modified TeNT where amino acids 882-1315 of SEQ ID NO: 8 are replaced with amino acids 52-109 of SEQ ID NO: 113; BaNT-TEV-IGF1XP6A, a modified BaNT where amino acids 858-1268 of SEQ ID NO: 9 are replaced with amino acids 52-109 of SEQ ID NO: 113; and BuNT-TEV-IGF1XP6A, a modified BuNT where amino acids 848-1251 of SEQ ID NO: 10 are replaced with amino acids 52-109 of SEQ ID NO: 113.
[0495]Likewise, a similar cloning strategy will be used to make pUCBHB1 cloning constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-TEV-XP6A that will replace the HC binding element from a Clostridial toxin the with an binding element comprising, e.g, a GDNF binding element comprising amino acids 118-211 of SEQ ID NO: 81; a Neurturin binding element comprising amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82; a Persephrin binding element comprising amino acids 66-155 of SEQ ID NO: 83; an Artemin binding element comprising amino acids 123-218 of SEQ ID NO: 84; a TGFβ1 binding element comprising amino acids 293-390 of SEQ ID NO: 85; a TGFβ2 binding element comprising amino acids 317-414 of SEQ ID NO: 86; a TGFβ3 binding element comprising amino acids 315-412 of SEQ ID NO: 87; a TGFβ4 binding element comprising amino acids 276-373 of SEQ ID NO: 88; a BMP2 binding element comprising amino acids 296-396 of SEQ ID NO: 89; a BMP3 binding element comprising amino acids 370-472 of SEQ ID NO: 90; a BMP4 binding element comprising amino acids 309-409 of SEQ ID NO: 91; a BMP5 binding element comprising amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92; a BMP6 binding element comprising amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93; a BMP7 binding element comprising amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94; a BMP8 binding element comprising amino acids 301-402 of SEQ ID NO: 95; a BMP10 binding element comprising amino acids 323-424 of SEQ ID NO: 96; a GDF1 binding element comprising amino acids 267-372 of SEQ ID NO: 97; a GDF2 binding element comprising amino acids 327-429 of SEQ ID NO: 98; a GDF3 binding element comprising amino acids 264-364 of SEQ ID NO: 99; a GDF5 binding element comprising amino acids 400-501 of SEQ ID NO: 100; a GDF6 binding element comprising amino acids 354-455 of SEQ ID NO: 101; a GDF7 binding element comprising amino acids 352-450 of SEQ ID NO: 102; a GDF8 binding element comprising amino acids 281-375 of SEQ ID NO: 103; a GDF10 binding element comprising amino acids 376-478 of SEQ ID NO: 104; a GDF11 binding element comprising amino acids 313-407 of SEQ ID NO: 105; a GDF15 binding element comprising amino acids 211-308 of SEQ ID NO: 106; an Activin A binding element comprising amino acids 321-426 of SEQ ID NO: 107; an Activin B binding element comprising amino acids 303-406 of SEQ ID NO: 108; an Activin C binding element comprising amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109; an Activin E binding element comprising amino acids 247-350 of SEQ ID NO: 110; an Inhibin A binding element comprising amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111; a VEGF binding element comprising SEQ ID NO: 112; an IGF-1 binding element comprising amino acids 49-118 of SEQ ID NO: 113; an IGF-2 binding element comprising amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114; an EGF binding element comprising SEQ ID NO: 115.
[0496]Likewise, a similar cloning strategy will be used to make pUCBHB1 cloning constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-XP6A comprising an exogenous protease cleavage site incorporated within the di-chain loop region, e.g, a bovine enterokinase protease cleavage site comprising SEQ ID NO: 21; a Tobacco Etch Virus protease cleavage site comprising SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32 or SEQ ID NO: 33; a Tobacco Vein Mottling Virus protease cleavage site comprising SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, or SEQ ID NO: 39; a human rhinovirus 3C protease cleavage site comprising SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45 or SEQ ID NO: 46; a subtilisin cleavage site comprising SEQ ID NO: 49, SEQ ID NO: 50, or SEQ ID NO: 51; a hydroxylamine cleavage site comprising SEQ ID NO: 52, SEQ ID NO: 53, or SEQ ID NO: 54; a SUMO/ULP-1 protease cleavage site comprising SEQ ID NO: 56; a non-human Caspase 3 protease cleavage site comprising SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62 or SEQ ID NO: 63.
[0497]To construct pET29/BoNT/A-TEV-IGF1XP6A, a pUCBHB1/BoNT/A-TEV-IGF1XP6A construct will be digested with restriction endonucleases that 1) will excise the polynucleotide molecule encoding the open reading frame of BoNT/A-TEV-IGF1XP6A; and 2) will enable this polynucleotide molecule to be operably-linked to a pET29 vector (EMD Biosciences-Novagen, Madison, Wis.). This insert will be subcloned using a T4 DNA ligase procedure into a pET29 vector that is digested with appropriate restriction endonucleases to yield pET29/BoNT/A-TEV-IGF1XP6A. The ligation mixture will be transformed into chemically competent E. coli DH5α cells (Invitrogen, Inc, Carlsbad, Calif.) using a heat shock method, will be plated on 1.5% Luria-Bertani agar plates (pH 7.0) containing 50 μg/mL of Kanamycin, and will be placed in a 37° C. incubator for overnight growth. Bacteria containing expression constructs will be identified as Kanamycin resistant colonies. Candidate constructs will be isolated using an alkaline lysis plasmid mini-preparation procedure and will be analyzed by restriction endonuclease digest mapping to determine the presence and orientation of the insert. This cloning strategy will yield a pET29 expression construct comprising the polynucleotide molecule encoding the BoNT/A-TEV-IGF1 XP6A operably-linked to a carboxyl terminal polyhistidine affinity binding peptide.
[0498]A similar cloning strategy will be used to make pET29 expression constructs for other modified Clostridial toxin-TEV-IGF1XP6A toxins, such as, e.g., BoNT/B-TEV-IGF1XP6A, BoNT/C1-TEV-IGF1 XP6A, BoNT/D-TEV-IGF1 XP6A, BoNT/E-TEV-IGF1 XP6A, BoNT/F-TEV-IGF1 XP6A, BoNT/G-TEV-IGF1 XP6A, TeNT-TEV-IGF1 XP6A, BaNT-TEV-IGF1 XP6A, or BuNT-TEV-IGF1 XP6A. Likewise, a similar cloning strategy will be used to make pET29 expression constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-TEV-XP6A comprising a binding element such as, e.g, a GDNF binding element comprising amino acids 118-211 of SEQ ID NO: 81; a Neurturin binding element comprising amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82; a Persephrin binding element comprising amino acids 66-155 of SEQ ID NO: 83; an Artemin binding element comprising amino acids 123-218 of SEQ ID NO: 84; a TGFβ1 binding element comprising amino acids 293-390 of SEQ ID NO: 85; a TGFβ2 binding element comprising amino acids 317-414 of SEQ ID NO: 86; a TGFβ3 binding element comprising amino acids 315-412 of SEQ ID NO: 87; a TGFβ4 binding element comprising amino acids 276-373 of SEQ ID NO: 88; a BMP2 binding element comprising amino acids 296-396 of SEQ ID NO: 89; a BMP3 binding element comprising amino acids 370-472 of SEQ ID NO: 90; a BMP4 binding element comprising amino acids 309-409 of SEQ ID NO: 91; a BMP5 binding element comprising amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92; a BMP6 binding element comprising amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93; a BMP7 binding element comprising amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94; a BMP8 binding element comprising amino acids 301-402 of SEQ ID NO: 95; a BMP10 binding element comprising amino acids 323-424 of SEQ ID NO: 96; a GDF1 binding element comprising amino acids 267-372 of SEQ ID NO: 97; a GDF2 binding element comprising amino acids 327-429 of SEQ ID NO: 98; a GDF3 binding element comprising amino acids 264-364 of SEQ ID NO: 99; a GDF5 binding element comprising amino acids 400-501 of SEQ ID NO: 100; a GDF6 binding element comprising amino acids 354-455 of SEQ ID NO: 101; a GDF7 binding element comprising amino acids 352-450 of SEQ ID NO: 102; a GDF8 binding element comprising amino acids 281-375 of SEQ ID NO: 103; a GDF10 binding element comprising amino acids 376-478 of SEQ ID NO: 104; a GDF11 binding element comprising amino acids 313-407 of SEQ ID NO: 105; a GDF15 binding element comprising amino acids 211-308 of SEQ ID NO: 106; an Activin A binding element comprising amino acids 321-426 of SEQ ID NO: 107; an Activin B binding element comprising amino acids 303-406 of SEQ ID NO: 108; an Activin C binding element comprising amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109; an Activin E binding element comprising amino acids 247-350 of SEQ ID NO: 110; an Inhibin A binding element comprising amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111; a VEGF binding element comprising SEQ ID NO: 112; an IGF-1 binding element comprising amino acids 49-118 of SEQ ID NO: 113; an IGF-2 binding element comprising amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114; an EGF binding element comprising SEQ ID NO: 115.
[0499]Furthermore, a similar cloning strategy will be used to make pET29 expression constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-XP6A comprising an exogenous protease cleavage site incorporated within the di-chain loop region such as, e.g, a bovine enterokinase protease cleavage site comprising SEQ ID NO: 21; a Tobacco Etch Virus protease cleavage site comprising SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32 or SEQ ID NO: 33; a Tobacco Vein Mottling Virus protease cleavage site comprising SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, or SEQ ID NO: 39; a human rhinovirus 3C protease cleavage site comprising SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45 or SEQ ID NO: 46; a subtilisin cleavage site comprising SEQ ID NO: 49, SEQ ID NO: 50, or SEQ ID NO: 51; a hydroxylamine cleavage site comprising SEQ ID NO: 52, SEQ ID NO: 53, or SEQ ID NO: 54; a SUMO/ULP-1 protease cleavage site comprising SEQ ID NO: 56; a non-human Caspase 3 protease cleavage site comprising SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62 or SEQ ID NO: 63.
19b. A translocation element-exogenous protease cleavage site-therapeutic element-binding element organization.
[0500]A polynucleotide molecule based on BoNT/A-TEV-IGF1XP6B (SEQ ID NO: 121) will be synthesized and cloned into a pUCBHB1 vector as described in Example 17a. This polynucleotide molecule encodes a BoNT/A modified to replace amino acids 872-1296 of SEQ ID NO: 1, a BoNT/A HC binding element, with amino acids 52-109 of SEQ ID NO: 113, an IGF-1 peptide and to incorporate a TEV protease site of SEQ ID NO: 24 within the di-chain loop region, arranged in an amino to carboxyl linear organization as depicted in FIG. 22B. If so desired, expression optimization to a different organism, such as, e.g., a bacteria, a yeast strain, an insect cell-line or a mammalian cell line, can be done as described above, see, e.g., Steward, supra, (Feb. 2, 2006); and Steward, supra, (Feb. 16, 2006).
[0501]A similar cloning strategy will be used to make pUCBHB1 cloning constructs for BoNT/B-TEV-IGF1XP6B, a modified BoNT/B where amino acids 861-1291 of SEQ ID NO: 2 are replaced with amino acids 52-109 of SEQ ID NO: 113; BoNT/C1-TEV-IGF1XP6B, a modified BoNT/C1 where amino acids 869-1291 of SEQ ID NO: 3 are replaced with amino acids 52-109 of SEQ ID NO: 113; BoNT/D-TEV-IGF1XP6B, a modified BoNT/D where amino acids 865-1276 of SEQ ID NO: 4 are replaced with amino acids 52-109 of SEQ ID NO: 113; BoNT/E-TEV-IGF1XP6B, a modified BoNT/E where amino acids 848-1252 of SEQ ID NO: 5 are replaced with amino acids 52-109 of SEQ ID NO: 113; BoNT/F-TEV-IGF1 XP6B, a modified BoNT/F where amino acids 867-1274 of SEQ ID NO: 6 are replaced with amino acids 52-109 of SEQ ID NO: 113; BoNT/G-TEV-IGF1XP6B, a modified BoNT/G where amino acids 866-1297 of SEQ ID NO: 7 are replaced with amino acids 52-109 of SEQ ID NO: 113; TeNT-TEV-IGF1XP6B, a modified TeNT where amino acids 882-1315 of SEQ ID NO: 8 are replaced with amino acids 52-109 of SEQ ID NO: 113; BaNT-TEV-IGF1XP6B, a modified BaNT where amino acids 858-1268 of SEQ ID NO: 9 are replaced with amino acids 52-109 of SEQ ID NO: 113; and BuNT-TEV-IGF1XP6B, a modified BuNT where amino acids 848-1251 of SEQ ID NO: 10 are replaced with amino acids 52-109 of SEQ ID NO: 113.
[0502]Likewise, a similar cloning strategy will be used to make pUCBHB1 cloning constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-TEV-XP6B that will replace the HC binding element from a Clostridial toxin the with an binding element comprising, e.g, a GDNF binding element comprising amino acids 118-211 of SEQ ID NO: 81; a Neurturin binding element comprising amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82; a Persephrin binding element comprising amino acids 66-155 of SEQ ID NO: 83; an Artemin binding element comprising amino acids 123-218 of SEQ ID NO: 84; a TGFβ1 binding element comprising amino acids 293-390 of SEQ ID NO: 85; a TGFβ2 binding element comprising amino acids 317-414 of SEQ ID NO: 86; a TGFβ3 binding element comprising amino acids 315-412 of SEQ ID NO: 87; a TGFβ4 binding element comprising amino acids 276-373 of SEQ ID NO: 88; a BMP2 binding element comprising amino acids 296-396 of SEQ ID NO: 89; a BMP3 binding element comprising amino acids 370-472 of SEQ ID NO: 90; a BMP4 binding element comprising amino acids 309-409 of SEQ ID NO: 91; a BMP5 binding element comprising amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92; a BMP6 binding element comprising amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93; a BMP7 binding element comprising amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94; a BMP8 binding element comprising amino acids 301-402 of SEQ ID NO: 95; a BMP10 binding element comprising amino acids 323-424 of SEQ ID NO: 96; a GDF1 binding element comprising amino acids 267-372 of SEQ ID NO: 97; a GDF2 binding element comprising amino acids 327-429 of SEQ ID NO: 98; a GDF3 binding element comprising amino acids 264-364 of SEQ ID NO: 99; a GDF5 binding element comprising amino acids 400-501 of SEQ ID NO: 100; a GDF6 binding element comprising amino acids 354-455 of SEQ ID NO: 101; a GDF7 binding element comprising amino acids 352-450 of SEQ ID NO: 102; a GDF8 binding element comprising amino acids 281-375 of SEQ ID NO: 103; a GDF10 binding element comprising amino acids 376-478 of SEQ ID NO: 104; a GDF11 binding element comprising amino acids 313-407 of SEQ ID NO: 105; a GDF15 binding element comprising amino acids 211-308 of SEQ ID NO: 106; an Activin A binding element comprising amino acids 321-426 of SEQ ID NO: 107; an Activin B binding element comprising amino acids 303-406 of SEQ ID NO: 108; an Activin C binding element comprising amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109; an Activin E binding element comprising amino acids 247-350 of SEQ ID NO: 110; an Inhibin A binding element comprising amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111; a VEGF binding element comprising SEQ ID NO: 112; an IGF-1 binding element comprising amino acids 49-118 of SEQ ID NO: 113; an IGF-2 binding element comprising amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114; an EGF binding element comprising SEQ ID NO: 115.
[0503]Likewise, a similar cloning strategy will be used to make pUCBHB1 cloning constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-XP6B comprising an exogenous protease cleavage site incorporated within the di-chain loop region, e.g, a bovine enterokinase protease cleavage site comprising SEQ ID NO: 21; a Tobacco Etch Virus protease cleavage site comprising SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32 or SEQ ID NO: 33; a Tobacco Vein Mottling Virus protease cleavage site comprising SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, or SEQ ID NO: 39; a human rhinovirus 3C protease cleavage site comprising SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45 or SEQ ID NO: 46; a subtilisin cleavage site comprising SEQ ID NO: 49, SEQ ID NO: 50, or SEQ ID NO: 51; a hydroxylamine cleavage site comprising SEQ ID NO: 52, SEQ ID NO: 53, or SEQ ID NO: 54; a SUMO/ULP-1 protease cleavage site comprising SEQ ID NO: 56; a non-human Caspase 3 protease cleavage site comprising SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62 or SEQ ID NO: 63.
[0504]To construct pET29/BoNT/A-TEV-GDNFAP4B, a pUCBHB1/BoNT/A-TEV-IGF1XP6B construct will be digested with restriction endonucleases that 1) will excise the polynucleotide molecule encoding the open reading frame of BoNT/A-TEV-IGF1XP6B; and 2) will enable this polynucleotide molecule to be operably-linked to a pET29 vector (EMD Biosciences-Novagen, Madison, Wis.). This insert will be subcloned using a T4 DNA ligase procedure into a pET29 vector that is digested with appropriate restriction endonucleases to yield pET29/BoNT/A-TEV-IGF1XP6B. The ligation mixture will be transformed into chemically competent E. coli DH5α cells (Invitrogen, Inc, Carlsbad, Calif.) using a heat shock method, will be plated on 1.5% Luria-Bertani agar plates (pH 7.0) containing 50 μg/mL of Kanamycin, and will be placed in a 37° C. incubator for overnight growth. Bacteria containing expression constructs will be identified as Kanamycin resistant colonies. Candidate constructs will be isolated using an alkaline lysis plasmid mini-preparation procedure and will be analyzed by restriction endonuclease digest mapping to determine the presence and orientation of the insert. This cloning strategy will yield a pET29 expression construct comprising the polynucleotide molecule encoding the BoNT/A-TEV-IGF1XP6B operably-linked to a carboxyl terminal polyhistidine affinity binding peptide.
[0505]A similar cloning strategy will be used to make pET29 expression constructs for other modified Clostridial toxin-TEV-IGF1XP6B toxins, such as, e.g., BoNT/B-TEV-IGF1XP6B, BoNT/C1-TEV-IGF1 XP6B, BoNT/D-TEV-IGF1 XP6B, BoNT/E-TEV-IGF1 XP6B, BoNT/F-TEV-IGF1 XP6B, BoNT/G-TEV-IGF1 XP6B, TeNT-TEV-IGF1 XP6B, BaNT-TEV-IGF1 XP6B, or BuNT-TEV-IGF1 XP6B. Likewise, a similar cloning strategy will be used to make pET29 expression constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-TEV-XP6B comprising a binding element such as, e.g, a GDNF binding element comprising amino acids 118-211 of SEQ ID NO: 81; a Neurturin binding element comprising amino acids 107-196 or amino acids 96-197 of SEQ ID NO: 82; a Persephrin binding element comprising amino acids 66-155 of SEQ ID NO: 83; an Artemin binding element comprising amino acids 123-218 of SEQ ID NO: 84; a TGFβ1 binding element comprising amino acids 293-390 of SEQ ID NO: 85; a TGFβ2 binding element comprising amino acids 317-414 of SEQ ID NO: 86; a TGFβ3 binding element comprising amino acids 315-412 of SEQ ID NO: 87; a TGFβ4 binding element comprising amino acids 276-373 of SEQ ID NO: 88; a BMP2 binding element comprising amino acids 296-396 of SEQ ID NO: 89; a BMP3 binding element comprising amino acids 370-472 of SEQ ID NO: 90; a BMP4 binding element comprising amino acids 309-409 of SEQ ID NO: 91; a BMP5 binding element comprising amino acids 353-454 or amino acids 323-454 of SEQ ID NO: 92; a BMP6 binding element comprising amino acids 412-513 or amino acids 374-513 of SEQ ID NO: 93; a BMP7 binding element comprising amino acids 330-431 or amino acids 293-431 of SEQ ID NO: 94; a BMP8 binding element comprising amino acids 301-402 of SEQ ID NO: 95; a BMP10 binding element comprising amino acids 323-424 of SEQ ID NO: 96; a GDF1 binding element comprising amino acids 267-372 of SEQ ID NO: 97; a GDF2 binding element comprising amino acids 327-429 of SEQ ID NO: 98; a GDF3 binding element comprising amino acids 264-364 of SEQ ID NO: 99; a GDF5 binding element comprising amino acids 400-501 of SEQ ID NO: 100; a GDF6 binding element comprising amino acids 354-455 of SEQ ID NO: 101; a GDF7 binding element comprising amino acids 352-450 of SEQ ID NO: 102; a GDF8 binding element comprising amino acids 281-375 of SEQ ID NO: 103; a GDF10 binding element comprising amino acids 376-478 of SEQ ID NO: 104; a GDF11 binding element comprising amino acids 313-407 of SEQ ID NO: 105; a GDF15 binding element comprising amino acids 211-308 of SEQ ID NO: 106; an Activin A binding element comprising amino acids 321-426 of SEQ ID NO: 107; an Activin B binding element comprising amino acids 303-406 of SEQ ID NO: 108; an Activin C binding element comprising amino acids 247-352 or amino acids 237-352 of SEQ ID NO: 109; an Activin E binding element comprising amino acids 247-350 of SEQ ID NO: 110; an Inhibin A binding element comprising amino acids 262-366 or amino acids 233-366 of SEQ ID NO: 111; a VEGF binding element comprising SEQ ID NO: 112; an IGF-1 binding element comprising amino acids 49-118 of SEQ ID NO: 113; an IGF-2 binding element comprising amino acids 31-84 or amino acids 25-180 of SEQ ID NO: 114; an EGF binding element comprising SEQ ID NO: 115.
[0506]Furthermore, a similar cloning strategy will be used to make pET29 expression constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin-XP6B comprising an exogenous protease cleavage site incorporated within the di-chain loop region such as, e.g, a bovine enterokinase protease cleavage site comprising SEQ ID NO: 21; a Tobacco Etch Virus protease cleavage site comprising SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32 or SEQ ID NO: 33; a Tobacco Vein Mottling Virus protease cleavage site comprising SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, or SEQ ID NO: 39; a human rhinovirus 3C protease cleavage site comprising SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45 or SEQ ID NO: 46; a subtilisin cleavage site comprising SEQ ID NO: 49, SEQ ID NO: 50, or SEQ ID NO: 51; a hydroxylamine cleavage site comprising SEQ ID NO: 52, SEQ ID NO: 53, or SEQ ID NO: 54; a SUMO/ULP-1 protease cleavage site comprising SEQ ID NO: 56; a non-human Caspase 3 protease cleavage site comprising SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62 or SEQ ID NO: 63.
Example 20
Expression of Activatable Clostridial Toxins in a Bacterial Cell
[0507]The following example illustrates a procedure useful for expressing any of the activatable Clostridial toxins disclosed in the present specification in a bacterial cell.
[0508]An expression construct, such as, e.g., any of the expression constructs in Examples 17-19, will be introduced into chemically competent E. coli BL21 (DE3) cells (Invitrogen, Inc, Carlsbad, Calif.) using a heat-shock transformation protocol. The heat-shock reaction will be plated onto 1.5% Luria-Bertani agar plates (pH 7.0) containing 50 μg/mL of Kanamycin and will be placed in a 37° C. incubator for overnight growth. Kanamycin-resistant colonies of transformed E. coli containing the expression construct will be used to inoculate a baffled flask containing 3.0 mL of PA-0.5G media containing 50 μg/mL of Kanamycin which will then placed in a 37° C. incubator, shaking at 250 rpm, for overnight growth. The resulting overnight starter culture will be used to inoculate a 3 L baffled flask containing ZYP-5052 autoinducing media containing 50 μg/mL of Kanamycin at a dilution of 1:1000. Culture volumes will range from about 600 mL (20% flask volume) to about 750 mL (25% flask volume). These cultures will be grown in a 37° C. incubator shaking at 250 rpm for approximately 5.5 hours and will be then transferred to a 16° C. incubator shaking at 250 rpm for overnight expression. Cells will be harvested by centrifugation (4,000 rpm at 4° C. for 20-30 minutes) and will be used immediately, or will be stored dry at -80° C. until needed.
Example 21
Purification and Quantification of Activatable Clostridial Toxins
[0509]The following example illustrates methods useful for purification and quantification of any activatable Clostridial toxins disclosed in the present specification.
[0510]For immobilized metal affinity chromatography (IMAC) protein purification, E. coli BL21 (DE3) cell pellets used to express a modified Clostridial toxin, as described in Example 20, will be resuspended in Column Binding Buffer (25 mM N-(2-hydroxyethyl) piperazine-N'-(2-ethanesulfonic acid) (HEPES), pH 7.8; 500 mM sodium chloride; 10 mM imidazole; 2× Protease Inhibitor Cocktail Set III (EMD Biosciences-Calbiochem, San Diego Calif.); 5 units/mL of Benzonase (EMD Biosciences-Novagen, Madison, Wis.); 0.1% (v/v) TRITON-X® 100, 4-octylphenol polyethoxylate; 10% (v/v) glycerol), and will then be transferred to a cold Oakridge centrifuge tube. The cell suspension will be sonicated on ice (10-12 pulses of 10 seconds at 40% amplitude with 60 seconds cooling intervals on a Branson Digital Sonifier) in order to lyse the cells and then is centrifuged (16,000 rpm at 4° C. for 20 minutes) to clarify the lysate. An immobilized metal affinity chromatography column will be prepared using a 20 mL Econo-Pac column support (Bio-Rad Laboratories, Hercules, Calif.) packed with 2.5-5.0 mL of TALON® SuperFlow Co2+affinity resin (BD Biosciences-Clontech, Palo Alto, Calif.), which will then be equilibrated by rinsing with 5 column volumes of deionized, distilled water, followed by 5 column volumes of Column Binding Buffer. The clarified lysate will be applied slowly to the equilibrated column by gravity flow (approximately 0.25-0.3 mL/minute). The column will then be washed with 5 column volumes of Column Wash Buffer (N-(2-hydroxyethyl) piperazine-N'-(2-ethanesulfonic acid) (HEPES), pH 7.8; 500 mM sodium chloride; 10 mM imidazole; 0.1% (v/v) Triton-X® 100, 4-octylphenol polyethoxylate; 10% (v/v) glycerol). The modified Clostridial toxin will be eluted with 20-30 mL of Column Elution Buffer (25 mM N-(2-hydroxyethyl) piperazine-N'-(2-ethanesulfonic acid) (HEPES), pH 7.8; 500 mM sodium chloride; 500 mM imidazole; 0.1% (v/v) TRITON-X® 100, 4-octylphenol polyethoxylate; 10% (v/v) glycerol) and will be collected in approximately twelve 1 mL fractions. The amount of modified Clostridial toxin contained in each elution fraction will be determined by a Bradford dye assay. In this procedure, 20 μL aliquots of each 1.0 mL fraction will be combined with 200 μL of Bio-Rad Protein Reagent (Bio-Rad Laboratories, Hercules, Calif.), diluted 1 to 4 with deionized, distilled water, and then the intensity of the colorimetric signal will be measured using a spectrophotometer. The five fractions with the strongest signal will be considered the elution peak and will be combined together. Total protein yield will be determined by estimating the total protein concentration of the pooled peak elution fractions using bovine gamma globulin as a standard (Bio-Rad Laboratories, Hercules, Calif.).
[0511]For purification of a modified Clostridial toxin using a FPLC desalting column, a HiPrep® 26/10 size exclusion column (Amersham Biosciences, Piscataway, N.J.) will be pre-equilibrated with 80 mL of 4° C. Column Buffer (50 mM sodium phosphate, pH 6.5). After the column is equilibrated, a modified Clostridial toxin sample will be applied to the size exclusion column with an isocratic mobile phase of 4° C. Column Buffer and at a flow rate of 10 mL/minute using a BioLogic DuoFlow chromatography system (Bio-Rad Laboratories, Hercules, Calif.). The desalted modified Clostridial toxin sample will be collected as a single fraction of approximately 7-12 mL.
[0512]For purification of a modified Clostridial toxin using a FPLC ion exchange column, a modified Clostridial toxin sample that has been desalted following elution from an IMAC column will be applied to a 1 mL Q1® anion exchange column (Bio-Rad Laboratories, Hercules, Calif.) using a BioLogic DuoFlow chromatography system (Bio-Rad Laboratories, Hercules, Calif.). The sample will be applied to the column in 4° C. Column Buffer (50 mM sodium phosphate, pH 6.5) and will be eluted by linear gradient with 4° C. Elution Buffer (50 mM sodium phosphate, 1 M sodium chloride, pH 6.5) as follows: step 1, 5.0 mL of 5% Elution Buffer at a flow rate of 1 mL/minute; step 2, 20.0 mL of 5-30% Elution Buffer at a flow rate of 1 mL/minute; step 3, 2.0 mL of 50% Elution Buffer at a flow rate of 1.0 mL/minute; step 4, 4.0 mL of 100% Elution Buffer at a flow rate of 1.0 mL/minute; and step 5, 5.0 mL of 0% Elution Buffer at a flow rate of 1.0 mL/minute. Elution of modified Clostridial toxin from the column will be monitored at 280, 260, and 214 nm, and peaks absorbing above a minimum threshold (0.01 au) at 280 nm will be collected. Most of the modified Clostridial toxin will be eluted at a sodium chloride concentration of approximately 100 to 200 mM. Average total yields of modified Clostridial toxin will be determined by a Bradford assay.
[0513]Expression of a modified Clostridial toxin will be analyzed by polyacrylamide gel electrophoresis. Samples purified using the procedure described above are added to 2×LDS Sample Buffer (Invitrogen, Inc, Carlsbad, Calif.) and will be separated by MOPS polyacrylamide gel electrophoresis using NuPAGE® Novex 4-12% Bis-Tris precast polyacrylamide gels (Invitrogen, Inc, Carlsbad, Calif.) under denaturing, reducing conditions. Gels will be stained with SYPRO® Ruby (Bio-Rad Laboratories, Hercules, Calif.) and the separated polypeptides will be imaged using a Fluor-S MAX Multilmager (Bio-Rad Laboratories, Hercules, Calif.) for quantification of modified Clostridial toxin expression levels. The size and amount of modified Clostridial toxin will be determined by comparison to MagicMark® protein molecular weight standards (Invitrogen, Inc, Carlsbad, Calif.).
[0514]Expression of modified Clostridial toxin will also be analyzed by Western blot analysis. Protein samples purified using the procedure described above will be added to 2×LDS Sample Buffer (Invitrogen, Inc, Carlsbad, Calif.) and will be separated by MOPS polyacrylamide gel electrophoresis using NuPAGE® Novex 4-12% Bis-Tris precast polyacrylamide gels (Invitrogen, Inc, Carlsbad, Calif.) under denaturing, reducing conditions. Separated polypeptides will be transferred from the gel onto polyvinylidene fluoride (PVDF) membranes (Invitrogen, Inc, Carlsbad, Calif.) by Western blotting using a Trans-Blot® SD semi-dry electrophoretic transfer cell apparatus (Bio-Rad Laboratories, Hercules, Calif.). PVDF membranes will be blocked by incubating at room temperature for 2 hours in a solution containing 25 mM Tris-Buffered Saline (25 mM 2-amino-2-hydroxymethyl-1,3-propanediol hydrochloric acid (Tris-HCl)(pH 7.4), 137 mM sodium chloride, 2.7 mM potassium chloride), 0.1% TWEEN-20®, polyoxyethylene (20) sorbitan monolaureate, 2% bovine serum albumin, 5% nonfat dry milk. Blocked membranes will be incubated at 4° C. for overnight in Tris-Buffered Saline TWEEN-20® (25 mM Tris-Buffered Saline, 0.1% TWEEN-20®, polyoxyethylene (20) sorbitan monolaureate) containing appropriate primary antibodies as a probe. Primary antibody probed blots will be washed three times for 15 minutes each time in Tris-Buffered Saline TWEEN-20®. Washed membranes will be incubated at room temperature for 2 hours in Tris-Buffered Saline TWEEN-20® containing an appropriate immunoglobulin G antibody conjugated to horseradish peroxidase as a secondary antibody. Secondary antibody-probed blots will be washed three times for 15 minutes each time in Tris-Buffered Saline TWEEN-20®. Signal detection of the labeled modified Clostridial toxin will be visualized using the ECL Plus® Western Blot Detection System (Amersham Biosciences, Piscataway, N.J.) and will be imaged with a Typhoon 9410 Variable Mode Imager (Amersham Biosciences, Piscataway, N.J.) for quantification of modified Clostridial toxin expression levels.
[0515]Although aspects of the present invention have been described with reference to the disclosed embodiments, one skilled in the art will readily appreciate that the specific examples disclosed are only illustrative of these aspects and in no way limit the present invention. Various modifications can be made without departing from the spirit of the present invention.
[0516]Those of skill in the art will understand that the Examples provided herein describe preferred compositions and methods, and that a variety of different cloning strategies, protease cleavage sites, and specific binding complex members may be employed in the practice and use of the present invention while remaining within the invention's scope. Additionally, different di-chain or binary toxin molecules and modified versions thereof (for example, BoNT/B-E and modified variants thereof) may be used as the basis for the methods and compositions of the present invention.
Sequence CWU
1
12111296PRTClostridium botulinum Serotype ADOMAIN(1)...(448)Light chain
comprising the enzymatic domain. 1Met Pro Phe Val Asn Lys Gln Phe Asn Tyr
Lys Asp Pro Val Asn Gly1 5 10
15Val Asp Ile Ala Tyr Ile Lys Ile Pro Asn Ala Gly Gln Met Gln Pro20
25 30Val Lys Ala Phe Lys Ile His Asn Lys
Ile Trp Val Ile Pro Glu Arg35 40 45Asp
Thr Phe Thr Asn Pro Glu Glu Gly Asp Leu Asn Pro Pro Pro Glu50
55 60Ala Lys Gln Val Pro Val Ser Tyr Tyr Asp Ser
Thr Tyr Leu Ser Thr65 70 75
80Asp Asn Glu Lys Asp Asn Tyr Leu Lys Gly Val Thr Lys Leu Phe Glu85
90 95Arg Ile Tyr Ser Thr Asp Leu Gly Arg
Met Leu Leu Thr Ser Ile Val100 105 110Arg
Gly Ile Pro Phe Trp Gly Gly Ser Thr Ile Asp Thr Glu Leu Lys115
120 125Val Ile Asp Thr Asn Cys Ile Asn Val Ile Gln
Pro Asp Gly Ser Tyr130 135 140Arg Ser Glu
Glu Leu Asn Leu Val Ile Ile Gly Pro Ser Ala Asp Ile145
150 155 160Ile Gln Phe Glu Cys Lys Ser
Phe Gly His Glu Val Leu Asn Leu Thr165 170
175Arg Asn Gly Tyr Gly Ser Thr Gln Tyr Ile Arg Phe Ser Pro Asp Phe180
185 190Thr Phe Gly Phe Glu Glu Ser Leu Glu
Val Asp Thr Asn Pro Leu Leu195 200 205Gly
Ala Gly Lys Phe Ala Thr Asp Pro Ala Val Thr Leu Ala His Glu210
215 220Leu Ile His Ala Gly His Arg Leu Tyr Gly Ile
Ala Ile Asn Pro Asn225 230 235
240Arg Val Phe Lys Val Asn Thr Asn Ala Tyr Tyr Glu Met Ser Gly
Leu245 250 255Glu Val Ser Phe Glu Glu Leu
Arg Thr Phe Gly Gly His Asp Ala Lys260 265
270Phe Ile Asp Ser Leu Gln Glu Asn Glu Phe Arg Leu Tyr Tyr Tyr Asn275
280 285Lys Phe Lys Asp Ile Ala Ser Thr Leu
Asn Lys Ala Lys Ser Ile Val290 295 300Gly
Thr Thr Ala Ser Leu Gln Tyr Met Lys Asn Val Phe Lys Glu Lys305
310 315 320Tyr Leu Leu Ser Glu Asp
Thr Ser Gly Lys Phe Ser Val Asp Lys Leu325 330
335Lys Phe Asp Lys Leu Tyr Lys Met Leu Thr Glu Ile Tyr Thr Glu
Asp340 345 350Asn Phe Val Lys Phe Phe Lys
Val Leu Asn Arg Lys Thr Tyr Leu Asn355 360
365Phe Asp Lys Ala Val Phe Lys Ile Asn Ile Val Pro Lys Val Asn Tyr370
375 380Thr Ile Tyr Asp Gly Phe Asn Leu Arg
Asn Thr Asn Leu Ala Ala Asn385 390 395
400Phe Asn Gly Gln Asn Thr Glu Ile Asn Asn Met Asn Phe Thr
Lys Leu405 410 415Lys Asn Phe Thr Gly Leu
Phe Glu Phe Tyr Lys Leu Leu Cys Val Arg420 425
430Gly Ile Ile Thr Ser Lys Thr Lys Ser Leu Asp Lys Gly Tyr Asn
Lys435 440 445Ala Leu Asn Asp Leu Cys Ile
Lys Val Asn Asn Trp Asp Leu Phe Phe450 455
460Ser Pro Ser Glu Asp Asn Phe Thr Asn Asp Leu Asn Lys Gly Glu Glu465
470 475 480Ile Thr Ser Asp
Thr Asn Ile Glu Ala Ala Glu Glu Asn Ile Ser Leu485 490
495Asp Leu Ile Gln Gln Tyr Tyr Leu Thr Phe Asn Phe Asp Asn
Glu Pro500 505 510Glu Asn Ile Ser Ile Glu
Asn Leu Ser Ser Asp Ile Ile Gly Gln Leu515 520
525Glu Leu Met Pro Asn Ile Glu Arg Phe Pro Asn Gly Lys Lys Tyr
Glu530 535 540Leu Asp Lys Tyr Thr Met Phe
His Tyr Leu Arg Ala Gln Glu Phe Glu545 550
555 560His Gly Lys Ser Arg Ile Ala Leu Thr Asn Ser Val
Asn Glu Ala Leu565 570 575Leu Asn Pro Ser
Arg Val Tyr Thr Phe Phe Ser Ser Asp Tyr Val Lys580 585
590Lys Val Asn Lys Ala Thr Glu Ala Ala Met Phe Leu Gly Trp
Val Glu595 600 605Gln Leu Val Tyr Asp Phe
Thr Asp Glu Thr Ser Glu Val Ser Thr Thr610 615
620Asp Lys Ile Ala Asp Ile Thr Ile Ile Ile Pro Tyr Ile Gly Pro
Ala625 630 635 640Leu Asn
Ile Gly Asn Met Leu Tyr Lys Asp Asp Phe Val Gly Ala Leu645
650 655Ile Phe Ser Gly Ala Val Ile Leu Leu Glu Phe Ile
Pro Glu Ile Ala660 665 670Ile Pro Val Leu
Gly Thr Phe Ala Leu Val Ser Tyr Ile Ala Asn Lys675 680
685Val Leu Thr Val Gln Thr Ile Asp Asn Ala Leu Ser Lys Arg
Asn Glu690 695 700Lys Trp Asp Glu Val Tyr
Lys Tyr Ile Val Thr Asn Trp Leu Ala Lys705 710
715 720Val Asn Thr Gln Ile Asp Leu Ile Arg Lys Lys
Met Lys Glu Ala Leu725 730 735Glu Asn Gln
Ala Glu Ala Thr Lys Ala Ile Ile Asn Tyr Gln Tyr Asn740
745 750Gln Tyr Thr Glu Glu Glu Lys Asn Asn Ile Asn Phe
Asn Ile Asp Asp755 760 765Leu Ser Ser Lys
Leu Asn Glu Ser Ile Asn Lys Ala Met Ile Asn Ile770 775
780Asn Lys Phe Leu Asn Gln Cys Ser Val Ser Tyr Leu Met Asn
Ser Met785 790 795 800Ile
Pro Tyr Gly Val Lys Arg Leu Glu Asp Phe Asp Ala Ser Leu Lys805
810 815Asp Ala Leu Leu Lys Tyr Ile Tyr Asp Asn Arg
Gly Thr Leu Ile Gly820 825 830Gln Val Asp
Arg Leu Lys Asp Lys Val Asn Asn Thr Leu Ser Thr Asp835
840 845Ile Pro Phe Gln Leu Ser Lys Tyr Val Asp Asn Gln
Arg Leu Leu Ser850 855 860Thr Phe Thr Glu
Tyr Ile Lys Asn Ile Ile Asn Thr Ser Ile Leu Asn865 870
875 880Leu Arg Tyr Glu Ser Asn His Leu Ile
Asp Leu Ser Arg Tyr Ala Ser885 890 895Lys
Ile Asn Ile Gly Ser Lys Val Asn Phe Asp Pro Ile Asp Lys Asn900
905 910Gln Ile Gln Leu Phe Asn Leu Glu Ser Ser Lys
Ile Glu Val Ile Leu915 920 925Lys Asn Ala
Ile Val Tyr Asn Ser Met Tyr Glu Asn Phe Ser Thr Ser930
935 940Phe Trp Ile Arg Ile Pro Lys Tyr Phe Asn Ser Ile
Ser Leu Asn Asn945 950 955
960Glu Tyr Thr Ile Ile Asn Cys Met Glu Asn Asn Ser Gly Trp Lys Val965
970 975Ser Leu Asn Tyr Gly Glu Ile Ile Trp
Thr Leu Gln Asp Thr Gln Glu980 985 990Ile
Lys Gln Arg Val Val Phe Lys Tyr Ser Gln Met Ile Asn Ile Ser995
1000 1005Asp Tyr Ile Asn Arg Trp Ile Phe Val Thr Ile
Thr Asn Asn Arg Leu1010 1015 1020Asn Asn
Ser Lys Ile Tyr Ile Asn Gly Arg Leu Ile Asp Gln Lys Pro1025
1030 1035 1040Ile Ser Asn Leu Gly Asn Ile
His Ala Ser Asn Asn Ile Met Phe Lys1045 1050
1055Leu Asp Gly Cys Arg Asp Thr His Arg Tyr Ile Trp Ile Lys Tyr Phe1060
1065 1070Asn Leu Phe Asp Lys Glu Leu Asn Glu
Lys Glu Ile Lys Asp Leu Tyr1075 1080
1085Asp Asn Gln Ser Asn Ser Gly Ile Leu Lys Asp Phe Trp Gly Asp Tyr1090
1095 1100Leu Gln Tyr Asp Lys Pro Tyr Tyr Met
Leu Asn Leu Tyr Asp Pro Asn1105 1110 1115
1120Lys Tyr Val Asp Val Asn Asn Val Gly Ile Arg Gly Tyr Met
Tyr Leu1125 1130 1135Lys Gly Pro Arg Gly
Ser Val Met Thr Thr Asn Ile Tyr Leu Asn Ser1140 1145
1150Ser Leu Tyr Arg Gly Thr Lys Phe Ile Ile Lys Lys Tyr Ala Ser
Gly1155 1160 1165Asn Lys Asp Asn Ile Val
Arg Asn Asn Asp Arg Val Tyr Ile Asn Val1170 1175
1180Val Val Lys Asn Lys Glu Tyr Arg Leu Ala Thr Asn Ala Ser Gln
Ala1185 1190 1195 1200Gly
Val Glu Lys Ile Leu Ser Ala Leu Glu Ile Pro Asp Val Gly Asn1205
1210 1215Leu Ser Gln Val Val Val Met Lys Ser Lys Asn
Asp Gln Gly Ile Thr1220 1225 1230Asn Lys
Cys Lys Met Asn Leu Gln Asp Asn Asn Gly Asn Asp Ile Gly1235
1240 1245Phe Ile Gly Phe His Gln Phe Asn Asn Ile Ala Lys
Leu Val Ala Ser1250 1255 1260Asn Trp Tyr
Asn Arg Gln Ile Glu Arg Ser Ser Arg Thr Leu Gly Cys1265
1270 1275 1280Ser Trp Glu Phe Ile Pro Val
Asp Asp Gly Trp Gly Glu Arg Pro Leu1285 1290
129521291PRTClostridium botulinum Serotype BDOMAIN(1)...(441)Light chain
comprising the enzymatic domain. 2Met Pro Val Thr Ile Asn Asn Phe Asn Tyr
Asn Asp Pro Ile Asp Asn1 5 10
15Asn Asn Ile Ile Met Met Glu Pro Pro Phe Ala Arg Gly Thr Gly Arg20
25 30Tyr Tyr Lys Ala Phe Lys Ile Thr Asp
Arg Ile Trp Ile Ile Pro Glu35 40 45Arg
Tyr Thr Phe Gly Tyr Lys Pro Glu Asp Phe Asn Lys Ser Ser Gly50
55 60Ile Phe Asn Arg Asp Val Cys Glu Tyr Tyr Asp
Pro Asp Tyr Leu Asn65 70 75
80Thr Asn Asp Lys Lys Asn Ile Phe Leu Gln Thr Met Ile Lys Leu Phe85
90 95Asn Arg Ile Lys Ser Lys Pro Leu Gly
Glu Lys Leu Leu Glu Met Ile100 105 110Ile
Asn Gly Ile Pro Tyr Leu Gly Asp Arg Arg Val Pro Leu Glu Glu115
120 125Phe Asn Thr Asn Ile Ala Ser Val Thr Val Asn
Lys Leu Ile Ser Asn130 135 140Pro Gly Glu
Val Glu Arg Lys Lys Gly Ile Phe Ala Asn Leu Ile Ile145
150 155 160Phe Gly Pro Gly Pro Val Leu
Asn Glu Asn Glu Thr Ile Asp Ile Gly165 170
175Ile Gln Asn His Phe Ala Ser Arg Glu Gly Phe Gly Gly Ile Met Gln180
185 190Met Lys Phe Cys Pro Glu Tyr Val Ser
Val Phe Asn Asn Val Gln Glu195 200 205Asn
Lys Gly Ala Ser Ile Phe Asn Arg Arg Gly Tyr Phe Ser Asp Pro210
215 220Ala Leu Ile Leu Met His Glu Leu Ile His Val
Leu His Gly Leu Tyr225 230 235
240Gly Ile Lys Val Asp Asp Leu Pro Ile Val Pro Asn Glu Lys Lys
Phe245 250 255Phe Met Gln Ser Thr Asp Ala
Ile Gln Ala Glu Glu Leu Tyr Thr Phe260 265
270Gly Gly Gln Asp Pro Ser Ile Ile Thr Pro Ser Thr Asp Lys Ser Ile275
280 285Tyr Asp Lys Val Leu Gln Asn Phe Arg
Gly Ile Val Asp Arg Leu Asn290 295 300Lys
Val Leu Val Cys Ile Ser Asp Pro Asn Ile Asn Ile Asn Ile Tyr305
310 315 320Lys Asn Lys Phe Lys Asp
Lys Tyr Lys Phe Val Glu Asp Ser Glu Gly325 330
335Lys Tyr Ser Ile Asp Val Glu Ser Phe Asp Lys Leu Tyr Lys Ser
Leu340 345 350Met Phe Gly Phe Thr Glu Thr
Asn Ile Ala Glu Asn Tyr Lys Ile Lys355 360
365Thr Arg Ala Ser Tyr Phe Ser Asp Ser Leu Pro Pro Val Lys Ile Lys370
375 380Asn Leu Leu Asp Asn Glu Ile Tyr Thr
Ile Glu Glu Gly Phe Asn Ile385 390 395
400Ser Asp Lys Asp Met Glu Lys Glu Tyr Arg Gly Gln Asn Lys
Ala Ile405 410 415Asn Lys Gln Ala Tyr Glu
Glu Ile Ser Lys Glu His Leu Ala Val Tyr420 425
430Lys Ile Gln Met Cys Lys Ser Val Lys Ala Pro Gly Ile Cys Ile
Asp435 440 445Val Asp Asn Glu Asp Leu Phe
Phe Ile Ala Asp Lys Asn Ser Phe Ser450 455
460Asp Asp Leu Ser Lys Asn Glu Arg Ile Glu Tyr Asn Thr Gln Ser Asn465
470 475 480Tyr Ile Glu Asn
Asp Phe Pro Ile Asn Glu Leu Ile Leu Asp Thr Asp485 490
495Leu Ile Ser Lys Ile Glu Leu Pro Ser Glu Asn Thr Glu Ser
Leu Thr500 505 510Asp Phe Asn Val Asp Val
Pro Val Tyr Glu Lys Gln Pro Ala Ile Lys515 520
525Lys Ile Phe Thr Asp Glu Asn Thr Ile Phe Gln Tyr Leu Tyr Ser
Gln530 535 540Thr Phe Pro Leu Asp Ile Arg
Asp Ile Ser Leu Thr Ser Ser Phe Asp545 550
555 560Asp Ala Leu Leu Phe Ser Asn Lys Val Tyr Ser Phe
Phe Ser Met Asp565 570 575Tyr Ile Lys Thr
Ala Asn Lys Val Val Glu Ala Gly Leu Phe Ala Gly580 585
590Trp Val Lys Gln Ile Val Asn Asp Phe Val Ile Glu Ala Asn
Lys Ser595 600 605Asn Thr Met Asp Lys Ile
Ala Asp Ile Ser Leu Ile Val Pro Tyr Ile610 615
620Gly Leu Ala Leu Asn Val Gly Asn Glu Thr Ala Lys Gly Asn Phe
Glu625 630 635 640Asn Ala
Phe Glu Ile Ala Gly Ala Ser Ile Leu Leu Glu Phe Ile Pro645
650 655Glu Leu Leu Ile Pro Val Val Gly Ala Phe Leu Leu
Glu Ser Tyr Ile660 665 670Asp Asn Lys Asn
Lys Ile Ile Lys Thr Ile Asp Asn Ala Leu Thr Lys675 680
685Arg Asn Glu Lys Trp Ser Asp Met Tyr Gly Leu Ile Val Ala
Gln Trp690 695 700Leu Ser Thr Val Asn Thr
Gln Phe Tyr Thr Ile Lys Glu Gly Met Tyr705 710
715 720Lys Ala Leu Asn Tyr Gln Ala Gln Ala Leu Glu
Glu Ile Ile Lys Tyr725 730 735Arg Tyr Asn
Ile Tyr Ser Glu Lys Glu Lys Ser Asn Ile Asn Ile Asp740
745 750Phe Asn Asp Ile Asn Ser Lys Leu Asn Glu Gly Ile
Asn Gln Ala Ile755 760 765Asp Asn Ile Asn
Asn Phe Ile Asn Gly Cys Ser Val Ser Tyr Leu Met770 775
780Lys Lys Met Ile Pro Leu Ala Val Glu Lys Leu Leu Asp Phe
Asp Asn785 790 795 800Thr
Leu Lys Lys Asn Leu Leu Asn Tyr Ile Asp Glu Asn Lys Leu Tyr805
810 815Leu Ile Gly Ser Ala Glu Tyr Glu Lys Ser Lys
Val Asn Lys Tyr Leu820 825 830Lys Thr Ile
Met Pro Phe Asp Leu Ser Ile Tyr Thr Asn Asp Thr Ile835
840 845Leu Ile Glu Met Phe Asn Lys Tyr Asn Ser Glu Ile
Leu Asn Asn Ile850 855 860Ile Leu Asn Leu
Arg Tyr Lys Asp Asn Asn Leu Ile Asp Leu Ser Gly865 870
875 880Tyr Gly Ala Lys Val Glu Val Tyr Asp
Gly Val Glu Leu Asn Asp Lys885 890 895Asn
Gln Phe Lys Leu Thr Ser Ser Ala Asn Ser Lys Ile Arg Val Thr900
905 910Gln Asn Gln Asn Ile Ile Phe Asn Ser Val Phe
Leu Asp Phe Ser Val915 920 925Ser Phe Trp
Ile Arg Ile Pro Lys Tyr Lys Asn Asp Gly Ile Gln Asn930
935 940Tyr Ile His Asn Glu Tyr Thr Ile Ile Asn Cys Met
Lys Asn Asn Ser945 950 955
960Gly Trp Lys Ile Ser Ile Arg Gly Asn Arg Ile Ile Trp Thr Leu Ile965
970 975Asp Ile Asn Gly Lys Thr Lys Ser Val
Phe Phe Glu Tyr Asn Ile Arg980 985 990Glu
Asp Ile Ser Glu Tyr Ile Asn Arg Trp Phe Phe Val Thr Ile Thr995
1000 1005Asn Asn Leu Asn Asn Ala Lys Ile Tyr Ile Asn
Gly Lys Leu Glu Ser1010 1015 1020Asn Thr
Asp Ile Lys Asp Ile Arg Glu Val Ile Ala Asn Gly Glu Ile1025
1030 1035 1040Ile Phe Lys Leu Asp Gly Asp
Ile Asp Arg Thr Gln Phe Ile Trp Met1045 1050
1055Lys Tyr Phe Ser Ile Phe Asn Thr Glu Leu Ser Gln Ser Asn Ile Glu1060
1065 1070Glu Arg Tyr Lys Ile Gln Ser Tyr Ser
Glu Tyr Leu Lys Asp Phe Trp1075 1080
1085Gly Asn Pro Leu Met Tyr Asn Lys Glu Tyr Tyr Met Phe Asn Ala Gly1090
1095 1100Asn Lys Asn Ser Tyr Ile Lys Leu Lys
Lys Asp Ser Pro Val Gly Glu1105 1110 1115
1120Ile Leu Thr Arg Ser Lys Tyr Asn Gln Asn Ser Lys Tyr Ile
Asn Tyr1125 1130 1135Arg Asp Leu Tyr Ile
Gly Glu Lys Phe Ile Ile Arg Arg Lys Ser Asn1140 1145
1150Ser Gln Ser Ile Asn Asp Asp Ile Val Arg Lys Glu Asp Tyr Ile
Tyr1155 1160 1165Leu Asp Phe Phe Asn Leu
Asn Gln Glu Trp Arg Val Tyr Thr Tyr Lys1170 1175
1180Tyr Phe Lys Lys Glu Glu Glu Lys Leu Phe Leu Ala Pro Ile Ser
Asp1185 1190 1195 1200Ser
Asp Glu Phe Tyr Asn Thr Ile Gln Ile Lys Glu Tyr Asp Glu Gln1205
1210 1215Pro Thr Tyr Ser Cys Gln Leu Leu Phe Lys Lys
Asp Glu Glu Ser Thr1220 1225 1230Asp Glu
Ile Gly Leu Ile Gly Ile His Arg Phe Tyr Glu Ser Gly Ile1235
1240 1245Val Phe Glu Glu Tyr Lys Asp Tyr Phe Cys Ile Ser
Lys Trp Tyr Leu1250 1255 1260Lys Glu Val
Lys Arg Lys Pro Tyr Asn Leu Lys Leu Gly Cys Asn Trp1265
1270 1275 1280Gln Phe Ile Pro Lys Asp Glu
Gly Trp Thr Glu1285 129031291PRTClostridium botulinum
Serotype C1DOMAIN(1)...(449)Light chain comprising the enzymatic domain.
3Met Pro Ile Thr Ile Asn Asn Phe Asn Tyr Ser Asp Pro Val Asp Asn1
5 10 15Lys Asn Ile Leu Tyr Leu
Asp Thr His Leu Asn Thr Leu Ala Asn Glu20 25
30Pro Glu Lys Ala Phe Arg Ile Thr Gly Asn Ile Trp Val Ile Pro Asp35
40 45Arg Phe Ser Arg Asn Ser Asn Pro Asn
Leu Asn Lys Pro Pro Arg Val50 55 60Thr
Ser Pro Lys Ser Gly Tyr Tyr Asp Pro Asn Tyr Leu Ser Thr Asp65
70 75 80Ser Asp Lys Asp Pro Phe
Leu Lys Glu Ile Ile Lys Leu Phe Lys Arg85 90
95Ile Asn Ser Arg Glu Ile Gly Glu Glu Leu Ile Tyr Arg Leu Ser Thr100
105 110Asp Ile Pro Phe Pro Gly Asn Asn
Asn Thr Pro Ile Asn Thr Phe Asp115 120
125Phe Asp Val Asp Phe Asn Ser Val Asp Val Lys Thr Arg Gln Gly Asn130
135 140Asn Trp Val Lys Thr Gly Ser Ile Asn
Pro Ser Val Ile Ile Thr Gly145 150 155
160Pro Arg Glu Asn Ile Ile Asp Pro Glu Thr Ser Thr Phe Lys
Leu Thr165 170 175Asn Asn Thr Phe Ala Ala
Gln Glu Gly Phe Gly Ala Leu Ser Ile Ile180 185
190Ser Ile Ser Pro Arg Phe Met Leu Thr Tyr Ser Asn Ala Thr Asn
Asp195 200 205Val Gly Glu Gly Arg Phe Ser
Lys Ser Glu Phe Cys Met Asp Pro Ile210 215
220Leu Ile Leu Met His Glu Leu Asn His Ala Met His Asn Leu Tyr Gly225
230 235 240Ile Ala Ile Pro
Asn Asp Gln Thr Ile Ser Ser Val Thr Ser Asn Ile245 250
255Phe Tyr Ser Gln Tyr Asn Val Lys Leu Glu Tyr Ala Glu Ile
Tyr Ala260 265 270Phe Gly Gly Pro Thr Ile
Asp Leu Ile Pro Lys Ser Ala Arg Lys Tyr275 280
285Phe Glu Glu Lys Ala Leu Asp Tyr Tyr Arg Ser Ile Ala Lys Arg
Leu290 295 300Asn Ser Ile Thr Thr Ala Asn
Pro Ser Ser Phe Asn Lys Tyr Ile Gly305 310
315 320Glu Tyr Lys Gln Lys Leu Ile Arg Lys Tyr Arg Phe
Val Val Glu Ser325 330 335Ser Gly Glu Val
Thr Val Asn Arg Asn Lys Phe Val Glu Leu Tyr Asn340 345
350Glu Leu Thr Gln Ile Phe Thr Glu Phe Asn Tyr Ala Lys Ile
Tyr Asn355 360 365Val Gln Asn Arg Lys Ile
Tyr Leu Ser Asn Val Tyr Thr Pro Val Thr370 375
380Ala Asn Ile Leu Asp Asp Asn Val Tyr Asp Ile Gln Asn Gly Phe
Asn385 390 395 400Ile Pro
Lys Ser Asn Leu Asn Val Leu Phe Met Gly Gln Asn Leu Ser405
410 415Arg Asn Pro Ala Leu Arg Lys Val Asn Pro Glu Asn
Met Leu Tyr Leu420 425 430Phe Thr Lys Phe
Cys His Lys Ala Ile Asp Gly Arg Ser Leu Tyr Asn435 440
445Lys Thr Leu Asp Cys Arg Glu Leu Leu Val Lys Asn Thr Asp
Leu Pro450 455 460Phe Ile Gly Asp Ile Ser
Asp Val Lys Thr Asp Ile Phe Leu Arg Lys465 470
475 480Asp Ile Asn Glu Glu Thr Glu Val Ile Tyr Tyr
Pro Asp Asn Val Ser485 490 495Val Asp Gln
Val Ile Leu Ser Lys Asn Thr Ser Glu His Gly Gln Leu500
505 510Asp Leu Leu Tyr Pro Ser Ile Asp Ser Glu Ser Glu
Ile Leu Pro Gly515 520 525Glu Asn Gln Val
Phe Tyr Asp Asn Arg Thr Gln Asn Val Asp Tyr Leu530 535
540Asn Ser Tyr Tyr Tyr Leu Glu Ser Gln Lys Leu Ser Asp Asn
Val Glu545 550 555 560Asp
Phe Thr Phe Thr Arg Ser Ile Glu Glu Ala Leu Asp Asn Ser Ala565
570 575Lys Val Tyr Thr Tyr Phe Pro Thr Leu Ala Asn
Lys Val Asn Ala Gly580 585 590Val Gln Gly
Gly Leu Phe Leu Met Trp Ala Asn Asp Val Val Glu Asp595
600 605Phe Thr Thr Asn Ile Leu Arg Lys Asp Thr Leu Asp
Lys Ile Ser Asp610 615 620Val Ser Ala Ile
Ile Pro Tyr Ile Gly Pro Ala Leu Asn Ile Ser Asn625 630
635 640Ser Val Arg Arg Gly Asn Phe Thr Glu
Ala Phe Ala Val Thr Gly Val645 650 655Thr
Ile Leu Leu Glu Ala Phe Pro Glu Phe Thr Ile Pro Ala Leu Gly660
665 670Ala Phe Val Ile Tyr Ser Lys Val Gln Glu Arg
Asn Glu Ile Ile Lys675 680 685Thr Ile Asp
Asn Cys Leu Glu Gln Arg Ile Lys Arg Trp Lys Asp Ser690
695 700Tyr Glu Trp Met Met Gly Thr Trp Leu Ser Arg Ile
Ile Thr Gln Phe705 710 715
720Asn Asn Ile Ser Tyr Gln Met Tyr Asp Ser Leu Asn Tyr Gln Ala Gly725
730 735Ala Ile Lys Ala Lys Ile Asp Leu Glu
Tyr Lys Lys Tyr Ser Gly Ser740 745 750Asp
Lys Glu Asn Ile Lys Ser Gln Val Glu Asn Leu Lys Asn Ser Leu755
760 765Asp Val Lys Ile Ser Glu Ala Met Asn Asn Ile
Asn Lys Phe Ile Arg770 775 780Glu Cys Ser
Val Thr Tyr Leu Phe Lys Asn Met Leu Pro Lys Val Ile785
790 795 800Asp Glu Leu Asn Glu Phe Asp
Arg Asn Thr Lys Ala Lys Leu Ile Asn805 810
815Leu Ile Asp Ser His Asn Ile Ile Leu Val Gly Glu Val Asp Lys Leu820
825 830Lys Ala Lys Val Asn Asn Ser Phe Gln
Asn Thr Ile Pro Phe Asn Ile835 840 845Phe
Ser Tyr Thr Asn Asn Ser Leu Leu Lys Asp Ile Ile Asn Glu Tyr850
855 860Phe Asn Asn Ile Asn Asp Ser Lys Ile Leu Ser
Leu Gln Asn Arg Lys865 870 875
880Asn Thr Leu Val Asp Thr Ser Gly Tyr Asn Ala Glu Val Ser Glu
Glu885 890 895Gly Asp Val Gln Leu Asn Pro
Ile Phe Pro Phe Asp Phe Lys Leu Gly900 905
910Ser Ser Gly Glu Asp Arg Gly Lys Val Ile Val Thr Gln Asn Glu Asn915
920 925Ile Val Tyr Asn Ser Met Tyr Glu Ser
Phe Ser Ile Ser Phe Trp Ile930 935 940Arg
Ile Asn Lys Trp Val Ser Asn Leu Pro Gly Tyr Thr Ile Ile Asp945
950 955 960Ser Val Lys Asn Asn Ser
Gly Trp Ser Ile Gly Ile Ile Ser Asn Phe965 970
975Leu Val Phe Thr Leu Lys Gln Asn Glu Asp Ser Glu Gln Ser Ile
Asn980 985 990Phe Ser Tyr Asp Ile Ser Asn
Asn Ala Pro Gly Tyr Asn Lys Trp Phe995 1000
1005Phe Val Thr Val Thr Asn Asn Met Met Gly Asn Met Lys Ile Tyr Ile1010
1015 1020Asn Gly Lys Leu Ile Asp Thr Ile Lys
Val Lys Glu Leu Thr Gly Ile1025 1030 1035
1040Asn Phe Ser Lys Thr Ile Thr Phe Glu Ile Asn Lys Ile Pro
Asp Thr1045 1050 1055Gly Leu Ile Thr Ser
Asp Ser Asp Asn Ile Asn Met Trp Ile Arg Asp1060 1065
1070Phe Tyr Ile Phe Ala Lys Glu Leu Asp Gly Lys Asp Ile Asn Ile
Leu1075 1080 1085Phe Asn Ser Leu Gln Tyr
Thr Asn Val Val Lys Asp Tyr Trp Gly Asn1090 1095
1100Asp Leu Arg Tyr Asn Lys Glu Tyr Tyr Met Val Asn Ile Asp Tyr
Leu1105 1110 1115 1120Asn
Arg Tyr Met Tyr Ala Asn Ser Arg Gln Ile Val Phe Asn Thr Arg1125
1130 1135Arg Asn Asn Asn Asp Phe Asn Glu Gly Tyr Lys
Ile Ile Ile Lys Arg1140 1145 1150Ile Arg
Gly Asn Thr Asn Asp Thr Arg Val Arg Gly Gly Asp Ile Leu1155
1160 1165Tyr Phe Asp Met Thr Ile Asn Asn Lys Ala Tyr Asn
Leu Phe Met Lys1170 1175 1180Asn Glu Thr
Met Tyr Ala Asp Asn His Ser Thr Glu Asp Ile Tyr Ala1185
1190 1195 1200Ile Gly Leu Arg Glu Gln Thr
Lys Asp Ile Asn Asp Asn Ile Ile Phe1205 1210
1215Gln Ile Gln Pro Met Asn Asn Thr Tyr Tyr Tyr Ala Ser Gln Ile Phe1220
1225 1230Lys Ser Asn Phe Asn Gly Glu Asn Ile
Ser Gly Ile Cys Ser Ile Gly1235 1240
1245Thr Tyr Arg Phe Arg Leu Gly Gly Asp Trp Tyr Arg His Asn Tyr Leu1250
1255 1260Val Pro Thr Val Lys Gln Gly Asn Tyr
Ala Ser Leu Leu Glu Ser Thr1265 1270 1275
1280Ser Thr His Trp Gly Phe Val Pro Val Ser Glu1285
129041276PRTClostridium botulinum Serotype DDOMAIN(1)...(442)Light
chain comprising the enzymatic domain. 4Met Thr Trp Pro Val Lys Asp Phe
Asn Tyr Ser Asp Pro Val Asn Asp1 5 10
15Asn Asp Ile Leu Tyr Leu Arg Ile Pro Gln Asn Lys Leu Ile Thr
Thr20 25 30Pro Val Lys Ala Phe Met Ile
Thr Gln Asn Ile Trp Val Ile Pro Glu35 40
45Arg Phe Ser Ser Asp Thr Asn Pro Ser Leu Ser Lys Pro Pro Arg Pro50
55 60Thr Ser Lys Tyr Gln Ser Tyr Tyr Asp Pro
Ser Tyr Leu Ser Thr Asp65 70 75
80Glu Gln Lys Asp Thr Phe Leu Lys Gly Ile Ile Lys Leu Phe Lys
Arg85 90 95Ile Asn Glu Arg Asp Ile Gly
Lys Lys Leu Ile Asn Tyr Leu Val Val100 105
110Gly Ser Pro Phe Met Gly Asp Ser Ser Thr Pro Glu Asp Thr Phe Asp115
120 125Phe Thr Arg His Thr Thr Asn Ile Ala
Val Glu Lys Phe Glu Asn Gly130 135 140Ser
Trp Lys Val Thr Asn Ile Ile Thr Pro Ser Val Leu Ile Phe Gly145
150 155 160Pro Leu Pro Asn Ile Leu
Asp Tyr Thr Ala Ser Leu Thr Leu Gln Gly165 170
175Gln Gln Ser Asn Pro Ser Phe Glu Gly Phe Gly Thr Leu Ser Ile
Leu180 185 190Lys Val Ala Pro Glu Phe Leu
Leu Thr Phe Ser Asp Val Thr Ser Asn195 200
205Gln Ser Ser Ala Val Leu Gly Lys Ser Ile Phe Cys Met Asp Pro Val210
215 220Ile Ala Leu Met His Glu Leu Thr His
Ser Leu His Gln Leu Tyr Gly225 230 235
240Ile Asn Ile Pro Ser Asp Lys Arg Ile Arg Pro Gln Val Ser
Glu Gly245 250 255Phe Phe Ser Gln Asp Gly
Pro Asn Val Gln Phe Glu Glu Leu Tyr Thr260 265
270Phe Gly Gly Leu Asp Val Glu Ile Ile Pro Gln Ile Glu Arg Ser
Gln275 280 285Leu Arg Glu Lys Ala Leu Gly
His Tyr Lys Asp Ile Ala Lys Arg Leu290 295
300Asn Asn Ile Asn Lys Thr Ile Pro Ser Ser Trp Ile Ser Asn Ile Asp305
310 315 320Lys Tyr Lys Lys
Ile Phe Ser Glu Lys Tyr Asn Phe Asp Lys Asp Asn325 330
335Thr Gly Asn Phe Val Val Asn Ile Asp Lys Phe Asn Ser Leu
Tyr Ser340 345 350Asp Leu Thr Asn Val Met
Ser Glu Val Val Tyr Ser Ser Gln Tyr Asn355 360
365Val Lys Asn Arg Thr His Tyr Phe Ser Arg His Tyr Leu Pro Val
Phe370 375 380Ala Asn Ile Leu Asp Asp Asn
Ile Tyr Thr Ile Arg Asp Gly Phe Asn385 390
395 400Leu Thr Asn Lys Gly Phe Asn Ile Glu Asn Ser Gly
Gln Asn Ile Glu405 410 415Arg Asn Pro Ala
Leu Gln Lys Leu Ser Ser Glu Ser Val Val Asp Leu420 425
430Phe Thr Lys Val Cys Leu Arg Leu Thr Lys Asn Ser Arg Asp
Asp Ser435 440 445Thr Cys Ile Lys Val Lys
Asn Asn Arg Leu Pro Tyr Val Ala Asp Lys450 455
460Asp Ser Ile Ser Gln Glu Ile Phe Glu Asn Lys Ile Ile Thr Asp
Glu465 470 475 480Thr Asn
Val Gln Asn Tyr Ser Asp Lys Phe Ser Leu Asp Glu Ser Ile485
490 495Leu Asp Gly Gln Val Pro Ile Asn Pro Glu Ile Val
Asp Pro Leu Leu500 505 510Pro Asn Val Asn
Met Glu Pro Leu Asn Leu Pro Gly Glu Glu Ile Val515 520
525Phe Tyr Asp Asp Ile Thr Lys Tyr Val Asp Tyr Leu Asn Ser
Tyr Tyr530 535 540Tyr Leu Glu Ser Gln Lys
Leu Ser Asn Asn Val Glu Asn Ile Thr Leu545 550
555 560Thr Thr Ser Val Glu Glu Ala Leu Gly Tyr Ser
Asn Lys Ile Tyr Thr565 570 575Phe Leu Pro
Ser Leu Ala Glu Lys Val Asn Lys Gly Val Gln Ala Gly580
585 590Leu Phe Leu Asn Trp Ala Asn Glu Val Val Glu Asp
Phe Thr Thr Asn595 600 605Ile Met Lys Lys
Asp Thr Leu Asp Lys Ile Ser Asp Val Ser Val Ile610 615
620Ile Pro Tyr Ile Gly Pro Ala Leu Asn Ile Gly Asn Ser Ala
Leu Arg625 630 635 640Gly
Asn Phe Asn Gln Ala Phe Ala Thr Ala Gly Val Ala Phe Leu Leu645
650 655Glu Gly Phe Pro Glu Phe Thr Ile Pro Ala Leu
Gly Val Phe Thr Phe660 665 670Tyr Ser Ser
Ile Gln Glu Arg Glu Lys Ile Ile Lys Thr Ile Glu Asn675
680 685Cys Leu Glu Gln Arg Val Lys Arg Trp Lys Asp Ser
Tyr Gln Trp Met690 695 700Val Ser Asn Trp
Leu Ser Arg Ile Thr Thr Gln Phe Asn His Ile Asn705 710
715 720Tyr Gln Met Tyr Asp Ser Leu Ser Tyr
Gln Ala Asp Ala Ile Lys Ala725 730 735Lys
Ile Asp Leu Glu Tyr Lys Lys Tyr Ser Gly Ser Asp Lys Glu Asn740
745 750Ile Lys Ser Gln Val Glu Asn Leu Lys Asn Ser
Leu Asp Val Lys Ile755 760 765Ser Glu Ala
Met Asn Asn Ile Asn Lys Phe Ile Arg Glu Cys Ser Val770
775 780Thr Tyr Leu Phe Lys Asn Met Leu Pro Lys Val Ile
Asp Glu Leu Asn785 790 795
800Lys Phe Asp Leu Arg Thr Lys Thr Glu Leu Ile Asn Leu Ile Asp Ser805
810 815His Asn Ile Ile Leu Val Gly Glu Val
Asp Arg Leu Lys Ala Lys Val820 825 830Asn
Glu Ser Phe Glu Asn Thr Met Pro Phe Asn Ile Phe Ser Tyr Thr835
840 845Asn Asn Ser Leu Leu Lys Asp Ile Ile Asn Glu
Tyr Phe Asn Ser Ile850 855 860Asn Asp Ser
Lys Ile Leu Ser Leu Gln Asn Lys Lys Asn Ala Leu Val865
870 875 880Asp Thr Ser Gly Tyr Asn Ala
Glu Val Arg Val Gly Asp Asn Val Gln885 890
895Leu Asn Thr Ile Tyr Thr Asn Asp Phe Lys Leu Ser Ser Ser Gly Asp900
905 910Lys Ile Ile Val Asn Leu Asn Asn Asn
Ile Leu Tyr Ser Ala Ile Tyr915 920 925Glu
Asn Ser Ser Val Ser Phe Trp Ile Lys Ile Ser Lys Asp Leu Thr930
935 940Asn Ser His Asn Glu Tyr Thr Ile Ile Asn Ser
Ile Glu Gln Asn Ser945 950 955
960Gly Trp Lys Leu Cys Ile Arg Asn Gly Asn Ile Glu Trp Ile Leu
Gln965 970 975Asp Val Asn Arg Lys Tyr Lys
Ser Leu Ile Phe Asp Tyr Ser Glu Ser980 985
990Leu Ser His Thr Gly Tyr Thr Asn Lys Trp Phe Phe Val Thr Ile Thr995
1000 1005Asn Asn Ile Met Gly Tyr Met Lys Leu
Tyr Ile Asn Gly Glu Leu Lys1010 1015
1020Gln Ser Gln Lys Ile Glu Asp Leu Asp Glu Val Lys Leu Asp Lys Thr1025
1030 1035 1040Ile Val Phe Gly
Ile Asp Glu Asn Ile Asp Glu Asn Gln Met Leu Trp1045 1050
1055Ile Arg Asp Phe Asn Ile Phe Ser Lys Glu Leu Ser Asn Glu
Asp Ile1060 1065 1070Asn Ile Val Tyr Glu
Gly Gln Ile Leu Arg Asn Val Ile Lys Asp Tyr1075 1080
1085Trp Gly Asn Pro Leu Lys Phe Asp Thr Glu Tyr Tyr Ile Ile Asn
Asp1090 1095 1100Asn Tyr Ile Asp Arg Tyr
Ile Ala Pro Glu Ser Asn Val Leu Val Leu1105 1110
1115 1120Val Gln Tyr Pro Asp Arg Ser Lys Leu Tyr Thr
Gly Asn Pro Ile Thr1125 1130 1135Ile Lys
Ser Val Ser Asp Lys Asn Pro Tyr Ser Arg Ile Leu Asn Gly1140
1145 1150Asp Asn Ile Ile Leu His Met Leu Tyr Asn Ser Arg
Lys Tyr Met Ile1155 1160 1165Ile Arg Asp
Thr Asp Thr Ile Tyr Ala Thr Gln Gly Gly Glu Cys Ser1170
1175 1180Gln Asn Cys Val Tyr Ala Leu Lys Leu Gln Ser Asn
Leu Gly Asn Tyr1185 1190 1195
1200Gly Ile Gly Ile Phe Ser Ile Lys Asn Ile Val Ser Lys Asn Lys Tyr1205
1210 1215Cys Ser Gln Ile Phe Ser Ser Phe Arg
Glu Asn Thr Met Leu Leu Ala1220 1225
1230Asp Ile Tyr Lys Pro Trp Arg Phe Ser Phe Lys Asn Ala Tyr Thr Pro1235
1240 1245Val Ala Val Thr Asn Tyr Glu Thr Lys
Leu Leu Ser Thr Ser Ser Phe1250 1255
1260Trp Lys Phe Ile Ser Arg Asp Pro Gly Trp Val Glu1265
1270 127551252PRTClostridium botulinum Serotype
EDOMAIN(1)...(422)Light chain comprising the enzymatic domain. 5Met Pro
Lys Ile Asn Ser Phe Asn Tyr Asn Asp Pro Val Asn Asp Arg1 5
10 15Thr Ile Leu Tyr Ile Lys Pro Gly Gly
Cys Gln Glu Phe Tyr Lys Ser20 25 30Phe
Asn Ile Met Lys Asn Ile Trp Ile Ile Pro Glu Arg Asn Val Ile35
40 45Gly Thr Thr Pro Gln Asp Phe His Pro Pro Thr
Ser Leu Lys Asn Gly50 55 60Asp Ser Ser
Tyr Tyr Asp Pro Asn Tyr Leu Gln Ser Asp Glu Glu Lys65 70
75 80Asp Arg Phe Leu Lys Ile Val Thr
Lys Ile Phe Asn Arg Ile Asn Asn85 90
95Asn Leu Ser Gly Gly Ile Leu Leu Glu Glu Leu Ser Lys Ala Asn Pro100
105 110Tyr Leu Gly Asn Asp Asn Thr Pro Asp Asn
Gln Phe His Ile Gly Asp115 120 125Ala Ser
Ala Val Glu Ile Lys Phe Ser Asn Gly Ser Gln Asp Ile Leu130
135 140Leu Pro Asn Val Ile Ile Met Gly Ala Glu Pro Asp
Leu Phe Glu Thr145 150 155
160Asn Ser Ser Asn Ile Ser Leu Arg Asn Asn Tyr Met Pro Ser Asn His165
170 175Gly Phe Gly Ser Ile Ala Ile Val Thr
Phe Ser Pro Glu Tyr Ser Phe180 185 190Arg
Phe Asn Asp Asn Ser Met Asn Glu Phe Ile Gln Asp Pro Ala Leu195
200 205Thr Leu Met His Glu Leu Ile His Ser Leu His
Gly Leu Tyr Gly Ala210 215 220Lys Gly Ile
Thr Thr Lys Tyr Thr Ile Thr Gln Lys Gln Asn Pro Leu225
230 235 240Ile Thr Asn Ile Arg Gly Thr
Asn Ile Glu Glu Phe Leu Thr Phe Gly245 250
255Gly Thr Asp Leu Asn Ile Ile Thr Ser Ala Gln Ser Asn Asp Ile Tyr260
265 270Thr Asn Leu Leu Ala Asp Tyr Lys Lys
Ile Ala Ser Lys Leu Ser Lys275 280 285Val
Gln Val Ser Asn Pro Leu Leu Asn Pro Tyr Lys Asp Val Phe Glu290
295 300Ala Lys Tyr Gly Leu Asp Lys Asp Ala Ser Gly
Ile Tyr Ser Val Asn305 310 315
320Ile Asn Lys Phe Asn Asp Ile Phe Lys Lys Leu Tyr Ser Phe Thr
Glu325 330 335Phe Asp Leu Ala Thr Lys Phe
Gln Val Lys Cys Arg Gln Thr Tyr Ile340 345
350Gly Gln Tyr Lys Tyr Phe Lys Leu Ser Asn Leu Leu Asn Asp Ser Ile355
360 365Tyr Asn Ile Ser Glu Gly Tyr Asn Ile
Asn Asn Leu Lys Val Asn Phe370 375 380Arg
Gly Gln Asn Ala Asn Leu Asn Pro Arg Ile Ile Thr Pro Ile Thr385
390 395 400Gly Arg Gly Leu Val Lys
Lys Ile Ile Arg Phe Cys Lys Asn Ile Val405 410
415Ser Val Lys Gly Ile Arg Lys Ser Ile Cys Ile Glu Ile Asn Asn
Gly420 425 430Glu Leu Phe Phe Val Ala Ser
Glu Asn Ser Tyr Asn Asp Asp Asn Ile435 440
445Asn Thr Pro Lys Glu Ile Asp Asp Thr Val Thr Ser Asn Asn Asn Tyr450
455 460Glu Asn Asp Leu Asp Gln Val Ile Leu
Asn Phe Asn Ser Glu Ser Ala465 470 475
480Pro Gly Leu Ser Asp Glu Lys Leu Asn Leu Thr Ile Gln Asn
Asp Ala485 490 495Tyr Ile Pro Lys Tyr Asp
Ser Asn Gly Thr Ser Asp Ile Glu Gln His500 505
510Asp Val Asn Glu Leu Asn Val Phe Phe Tyr Leu Asp Ala Gln Lys
Val515 520 525Pro Glu Gly Glu Asn Asn Val
Asn Leu Thr Ser Ser Ile Asp Thr Ala530 535
540Leu Leu Glu Gln Pro Lys Ile Tyr Thr Phe Phe Ser Ser Glu Phe Ile545
550 555 560Asn Asn Val Asn
Lys Pro Val Gln Ala Ala Leu Phe Val Ser Trp Ile565 570
575Gln Gln Val Leu Val Asp Phe Thr Thr Glu Ala Asn Gln Lys
Ser Thr580 585 590Val Asp Lys Ile Ala Asp
Ile Ser Ile Val Val Pro Tyr Ile Gly Leu595 600
605Ala Leu Asn Ile Gly Asn Glu Ala Gln Lys Gly Asn Phe Lys Asp
Ala610 615 620Leu Glu Leu Leu Gly Ala Gly
Ile Leu Leu Glu Phe Glu Pro Glu Leu625 630
635 640Leu Ile Pro Thr Ile Leu Val Phe Thr Ile Lys Ser
Phe Leu Gly Ser645 650 655Ser Asp Asn Lys
Asn Lys Val Ile Lys Ala Ile Asn Asn Ala Leu Lys660 665
670Glu Arg Asp Glu Lys Trp Lys Glu Val Tyr Ser Phe Ile Val
Ser Asn675 680 685Trp Met Thr Lys Ile Asn
Thr Gln Phe Asn Lys Arg Lys Glu Gln Met690 695
700Tyr Gln Ala Leu Gln Asn Gln Val Asn Ala Ile Lys Thr Ile Ile
Glu705 710 715 720Ser Lys
Tyr Asn Ser Tyr Thr Leu Glu Glu Lys Asn Glu Leu Thr Asn725
730 735Lys Tyr Asp Ile Lys Gln Ile Glu Asn Glu Leu Asn
Gln Lys Val Ser740 745 750Ile Ala Met Asn
Asn Ile Asp Arg Phe Leu Thr Glu Ser Ser Ile Ser755 760
765Tyr Leu Met Lys Leu Ile Asn Glu Val Lys Ile Asn Lys Leu
Arg Glu770 775 780Tyr Asp Glu Asn Val Lys
Thr Tyr Leu Leu Asn Tyr Ile Ile Gln His785 790
795 800Gly Ser Ile Leu Gly Glu Ser Gln Gln Glu Leu
Asn Ser Met Val Thr805 810 815Asp Thr Leu
Asn Asn Ser Ile Pro Phe Lys Leu Ser Ser Tyr Thr Asp820
825 830Asp Lys Ile Leu Ile Ser Tyr Phe Asn Lys Phe Phe
Lys Arg Ile Lys835 840 845Ser Ser Ser Val
Leu Asn Met Arg Tyr Lys Asn Asp Lys Tyr Val Asp850 855
860Thr Ser Gly Tyr Asp Ser Asn Ile Asn Ile Asn Gly Asp Val
Tyr Lys865 870 875 880Tyr
Pro Thr Asn Lys Asn Gln Phe Gly Ile Tyr Asn Asp Lys Leu Ser885
890 895Glu Val Asn Ile Ser Gln Asn Asp Tyr Ile Ile
Tyr Asp Asn Lys Tyr900 905 910Lys Asn Phe
Ser Ile Ser Phe Trp Val Arg Ile Pro Asn Tyr Asp Asn915
920 925Lys Ile Val Asn Val Asn Asn Glu Tyr Thr Ile Ile
Asn Cys Met Arg930 935 940Asp Asn Asn Ser
Gly Trp Lys Val Ser Leu Asn His Asn Glu Ile Ile945 950
955 960Trp Thr Leu Gln Asp Asn Ala Gly Ile
Asn Gln Lys Leu Ala Phe Asn965 970 975Tyr
Gly Asn Ala Asn Gly Ile Ser Asp Tyr Ile Asn Lys Trp Ile Phe980
985 990Val Thr Ile Thr Asn Asp Arg Leu Gly Asp Ser
Lys Leu Tyr Ile Asn995 1000 1005Gly Asn
Leu Ile Asp Gln Lys Ser Ile Leu Asn Leu Gly Asn Ile His1010
1015 1020Val Ser Asp Asn Ile Leu Phe Lys Ile Val Asn Cys
Ser Tyr Thr Arg1025 1030 1035
1040Tyr Ile Gly Ile Arg Tyr Phe Asn Ile Phe Asp Lys Glu Leu Asp Glu1045
1050 1055Thr Glu Ile Gln Thr Leu Tyr Ser Asn
Glu Pro Asn Thr Asn Ile Leu1060 1065
1070Lys Asp Phe Trp Gly Asn Tyr Leu Leu Tyr Asp Lys Glu Tyr Tyr Leu1075
1080 1085Leu Asn Val Leu Lys Pro Asn Asn Phe
Ile Asp Arg Arg Lys Asp Ser1090 1095
1100Thr Leu Ser Ile Asn Asn Ile Arg Ser Thr Ile Leu Leu Ala Asn Arg1105
1110 1115 1120Leu Tyr Ser Gly
Ile Lys Val Lys Ile Gln Arg Val Asn Asn Ser Ser1125 1130
1135Thr Asn Asp Asn Leu Val Arg Lys Asn Asp Gln Val Tyr Ile
Asn Phe1140 1145 1150Val Ala Ser Lys Thr
His Leu Phe Pro Leu Tyr Ala Asp Thr Ala Thr1155 1160
1165Thr Asn Lys Glu Lys Thr Ile Lys Ile Ser Ser Ser Gly Asn Arg
Phe1170 1175 1180Asn Gln Val Val Val Met
Asn Ser Val Gly Asn Asn Cys Thr Met Asn1185 1190
1195 1200Phe Lys Asn Asn Asn Gly Asn Asn Ile Gly Leu
Leu Gly Phe Lys Ala1205 1210 1215Asp Thr
Val Val Ala Ser Thr Trp Tyr Tyr Thr His Met Arg Asp His1220
1225 1230Thr Asn Ser Asn Gly Cys Phe Trp Asn Phe Ile Ser
Glu Glu His Gly1235 1240 1245Trp Gln Glu
Lys125061274PRTClostridium botulinum Serotype FDOMAIN(1)...(436)Light
chain comprising the enzymatic domain. 6Met Pro Val Ala Ile Asn Ser Phe
Asn Tyr Asn Asp Pro Val Asn Asp1 5 10
15Asp Thr Ile Leu Tyr Met Gln Ile Pro Tyr Glu Glu Lys Ser Lys
Lys20 25 30Tyr Tyr Lys Ala Phe Glu Ile
Met Arg Asn Val Trp Ile Ile Pro Glu35 40
45Arg Asn Thr Ile Gly Thr Asn Pro Ser Asp Phe Asp Pro Pro Ala Ser50
55 60Leu Lys Asn Gly Ser Ser Ala Tyr Tyr Asp
Pro Asn Tyr Leu Thr Thr65 70 75
80Asp Ala Glu Lys Asp Arg Tyr Leu Lys Thr Thr Ile Lys Leu Phe
Lys85 90 95Arg Ile Asn Ser Asn Pro Ala
Gly Lys Val Leu Leu Gln Glu Ile Ser100 105
110Tyr Ala Lys Pro Tyr Leu Gly Asn Asp His Thr Pro Ile Asp Glu Phe115
120 125Ser Pro Val Thr Arg Thr Thr Ser Val
Asn Ile Lys Leu Ser Thr Asn130 135 140Val
Glu Ser Ser Met Leu Leu Asn Leu Leu Val Leu Gly Ala Gly Pro145
150 155 160Asp Ile Phe Glu Ser Cys
Cys Tyr Pro Val Arg Lys Leu Ile Asp Pro165 170
175Asp Val Val Tyr Asp Pro Ser Asn Tyr Gly Phe Gly Ser Ile Asn
Ile180 185 190Val Thr Phe Ser Pro Glu Tyr
Glu Tyr Thr Phe Asn Asp Ile Ser Gly195 200
205Gly His Asn Ser Ser Thr Glu Ser Phe Ile Ala Asp Pro Ala Ile Ser210
215 220Leu Ala His Glu Leu Ile His Ala Leu
His Gly Leu Tyr Gly Ala Arg225 230 235
240Gly Val Thr Tyr Glu Glu Thr Ile Glu Val Lys Gln Ala Pro
Leu Met245 250 255Ile Ala Glu Lys Pro Ile
Arg Leu Glu Glu Phe Leu Thr Phe Gly Gly260 265
270Gln Asp Leu Asn Ile Ile Thr Ser Ala Met Lys Glu Lys Ile Tyr
Asn275 280 285Asn Leu Leu Ala Asn Tyr Glu
Lys Ile Ala Thr Arg Leu Ser Glu Val290 295
300Asn Ser Ala Pro Pro Glu Tyr Asp Ile Asn Glu Tyr Lys Asp Tyr Phe305
310 315 320Gln Trp Lys Tyr
Gly Leu Asp Lys Asn Ala Asp Gly Ser Tyr Thr Val325 330
335Asn Glu Asn Lys Phe Asn Glu Ile Tyr Lys Lys Leu Tyr Ser
Phe Thr340 345 350Glu Ser Asp Leu Ala Asn
Lys Phe Lys Val Lys Cys Arg Asn Thr Tyr355 360
365Phe Ile Lys Tyr Glu Phe Leu Lys Val Pro Asn Leu Leu Asp Asp
Asp370 375 380Ile Tyr Thr Val Ser Glu Gly
Phe Asn Ile Gly Asn Leu Ala Val Asn385 390
395 400Asn Arg Gly Gln Ser Ile Lys Leu Asn Pro Lys Ile
Ile Asp Ser Ile405 410 415Pro Asp Lys Gly
Leu Val Glu Lys Ile Val Lys Phe Cys Lys Ser Val420 425
430Ile Pro Arg Lys Gly Thr Lys Ala Pro Pro Arg Leu Cys Ile
Arg Val435 440 445Asn Asn Ser Glu Leu Phe
Phe Val Ala Ser Glu Ser Ser Tyr Asn Glu450 455
460Asn Asp Ile Asn Thr Pro Lys Glu Ile Asp Asp Thr Thr Asn Leu
Asn465 470 475 480Asn Asn
Tyr Arg Asn Asn Leu Asp Glu Val Ile Leu Asp Tyr Asn Ser485
490 495Gln Thr Ile Pro Gln Ile Ser Asn Arg Thr Leu Asn
Thr Leu Val Gln500 505 510Asp Asn Ser Tyr
Val Pro Arg Tyr Asp Ser Asn Gly Thr Ser Glu Ile515 520
525Glu Glu Tyr Asp Val Val Asp Phe Asn Val Phe Phe Tyr Leu
His Ala530 535 540Gln Lys Val Pro Glu Gly
Glu Thr Asn Ile Ser Leu Thr Ser Ser Ile545 550
555 560Asp Thr Ala Leu Leu Glu Glu Ser Lys Asp Ile
Phe Phe Ser Ser Glu565 570 575Phe Ile Asp
Thr Ile Asn Lys Pro Val Asn Ala Ala Leu Phe Ile Asp580
585 590Trp Ile Ser Lys Val Ile Arg Asp Phe Thr Thr Glu
Ala Thr Gln Lys595 600 605Ser Thr Val Asp
Lys Ile Ala Asp Ile Ser Leu Ile Val Pro Tyr Val610 615
620Gly Leu Ala Leu Asn Ile Ile Ile Glu Ala Glu Lys Gly Asn
Phe Glu625 630 635 640Glu
Ala Phe Glu Leu Leu Gly Val Gly Ile Leu Leu Glu Phe Val Pro645
650 655Glu Leu Thr Ile Pro Val Ile Leu Val Phe Thr
Ile Lys Ser Tyr Ile660 665 670Asp Ser Tyr
Glu Asn Lys Asn Lys Ala Ile Lys Ala Ile Asn Asn Ser675
680 685Leu Ile Glu Arg Glu Ala Lys Trp Lys Glu Ile Tyr
Ser Trp Ile Val690 695 700Ser Asn Trp Leu
Thr Arg Ile Asn Thr Gln Phe Asn Lys Arg Lys Glu705 710
715 720Gln Met Tyr Gln Ala Leu Gln Asn Gln
Val Asp Ala Ile Lys Thr Ala725 730 735Ile
Glu Tyr Lys Tyr Asn Asn Tyr Thr Ser Asp Glu Lys Asn Arg Leu740
745 750Glu Ser Glu Tyr Asn Ile Asn Asn Ile Glu Glu
Glu Leu Asn Lys Lys755 760 765Val Ser Leu
Ala Met Lys Asn Ile Glu Arg Phe Met Thr Glu Ser Ser770
775 780Ile Ser Tyr Leu Met Lys Leu Ile Asn Glu Ala Lys
Val Gly Lys Leu785 790 795
800Lys Lys Tyr Asp Asn His Val Lys Ser Asp Leu Leu Asn Tyr Ile Leu805
810 815Asp His Arg Ser Ile Leu Gly Glu Gln
Thr Asn Glu Leu Ser Asp Leu820 825 830Val
Thr Ser Thr Leu Asn Ser Ser Ile Pro Phe Glu Leu Ser Ser Tyr835
840 845Thr Asn Asp Lys Ile Leu Ile Ile Tyr Phe Asn
Arg Leu Tyr Lys Lys850 855 860Ile Lys Asp
Ser Ser Ile Leu Asp Met Arg Tyr Glu Asn Asn Lys Phe865
870 875 880Ile Asp Ile Ser Gly Tyr Gly
Ser Asn Ile Ser Ile Asn Gly Asn Val885 890
895Tyr Ile Tyr Ser Thr Asn Arg Asn Gln Phe Gly Ile Tyr Asn Ser Arg900
905 910Leu Ser Glu Val Asn Ile Ala Gln Asn
Asn Asp Ile Ile Tyr Asn Ser915 920 925Arg
Tyr Gln Asn Phe Ser Ile Ser Phe Trp Val Arg Ile Pro Lys His930
935 940Tyr Lys Pro Met Asn His Asn Arg Glu Tyr Thr
Ile Ile Asn Cys Met945 950 955
960Gly Asn Asn Asn Ser Gly Trp Lys Ile Ser Leu Arg Thr Val Arg
Asp965 970 975Cys Glu Ile Ile Trp Thr Leu
Gln Asp Thr Ser Gly Asn Lys Glu Asn980 985
990Leu Ile Phe Arg Tyr Glu Glu Leu Asn Arg Ile Ser Asn Tyr Ile Asn995
1000 1005Lys Trp Ile Phe Val Thr Ile Thr Asn
Asn Arg Leu Gly Asn Ser Arg1010 1015
1020Ile Tyr Ile Asn Gly Asn Leu Ile Val Glu Lys Ser Ile Ser Asn Leu1025
1030 1035 1040Gly Asp Ile His
Val Ser Asp Asn Ile Leu Phe Lys Ile Val Gly Cys1045 1050
1055Asp Asp Glu Thr Tyr Val Gly Ile Arg Tyr Phe Lys Val Phe
Asn Thr1060 1065 1070Glu Leu Asp Lys Thr
Glu Ile Glu Thr Leu Tyr Ser Asn Glu Pro Asp1075 1080
1085Pro Ser Ile Leu Lys Asn Tyr Trp Gly Asn Tyr Leu Leu Tyr Asn
Lys1090 1095 1100Lys Tyr Tyr Leu Phe Asn
Leu Leu Arg Lys Asp Lys Tyr Ile Thr Leu1105 1110
1115 1120Asn Ser Gly Ile Leu Asn Ile Asn Gln Gln Arg
Gly Val Thr Glu Gly1125 1130 1135Ser Val
Phe Leu Asn Tyr Lys Leu Tyr Glu Gly Val Glu Val Ile Ile1140
1145 1150Arg Lys Asn Gly Pro Ile Asp Ile Ser Asn Thr Asp
Asn Phe Val Arg1155 1160 1165Lys Asn Asp
Leu Ala Tyr Ile Asn Val Val Asp Arg Gly Val Glu Tyr1170
1175 1180Arg Leu Tyr Ala Asp Thr Lys Ser Glu Lys Glu Lys
Ile Ile Arg Thr1185 1190 1195
1200Ser Asn Leu Asn Asp Ser Leu Gly Gln Ile Ile Val Met Asp Ser Ile1205
1210 1215Gly Asn Asn Cys Thr Met Asn Phe Gln
Asn Asn Asn Gly Ser Asn Ile1220 1225
1230Gly Leu Leu Gly Phe His Ser Asn Asn Leu Val Ala Ser Ser Trp Tyr1235
1240 1245Tyr Asn Asn Ile Arg Arg Asn Thr Ser
Ser Asn Gly Cys Phe Trp Ser1250 1255
1260Ser Ile Ser Lys Glu Asn Gly Trp Lys Glu1265
127071297PRTClostridium botulinum Serotype GDOMAIN(1)...(442)Light chain
comprising the enzymatic domain. 7Met Pro Val Asn Ile Lys Asn Phe Asn Tyr
Asn Asp Pro Ile Asn Asn1 5 10
15Asp Asp Ile Ile Met Met Glu Pro Phe Asn Asp Pro Gly Pro Gly Thr20
25 30Tyr Tyr Lys Ala Phe Arg Ile Ile Asp
Arg Ile Trp Ile Val Pro Glu35 40 45Arg
Phe Thr Tyr Gly Phe Gln Pro Asp Gln Phe Asn Ala Ser Thr Gly50
55 60Val Phe Ser Lys Asp Val Tyr Glu Tyr Tyr Asp
Pro Thr Tyr Leu Lys65 70 75
80Thr Asp Ala Glu Lys Asp Lys Phe Leu Lys Thr Met Ile Lys Leu Phe85
90 95Asn Arg Ile Asn Ser Lys Pro Ser Gly
Gln Arg Leu Leu Asp Met Ile100 105 110Val
Asp Ala Ile Pro Tyr Leu Gly Asn Ala Ser Thr Pro Pro Asp Lys115
120 125Phe Ala Ala Asn Val Ala Asn Val Ser Ile Asn
Lys Lys Ile Ile Gln130 135 140Pro Gly Ala
Glu Asp Gln Ile Lys Gly Leu Met Thr Asn Leu Ile Ile145
150 155 160Phe Gly Pro Gly Pro Val Leu
Ser Asp Asn Phe Thr Asp Ser Met Ile165 170
175Met Asn Gly His Ser Pro Ile Ser Glu Gly Phe Gly Ala Arg Met Met180
185 190Ile Arg Phe Cys Pro Ser Cys Leu Asn
Val Phe Asn Asn Val Gln Glu195 200 205Asn
Lys Asp Thr Ser Ile Phe Ser Arg Arg Ala Tyr Phe Ala Asp Pro210
215 220Ala Leu Thr Leu Met His Glu Leu Ile His Val
Leu His Gly Leu Tyr225 230 235
240Gly Ile Lys Ile Ser Asn Leu Pro Ile Thr Pro Asn Thr Lys Glu
Phe245 250 255Phe Met Gln His Ser Asp Pro
Val Gln Ala Glu Glu Leu Tyr Thr Phe260 265
270Gly Gly His Asp Pro Ser Val Ile Ser Pro Ser Thr Asp Met Asn Ile275
280 285Tyr Asn Lys Ala Leu Gln Asn Phe Gln
Asp Ile Ala Asn Arg Leu Asn290 295 300Ile
Val Ser Ser Ala Gln Gly Ser Gly Ile Asp Ile Ser Leu Tyr Lys305
310 315 320Gln Ile Tyr Lys Asn Lys
Tyr Asp Phe Val Glu Asp Pro Asn Gly Lys325 330
335Tyr Ser Val Asp Lys Asp Lys Phe Asp Lys Leu Tyr Lys Ala Leu
Met340 345 350Phe Gly Phe Thr Glu Thr Asn
Leu Ala Gly Glu Tyr Gly Ile Lys Thr355 360
365Arg Tyr Ser Tyr Phe Ser Glu Tyr Leu Pro Pro Ile Lys Thr Glu Lys370
375 380Leu Leu Asp Asn Thr Ile Tyr Thr Gln
Asn Glu Gly Phe Asn Ile Ala385 390 395
400Ser Lys Asn Leu Lys Thr Glu Phe Asn Gly Gln Asn Lys Ala
Val Asn405 410 415Lys Glu Ala Tyr Glu Glu
Ile Ser Leu Glu His Leu Val Ile Tyr Arg420 425
430Ile Ala Met Cys Lys Pro Val Met Tyr Lys Asn Thr Gly Lys Ser
Glu435 440 445Gln Cys Ile Ile Val Asn Asn
Glu Asp Leu Phe Phe Ile Ala Asn Lys450 455
460Asp Ser Phe Ser Lys Asp Leu Ala Lys Ala Glu Thr Ile Ala Tyr Asn465
470 475 480Thr Gln Asn Asn
Thr Ile Glu Asn Asn Phe Ser Ile Asp Gln Leu Ile485 490
495Leu Asp Asn Asp Leu Ser Ser Gly Ile Asp Leu Pro Asn Glu
Asn Thr500 505 510Glu Pro Phe Thr Asn Phe
Asp Asp Ile Asp Ile Pro Val Tyr Ile Lys515 520
525Gln Ser Ala Leu Lys Lys Ile Phe Val Asp Gly Asp Ser Leu Phe
Glu530 535 540Tyr Leu His Ala Gln Thr Phe
Pro Ser Asn Ile Glu Asn Leu Gln Leu545 550
555 560Thr Asn Ser Leu Asn Asp Ala Leu Arg Asn Asn Asn
Lys Val Tyr Thr565 570 575Phe Phe Ser Thr
Asn Leu Val Glu Lys Ala Asn Thr Val Val Gly Ala580 585
590Ser Leu Phe Val Asn Trp Val Lys Gly Val Ile Asp Asp Phe
Thr Ser595 600 605Glu Ser Thr Gln Lys Ser
Thr Ile Asp Lys Val Ser Asp Val Ser Ile610 615
620Ile Ile Pro Tyr Ile Gly Pro Ala Leu Asn Val Gly Asn Glu Thr
Ala625 630 635 640Lys Glu
Asn Phe Lys Asn Ala Phe Glu Ile Gly Gly Ala Ala Ile Leu645
650 655Met Glu Phe Ile Pro Glu Leu Ile Val Pro Ile Val
Gly Phe Phe Thr660 665 670Leu Glu Ser Tyr
Val Gly Asn Lys Gly His Ile Ile Met Thr Ile Ser675 680
685Asn Ala Leu Lys Lys Arg Asp Gln Lys Trp Thr Asp Met Tyr
Gly Leu690 695 700Ile Val Ser Gln Trp Leu
Ser Thr Val Asn Thr Gln Phe Tyr Thr Ile705 710
715 720Lys Glu Arg Met Tyr Asn Ala Leu Asn Asn Gln
Ser Gln Ala Ile Glu725 730 735Lys Ile Ile
Glu Asp Gln Tyr Asn Arg Tyr Ser Glu Glu Asp Lys Met740
745 750Asn Ile Asn Ile Asp Phe Asn Asp Ile Asp Phe Lys
Leu Asn Gln Ser755 760 765Ile Asn Leu Ala
Ile Asn Asn Ile Asp Asp Phe Ile Asn Gln Cys Ser770 775
780Ile Ser Tyr Leu Met Asn Arg Met Ile Pro Leu Ala Val Lys
Lys Leu785 790 795 800Lys
Asp Phe Asp Asp Asn Leu Lys Arg Asp Leu Leu Glu Tyr Ile Asp805
810 815Thr Asn Glu Leu Tyr Leu Leu Asp Glu Val Asn
Ile Leu Lys Ser Lys820 825 830Val Asn Arg
His Leu Lys Asp Ser Ile Pro Phe Asp Leu Ser Leu Tyr835
840 845Thr Lys Asp Thr Ile Leu Ile Gln Val Phe Asn Asn
Tyr Ile Ser Asn850 855 860Ile Ser Ser Asn
Ala Ile Leu Ser Leu Ser Tyr Arg Gly Gly Arg Leu865 870
875 880Ile Asp Ser Ser Gly Tyr Gly Ala Thr
Met Asn Val Gly Ser Asp Val885 890 895Ile
Phe Asn Asp Ile Gly Asn Gly Gln Phe Lys Leu Asn Asn Ser Glu900
905 910Asn Ser Asn Ile Thr Ala His Gln Ser Lys Phe
Val Val Tyr Asp Ser915 920 925Met Phe Asp
Asn Phe Ser Ile Asn Phe Trp Val Arg Thr Pro Lys Tyr930
935 940Asn Asn Asn Asp Ile Gln Thr Tyr Leu Gln Asn Glu
Tyr Thr Ile Ile945 950 955
960Ser Cys Ile Lys Asn Asp Ser Gly Trp Lys Val Ser Ile Lys Gly Asn965
970 975Arg Ile Ile Trp Thr Leu Ile Asp Val
Asn Ala Lys Ser Lys Ser Ile980 985 990Phe
Phe Glu Tyr Ser Ile Lys Asp Asn Ile Ser Asp Tyr Ile Asn Lys995
1000 1005Trp Phe Ser Ile Thr Ile Thr Asn Asp Arg Leu
Gly Asn Ala Asn Ile1010 1015 1020Tyr Ile
Asn Gly Ser Leu Lys Lys Ser Glu Lys Ile Leu Asn Leu Asp1025
1030 1035 1040Arg Ile Asn Ser Ser Asn Asp
Ile Asp Phe Lys Leu Ile Asn Cys Thr1045 1050
1055Asp Thr Thr Lys Phe Val Trp Ile Lys Asp Phe Asn Ile Phe Gly Arg1060
1065 1070Glu Leu Asn Ala Thr Glu Val Ser Ser
Leu Tyr Trp Ile Gln Ser Ser1075 1080
1085Thr Asn Thr Leu Lys Asp Phe Trp Gly Asn Pro Leu Arg Tyr Asp Thr1090
1095 1100Gln Tyr Tyr Leu Phe Asn Gln Gly Met
Gln Asn Ile Tyr Ile Lys Tyr1105 1110 1115
1120Phe Ser Lys Ala Ser Met Gly Glu Thr Ala Pro Arg Thr Asn
Phe Asn1125 1130 1135Asn Ala Ala Ile Asn
Tyr Gln Asn Leu Tyr Leu Gly Leu Arg Phe Ile1140 1145
1150Ile Lys Lys Ala Ser Asn Ser Arg Asn Ile Asn Asn Asp Asn Ile
Val1155 1160 1165Arg Glu Gly Asp Tyr Ile
Tyr Leu Asn Ile Asp Asn Ile Ser Asp Glu1170 1175
1180Ser Tyr Arg Val Tyr Val Leu Val Asn Ser Lys Glu Ile Gln Thr
Gln1185 1190 1195 1200Leu
Phe Leu Ala Pro Ile Asn Asp Asp Pro Thr Phe Tyr Asp Val Leu1205
1210 1215Gln Ile Lys Lys Tyr Tyr Glu Lys Thr Thr Tyr
Asn Cys Gln Ile Leu1220 1225 1230Cys Glu
Lys Asp Thr Lys Thr Phe Gly Leu Phe Gly Ile Gly Lys Phe1235
1240 1245Val Lys Asp Tyr Gly Tyr Val Trp Asp Thr Tyr Asp
Asn Tyr Phe Cys1250 1255 1260Ile Ser Gln
Trp Tyr Leu Arg Arg Ile Ser Glu Asn Ile Asn Lys Leu1265
1270 1275 1280Arg Leu Gly Cys Asn Trp Gln
Phe Ile Pro Val Asp Glu Gly Trp Thr1285 1290
1295Glu81315PRTClostridium tetaniDOMAIN(1)...(441)Light chain comprising
the enzymatic domain. 8Met Pro Ile Thr Ile Asn Asn Phe Arg Tyr Ser Asp
Pro Val Asn Asn1 5 10
15Asp Thr Ile Ile Met Met Glu Pro Pro Tyr Cys Lys Gly Leu Asp Ile20
25 30Tyr Tyr Lys Ala Phe Lys Ile Thr Asp Arg
Ile Trp Ile Val Pro Glu35 40 45Arg Tyr
Glu Phe Gly Thr Lys Pro Glu Asp Phe Asn Pro Pro Ser Ser50
55 60Leu Ile Glu Gly Ala Ser Glu Tyr Tyr Asp Pro Asn
Tyr Leu Arg Thr65 70 75
80Asp Ser Asp Lys Asp Arg Phe Leu Gln Thr Met Val Lys Leu Phe Asn85
90 95Arg Ile Lys Asn Asn Val Ala Gly Glu Ala
Leu Leu Asp Lys Ile Ile100 105 110Asn Ala
Ile Pro Tyr Leu Gly Asn Ser Tyr Ser Leu Leu Asp Lys Phe115
120 125Asp Thr Asn Ser Asn Ser Val Ser Phe Asn Leu Leu
Glu Gln Asp Pro130 135 140Ser Gly Ala Thr
Thr Lys Ser Ala Met Leu Thr Asn Leu Ile Ile Phe145 150
155 160Gly Pro Gly Pro Val Leu Asn Lys Asn
Glu Val Arg Gly Ile Val Leu165 170 175Arg
Val Asp Asn Lys Asn Tyr Phe Pro Cys Arg Asp Gly Phe Gly Ser180
185 190Ile Met Gln Met Ala Phe Cys Pro Glu Tyr Val
Pro Thr Phe Asp Asn195 200 205Val Ile Glu
Asn Ile Thr Ser Leu Thr Ile Gly Lys Ser Lys Tyr Phe210
215 220Gln Asp Pro Ala Leu Leu Leu Met His Glu Leu Ile
His Val Leu His225 230 235
240Gly Leu Tyr Gly Met Gln Val Ser Ser His Glu Ile Ile Pro Ser Lys245
250 255Gln Glu Ile Tyr Met Gln His Thr Tyr
Pro Ile Ser Ala Glu Glu Leu260 265 270Phe
Thr Phe Gly Gly Gln Asp Ala Asn Leu Ile Ser Ile Asp Ile Lys275
280 285Asn Asp Leu Tyr Glu Lys Thr Leu Asn Asp Tyr
Lys Ala Ile Ala Asn290 295 300Lys Leu Ser
Gln Val Thr Ser Cys Asn Asp Pro Asn Ile Asp Ile Asp305
310 315 320Ser Tyr Lys Gln Ile Tyr Gln
Gln Lys Tyr Gln Phe Asp Lys Asp Ser325 330
335Asn Gly Gln Tyr Ile Val Asn Glu Asp Lys Phe Gln Ile Leu Tyr Asn340
345 350Ser Ile Met Tyr Gly Phe Thr Glu Ile
Glu Leu Gly Lys Lys Phe Asn355 360 365Ile
Lys Thr Arg Leu Ser Tyr Phe Ser Met Asn His Asp Pro Val Lys370
375 380Ile Pro Asn Leu Leu Asp Asp Thr Ile Tyr Asn
Asp Thr Glu Gly Phe385 390 395
400Asn Ile Glu Ser Lys Asp Leu Lys Ser Glu Tyr Lys Gly Gln Asn
Met405 410 415Arg Val Asn Thr Asn Ala Phe
Arg Asn Val Asp Gly Ser Gly Leu Val420 425
430Ser Lys Leu Ile Gly Leu Cys Lys Lys Ile Ile Pro Pro Thr Asn Ile435
440 445Arg Glu Asn Leu Tyr Asn Arg Thr Ala
Ser Leu Thr Asp Leu Gly Gly450 455 460Glu
Leu Cys Ile Lys Ile Lys Asn Glu Asp Leu Thr Phe Ile Ala Glu465
470 475 480Lys Asn Ser Phe Ser Glu
Glu Pro Phe Gln Asp Glu Ile Val Ser Tyr485 490
495Asn Thr Lys Asn Lys Pro Leu Asn Phe Asn Tyr Ser Leu Asp Lys
Ile500 505 510Ile Val Asp Tyr Asn Leu Gln
Ser Lys Ile Thr Leu Pro Asn Asp Arg515 520
525Thr Thr Pro Val Thr Lys Gly Ile Pro Tyr Ala Pro Glu Tyr Lys Ser530
535 540Asn Ala Ala Ser Thr Ile Glu Ile His
Asn Ile Asp Asp Asn Thr Ile545 550 555
560Tyr Gln Tyr Leu Tyr Ala Gln Lys Ser Pro Thr Thr Leu Gln
Arg Ile565 570 575Thr Met Thr Asn Ser Val
Asp Asp Ala Leu Ile Asn Ser Thr Lys Ile580 585
590Tyr Ser Tyr Phe Pro Ser Val Ile Ser Lys Val Asn Gln Gly Ala
Gln595 600 605Gly Ile Leu Phe Leu Gln Trp
Val Arg Asp Ile Ile Asp Asp Phe Thr610 615
620Asn Glu Ser Ser Gln Lys Thr Thr Ile Asp Lys Ile Ser Asp Val Ser625
630 635 640Thr Ile Val Pro
Tyr Ile Gly Pro Ala Leu Asn Ile Val Lys Gln Gly645 650
655Tyr Glu Gly Asn Phe Ile Gly Ala Leu Glu Thr Thr Gly Val
Val Leu660 665 670Leu Leu Glu Tyr Ile Pro
Glu Ile Thr Leu Pro Val Ile Ala Ala Leu675 680
685Ser Ile Ala Glu Ser Ser Thr Gln Lys Glu Lys Ile Ile Lys Thr
Ile690 695 700Asp Asn Phe Leu Glu Lys Arg
Tyr Glu Lys Trp Ile Glu Val Tyr Lys705 710
715 720Leu Val Lys Ala Lys Trp Leu Gly Thr Val Asn Thr
Gln Phe Gln Lys725 730 735Arg Ser Tyr Gln
Met Tyr Arg Ser Leu Glu Tyr Gln Val Asp Ala Ile740 745
750Lys Lys Ile Ile Asp Tyr Glu Tyr Lys Ile Tyr Ser Gly Pro
Asp Lys755 760 765Glu Gln Ile Ala Asp Glu
Ile Asn Asn Leu Lys Asn Lys Leu Glu Glu770 775
780Lys Ala Asn Lys Ala Met Ile Asn Ile Asn Ile Phe Met Arg Glu
Ser785 790 795 800Ser Arg
Ser Phe Leu Val Asn Gln Met Ile Asn Glu Ala Lys Lys Gln805
810 815Leu Leu Glu Phe Asp Thr Gln Ser Lys Asn Ile Leu
Met Gln Tyr Ile820 825 830Lys Ala Asn Ser
Lys Phe Ile Gly Ile Thr Glu Leu Lys Lys Leu Glu835 840
845Ser Lys Ile Asn Lys Val Phe Ser Thr Pro Ile Pro Phe Ser
Tyr Ser850 855 860Lys Asn Leu Asp Cys Trp
Val Asp Asn Glu Glu Asp Ile Asp Val Ile865 870
875 880Leu Lys Lys Ser Thr Ile Leu Asn Leu Asp Ile
Asn Asn Asp Ile Ile885 890 895Ser Asp Ile
Ser Gly Phe Asn Ser Ser Val Ile Thr Tyr Pro Asp Ala900
905 910Gln Leu Val Pro Gly Ile Asn Gly Lys Ala Ile His
Leu Val Asn Asn915 920 925Glu Ser Ser Glu
Val Ile Val His Lys Ala Met Asp Ile Glu Tyr Asn930 935
940Asp Met Phe Asn Asn Phe Thr Val Ser Phe Trp Leu Arg Val
Pro Lys945 950 955 960Val
Ser Ala Ser His Leu Glu Gln Tyr Gly Thr Asn Glu Tyr Ser Ile965
970 975Ile Ser Ser Met Lys Lys His Ser Leu Ser Ile
Gly Ser Gly Trp Ser980 985 990Val Ser Leu
Lys Gly Asn Asn Leu Ile Trp Thr Leu Lys Asp Ser Ala995
1000 1005Gly Glu Val Arg Gln Ile Thr Phe Arg Asp Leu Pro
Asp Lys Phe Asn1010 1015 1020Ala Tyr Leu
Ala Asn Lys Trp Val Phe Ile Thr Ile Thr Asn Asp Arg1025
1030 1035 1040Leu Ser Ser Ala Asn Leu Tyr
Ile Asn Gly Val Leu Met Gly Ser Ala1045 1050
1055Glu Ile Thr Gly Leu Gly Ala Ile Arg Glu Asp Asn Asn Ile Thr Leu1060
1065 1070Lys Leu Asp Arg Cys Asn Asn Asn Asn
Gln Tyr Val Ser Ile Asp Lys1075 1080
1085Phe Arg Ile Phe Cys Lys Ala Leu Asn Pro Lys Glu Ile Glu Lys Leu1090
1095 1100Tyr Thr Ser Tyr Leu Ser Ile Thr Phe
Leu Arg Asp Phe Trp Gly Asn1105 1110 1115
1120Pro Leu Arg Tyr Asp Thr Glu Tyr Tyr Leu Ile Pro Val Ala
Ser Ser1125 1130 1135Ser Lys Asp Val Gln
Leu Lys Asn Ile Thr Asp Tyr Met Tyr Leu Thr1140 1145
1150Asn Ala Pro Ser Tyr Thr Asn Gly Lys Leu Asn Ile Tyr Tyr Arg
Arg1155 1160 1165Leu Tyr Asn Gly Leu Lys
Phe Ile Ile Lys Arg Tyr Thr Pro Asn Asn1170 1175
1180Glu Ile Asp Ser Phe Val Lys Ser Gly Asp Phe Ile Lys Leu Tyr
Val1185 1190 1195 1200Ser
Tyr Asn Asn Asn Glu His Ile Val Gly Tyr Pro Lys Asp Gly Asn1205
1210 1215Ala Phe Asn Asn Leu Asp Arg Ile Leu Arg Val
Gly Tyr Asn Ala Pro1220 1225 1230Gly Ile
Pro Leu Tyr Lys Lys Met Glu Ala Val Lys Leu Arg Asp Leu1235
1240 1245Lys Thr Tyr Ser Val Gln Leu Lys Leu Tyr Asp Asp
Lys Asn Ala Ser1250 1255 1260Leu Gly Leu
Val Gly Thr His Asn Gly Gln Ile Gly Asn Asp Pro Asn1265
1270 1275 1280Arg Asp Ile Leu Ile Ala Ser
Asn Trp Tyr Phe Asn His Leu Lys Asp1285 1290
1295Lys Ile Leu Gly Cys Asp Trp Tyr Phe Val Pro Thr Asp Glu Gly Trp1300
1305 1310Thr Asn Asp131591268PRTClostridium
baratii 9Met Pro Val Asn Ile Asn Asn Phe Asn Tyr Asn Asp Pro Ile Asn Asn1
5 10 15Thr Thr Ile Leu
Tyr Met Lys Met Pro Tyr Tyr Glu Asp Ser Asn Lys20 25
30Tyr Tyr Lys Ala Phe Glu Ile Met Asp Asn Val Trp Ile Ile
Pro Glu35 40 45Arg Asn Ile Ile Gly Lys
Lys Pro Ser Asp Phe Tyr Pro Pro Ile Ser50 55
60Leu Asp Ser Gly Ser Ser Ala Tyr Tyr Asp Pro Asn Tyr Leu Thr Thr65
70 75 80Asp Ala Glu Lys
Asp Arg Phe Leu Lys Thr Val Ile Lys Leu Phe Asn85 90
95Arg Ile Asn Ser Asn Pro Ala Gly Gln Val Leu Leu Glu Glu
Ile Lys100 105 110Asn Gly Lys Pro Tyr Leu
Gly Asn Asp His Thr Ala Val Asn Glu Phe115 120
125Cys Ala Asn Asn Arg Ser Thr Ser Val Glu Ile Lys Glu Ser Asn
Gly130 135 140Thr Thr Asp Ser Met Leu Leu
Asn Leu Val Ile Leu Gly Pro Gly Pro145 150
155 160Asn Ile Leu Glu Cys Ser Thr Phe Pro Val Arg Ile
Phe Pro Asn Asn165 170 175Ile Ala Tyr Asp
Pro Ser Glu Lys Gly Phe Gly Ser Ile Gln Leu Met180 185
190Ser Phe Ser Thr Glu Tyr Glu Tyr Ala Phe Asn Asp Asn Thr
Asp Leu195 200 205Phe Ile Ala Asp Pro Ala
Ile Ser Leu Ala His Glu Leu Ile His Val210 215
220Leu His Gly Leu Tyr Gly Ala Lys Gly Val Thr Asn Lys Lys Val
Ile225 230 235 240Glu Val
Asp Gln Gly Ala Leu Met Ala Ala Glu Lys Asp Ile Lys Ile245
250 255Glu Glu Phe Ile Thr Phe Gly Gly Gln Asp Leu Asn
Ile Ile Thr Asn260 265 270Ser Thr Asn Gln
Lys Ile Tyr Val Ile Leu Leu Ser Asn Tyr Thr Ala275 280
285Ile Ala Ser Arg Leu Ser Gln Val Asn Arg Asn Asn Ser Ala
Leu Asn290 295 300Thr Thr Tyr Tyr Lys Asn
Phe Phe Gln Trp Lys Tyr Gly Leu Asp Gln305 310
315 320Asp Ser Asn Gly Asn Tyr Thr Val Asn Ile Ser
Lys Phe Asn Ala Ile325 330 335Tyr Lys Lys
Leu Phe Ser Phe Thr Glu Cys Asp Leu Ala Gln Lys Phe340
345 350Gln Val Lys Asn Arg Ser Asn Tyr Leu Phe His Phe
Lys Pro Phe Arg355 360 365Leu Leu Asp Leu
Leu Asp Asp Asn Ile Tyr Ser Ile Ser Glu Gly Phe370 375
380Asn Ile Gly Ser Leu Arg Val Asn Asn Asn Gly Gln Asn Ile
Asn Leu385 390 395 400Asn
Ser Arg Ile Val Gly Pro Ile Pro Asp Asn Gly Leu Val Glu Arg405
410 415Phe Val Gly Leu Cys Lys Ser Ile Val Ser Lys
Lys Gly Thr Lys Asn420 425 430Ser Leu Cys
Ile Lys Val Asn Asn Arg Asp Leu Phe Phe Val Ala Ser435
440 445Glu Ser Ser Tyr Asn Glu Asn Gly Ile Asn Ser Pro
Lys Glu Ile Asp450 455 460Asp Thr Thr Ile
Thr Asn Asn Asn Tyr Lys Lys Asn Leu Asp Glu Val465 470
475 480Ile Leu Asp Tyr Asn Ser Asp Ala Ile
Pro Asn Leu Ser Ser Arg Leu485 490 495Leu
Asn Thr Thr Ala Gln Asn Asp Ser Tyr Val Pro Lys Tyr Asp Ser500
505 510Asn Gly Thr Ser Glu Ile Lys Glu Tyr Thr Val
Asp Lys Leu Asn Val515 520 525Phe Phe Tyr
Leu Tyr Ala Gln Lys Ala Pro Glu Gly Glu Ser Ala Ile530
535 540Ser Leu Thr Ser Ser Val Asn Thr Ala Leu Leu Asp
Ala Ser Lys Val545 550 555
560Tyr Thr Phe Phe Ser Ser Asp Phe Ile Asn Thr Val Asn Lys Pro Val565
570 575Gln Ala Ala Leu Phe Ile Ser Trp Ile
Gln Gln Val Ile Asn Asp Phe580 585 590Thr
Thr Glu Ala Thr Gln Lys Ser Thr Ile Asp Lys Ile Ala Asp Ile595
600 605Ser Leu Ile Val Pro Tyr Val Gly Leu Ala Leu
Asn Ile Gly Asn Glu610 615 620Val Gln Lys
Gly Asn Phe Lys Glu Ala Ile Glu Leu Leu Gly Ala Gly625
630 635 640Ile Leu Leu Glu Phe Val Pro
Glu Leu Leu Ile Pro Thr Ile Leu Val645 650
655Phe Thr Ile Lys Ser Phe Ile Asn Ser Asp Asp Ser Lys Asn Lys Ile660
665 670Ile Lys Ala Ile Asn Asn Ala Leu Arg
Glu Arg Glu Leu Lys Trp Lys675 680 685Glu
Val Tyr Ser Trp Ile Val Ser Asn Trp Leu Thr Arg Ile Asn Thr690
695 700Gln Phe Asn Lys Arg Lys Glu Gln Met Tyr Gln
Ala Leu Gln Asn Gln705 710 715
720Val Asp Gly Ile Lys Lys Ile Ile Glu Tyr Lys Tyr Asn Asn Tyr
Thr725 730 735Leu Asp Glu Lys Asn Arg Leu
Arg Ala Glu Tyr Asn Ile Tyr Ser Ile740 745
750Lys Glu Glu Leu Asn Lys Lys Val Ser Leu Ala Met Gln Asn Ile Asp755
760 765Arg Phe Leu Thr Glu Ser Ser Ile Ser
Tyr Leu Met Lys Leu Ile Asn770 775 780Glu
Ala Lys Ile Asn Lys Leu Ser Glu Tyr Asp Lys Arg Val Asn Gln785
790 795 800Tyr Leu Leu Asn Tyr Ile
Leu Glu Asn Ser Ser Thr Leu Gly Thr Ser805 810
815Ser Val Pro Glu Leu Asn Asn Leu Val Ser Asn Thr Leu Asn Asn
Ser820 825 830Ile Pro Phe Glu Leu Ser Glu
Tyr Thr Asn Asp Lys Ile Leu Ile His835 840
845Ile Leu Ile Arg Phe Tyr Lys Arg Ile Ile Asp Ser Ser Ile Leu Asn850
855 860Met Lys Tyr Glu Asn Asn Arg Phe Ile
Asp Ser Ser Gly Tyr Gly Ser865 870 875
880Asn Ile Ser Ile Asn Gly Asp Ile Tyr Ile Tyr Ser Thr Asn
Arg Asn885 890 895Gln Phe Gly Ile Tyr Ser
Ser Arg Leu Ser Glu Val Asn Ile Thr Gln900 905
910Asn Asn Thr Ile Ile Tyr Asn Ser Arg Tyr Gln Asn Phe Ser Val
Ser915 920 925Phe Trp Val Arg Ile Pro Lys
Tyr Asn Asn Leu Lys Asn Leu Asn Asn930 935
940Glu Tyr Thr Ile Ile Asn Cys Met Arg Asn Asn Asn Ser Gly Trp Lys945
950 955 960Ile Ser Leu Asn
Tyr Asn Asn Ile Ile Trp Thr Leu Gln Asp Thr Thr965 970
975Gly Asn Asn Gln Lys Leu Val Phe Asn Tyr Thr Gln Met Ile
Asp Ile980 985 990Ser Asp Tyr Ile Asn Lys
Trp Thr Phe Val Thr Ile Thr Asn Asn Arg995 1000
1005Leu Gly His Ser Lys Leu Tyr Ile Asn Gly Asn Leu Thr Asp Gln
Lys1010 1015 1020Ser Ile Leu Asn Leu Gly
Asn Ile His Val Asp Asp Asn Ile Leu Phe1025 1030
1035 1040Lys Ile Val Gly Cys Asn Asp Thr Arg Tyr Val
Gly Ile Arg Tyr Phe1045 1050 1055Lys Ile
Phe Asn Met Glu Leu Asp Lys Thr Glu Ile Glu Thr Leu Tyr1060
1065 1070His Ser Glu Pro Asp Ser Thr Ile Leu Lys Asp Phe
Trp Gly Asn Tyr1075 1080 1085Leu Leu Tyr
Asn Lys Lys Tyr Tyr Leu Leu Asn Leu Leu Lys Pro Asn1090
1095 1100Met Ser Val Thr Lys Asn Ser Asp Ile Leu Asn Ile
Asn Arg Gln Arg1105 1110 1115
1120Gly Ile Tyr Ser Lys Thr Asn Ile Phe Ser Asn Ala Arg Leu Tyr Thr1125
1130 1135Gly Val Glu Val Ile Ile Arg Lys Val
Gly Ser Thr Asp Thr Ser Asn1140 1145
1150Thr Asp Asn Phe Val Arg Lys Asn Asp Thr Val Tyr Ile Asn Val Val1155
1160 1165Asp Gly Asn Ser Glu Tyr Gln Leu Tyr
Ala Asp Val Ser Thr Ser Ala1170 1175
1180Val Glu Lys Thr Ile Lys Leu Arg Arg Ile Ser Asn Ser Asn Tyr Asn1185
1190 1195 1200Ser Asn Gln Met
Ile Ile Met Asp Ser Ile Gly Asp Asn Cys Thr Met1205 1210
1215Asn Phe Lys Thr Asn Asn Gly Asn Asp Ile Gly Leu Leu Gly
Phe His1220 1225 1230Leu Asn Asn Leu Val
Ala Ser Ser Trp Tyr Tyr Lys Asn Ile Arg Asn1235 1240
1245Asn Thr Arg Asn Asn Gly Cys Phe Trp Ser Phe Ile Ser Lys Glu
His1250 1255 1260Gly Trp Gln
Glu1265101251PRTClostridium butyricum 10Met Pro Thr Ile Asn Ser Phe Asn
Tyr Asn Asp Pro Val Asn Asn Arg1 5 10
15Thr Ile Leu Tyr Ile Lys Pro Gly Gly Cys Gln Gln Phe Tyr Lys
Ser20 25 30Phe Asn Ile Met Lys Asn Ile
Trp Ile Ile Pro Glu Arg Asn Val Ile35 40
45Gly Thr Ile Pro Gln Asp Phe Leu Pro Pro Thr Ser Leu Lys Asn Gly50
55 60Asp Ser Ser Tyr Tyr Asp Pro Asn Tyr Leu
Gln Ser Asp Gln Glu Lys65 70 75
80Asp Lys Phe Leu Lys Ile Val Thr Lys Ile Phe Asn Arg Ile Asn
Asp85 90 95Asn Leu Ser Gly Arg Ile Leu
Leu Glu Glu Leu Ser Lys Ala Asn Pro100 105
110Tyr Leu Gly Asn Asp Asn Thr Pro Asp Gly Asp Phe Ile Ile Asn Asp115
120 125Ala Ser Ala Val Pro Ile Gln Phe Ser
Asn Gly Ser Gln Ser Ile Leu130 135 140Leu
Pro Asn Val Ile Ile Met Gly Ala Glu Pro Asp Leu Phe Glu Thr145
150 155 160Asn Ser Ser Asn Ile Ser
Leu Arg Asn Asn Tyr Met Pro Ser Asn His165 170
175Gly Phe Gly Ser Ile Ala Ile Val Thr Phe Ser Pro Glu Tyr Ser
Phe180 185 190Arg Phe Lys Asp Asn Ser Met
Asn Glu Phe Ile Gln Asp Pro Ala Leu195 200
205Thr Leu Met His Glu Leu Ile His Ser Leu His Gly Leu Tyr Gly Ala210
215 220Lys Gly Ile Thr Thr Lys Tyr Thr Ile
Thr Gln Lys Gln Asn Pro Leu225 230 235
240Ile Thr Asn Ile Arg Gly Thr Asn Ile Glu Glu Phe Leu Thr
Phe Gly245 250 255Gly Thr Asp Leu Asn Ile
Ile Thr Ser Ala Gln Ser Asn Asp Ile Tyr260 265
270Thr Asn Leu Leu Ala Asp Tyr Lys Lys Ile Ala Ser Lys Leu Ser
Lys275 280 285Val Gln Val Ser Asn Pro Leu
Leu Asn Pro Tyr Lys Asp Val Phe Glu290 295
300Ala Lys Tyr Gly Leu Asp Lys Asp Ala Ser Gly Ile Tyr Ser Val Asn305
310 315 320Ile Asn Lys Phe
Asn Asp Ile Phe Lys Lys Leu Tyr Ser Phe Thr Glu325 330
335Phe Asp Leu Ala Thr Lys Phe Gln Val Lys Cys Arg Gln Thr
Tyr Ile340 345 350Gly Gln Tyr Lys Tyr Phe
Lys Leu Ser Asn Leu Leu Asn Asp Ser Ile355 360
365Tyr Asn Ile Ser Glu Gly Tyr Asn Ile Asn Asn Leu Lys Val Asn
Phe370 375 380Arg Gly Gln Asn Ala Asn Leu
Asn Pro Arg Ile Ile Thr Pro Ile Thr385 390
395 400Gly Arg Gly Leu Val Lys Lys Ile Ile Arg Phe Cys
Lys Asn Ile Val405 410 415Ser Val Lys Gly
Ile Arg Lys Ser Ile Cys Ile Glu Ile Asn Asn Gly420 425
430Glu Leu Phe Phe Val Ala Ser Glu Asn Ser Tyr Asn Asp Asp
Asn Ile435 440 445Asn Thr Pro Lys Glu Ile
Asp Asp Thr Val Thr Ser Asn Asn Asn Tyr450 455
460Glu Asn Asp Leu Asp Gln Val Ile Leu Asn Phe Asn Ser Glu Ser
Ala465 470 475 480Pro Gly
Leu Ser Asp Glu Lys Leu Asn Leu Thr Ile Gln Asn Asp Ala485
490 495Tyr Ile Pro Lys Tyr Asp Ser Asn Gly Thr Ser Asp
Ile Glu Gln His500 505 510Asp Val Asn Glu
Leu Asn Val Phe Phe Tyr Leu Asp Ala Gln Lys Val515 520
525Pro Glu Gly Glu Asn Asn Val Asn Leu Thr Ser Ser Ile Asp
Thr Ala530 535 540Leu Leu Glu Gln Pro Lys
Ile Tyr Thr Phe Phe Ser Ser Glu Phe Ile545 550
555 560Asn Asn Val Asn Lys Pro Val Gln Ala Ala Leu
Phe Val Gly Trp Ile565 570 575Gln Gln Val
Leu Val Asp Phe Thr Thr Glu Ala Asn Gln Lys Ser Thr580
585 590Val Asp Lys Ile Ala Asp Ile Ser Ile Val Val Pro
Tyr Ile Gly Leu595 600 605Ala Leu Asn Ile
Gly Asn Glu Ala Gln Lys Gly Asn Phe Lys Asp Ala610 615
620Leu Glu Leu Leu Gly Ala Gly Ile Leu Leu Glu Phe Glu Pro
Glu Leu625 630 635 640Leu
Ile Pro Thr Ile Leu Val Phe Thr Ile Lys Ser Phe Leu Gly Ser645
650 655Ser Asp Asn Lys Asn Lys Val Ile Lys Ala Ile
Asn Asn Ala Leu Lys660 665 670Glu Arg Asp
Glu Lys Trp Lys Glu Val Tyr Ser Phe Ile Val Ser Asn675
680 685Trp Met Thr Lys Ile Asn Thr Gln Phe Asn Lys Arg
Lys Glu Gln Met690 695 700Tyr Gln Ala Leu
Gln Asn Gln Val Asn Ala Leu Lys Ala Ile Ile Glu705 710
715 720Ser Lys Tyr Asn Ser Tyr Thr Leu Glu
Glu Lys Asn Glu Leu Thr Asn725 730 735Lys
Tyr Asp Ile Glu Gln Ile Glu Asn Glu Leu Asn Gln Lys Val Ser740
745 750Ile Ala Met Asn Asn Ile Asp Arg Phe Leu Thr
Glu Ser Ser Ile Ser755 760 765Tyr Leu Met
Lys Leu Ile Asn Glu Val Lys Ile Asn Lys Leu Arg Glu770
775 780Tyr Asp Glu Asn Val Lys Thr Tyr Leu Leu Asp Tyr
Ile Ile Lys His785 790 795
800Gly Ser Ile Leu Gly Glu Ser Gln Gln Glu Leu Asn Ser Met Val Ile805
810 815Asp Thr Leu Asn Asn Ser Ile Pro Phe
Lys Leu Ser Ser Tyr Thr Asp820 825 830Asp
Lys Ile Leu Ile Ser Tyr Phe Asn Lys Phe Phe Lys Arg Ile Lys835
840 845Ser Ser Ser Val Leu Asn Met Arg Tyr Lys Asn
Asp Lys Tyr Val Asp850 855 860Thr Ser Gly
Tyr Asp Ser Asn Ile Asn Ile Asn Gly Asp Val Tyr Lys865
870 875 880Tyr Pro Thr Asn Lys Asn Gln
Phe Gly Ile Tyr Asn Asp Lys Leu Ser885 890
895Glu Val Asn Ile Ser Gln Asn Asp Tyr Ile Ile Tyr Asp Asn Lys Tyr900
905 910Lys Asn Phe Ser Ile Ser Phe Trp Val
Arg Ile Pro Asn Tyr Asp Asn915 920 925Lys
Ile Val Asn Val Asn Asn Glu Tyr Thr Ile Ile Asn Cys Met Arg930
935 940Asp Asn Asn Ser Gly Trp Lys Val Ser Leu Asn
His Asn Glu Ile Ile945 950 955
960Trp Thr Leu Gln Asp Asn Ser Gly Ile Asn Gln Lys Leu Ala Phe
Asn965 970 975Tyr Gly Asn Ala Asn Gly Ile
Ser Asp Tyr Ile Asn Lys Trp Ile Phe980 985
990Val Thr Ile Thr Asn Asp Arg Leu Gly Asp Ser Lys Leu Tyr Ile Asn995
1000 1005Gly Asn Leu Ile Asp Lys Lys Ser Ile
Leu Asn Leu Gly Asn Ile His1010 1015
1020Val Ser Asp Asn Ile Leu Phe Lys Ile Val Asn Cys Ser Tyr Thr Arg1025
1030 1035 1040Tyr Ile Gly Ile
Arg Tyr Phe Asn Ile Phe Asp Lys Glu Leu Asp Glu1045 1050
1055Thr Glu Ile Gln Thr Leu Tyr Asn Asn Glu Pro Asn Ala Asn
Ile Leu1060 1065 1070Lys Asp Phe Trp Gly
Asn Tyr Leu Leu Tyr Asp Lys Glu Tyr Tyr Leu1075 1080
1085Leu Asn Val Leu Lys Pro Asn Asn Phe Ile Asn Arg Arg Thr Asp
Ser1090 1095 1100Thr Leu Ser Ile Asn Asn
Ile Arg Ser Thr Ile Leu Leu Ala Asn Arg1105 1110
1115 1120Leu Tyr Ser Gly Ile Lys Val Lys Ile Gln Arg
Val Asn Asn Ser Ser1125 1130 1135Thr Asn
Asp Asn Leu Val Arg Lys Asn Asp Gln Val Tyr Ile Asn Phe1140
1145 1150Val Ala Ser Lys Thr His Leu Leu Pro Leu Tyr Ala
Asp Thr Ala Thr1155 1160 1165Thr Asn Lys
Glu Lys Thr Ile Lys Ile Ser Ser Ser Gly Asn Arg Phe1170
1175 1180Asn Gln Val Val Val Met Asn Ser Val Gly Asn Cys
Thr Met Asn Phe1185 1190 1195
1200Lys Asn Asn Asn Gly Asn Asn Ile Gly Leu Leu Gly Phe Lys Ala Asp1205
1210 1215Thr Val Val Ala Ser Thr Trp Tyr Tyr
Thr His Met Arg Asp Asn Thr1220 1225
1230Asn Ser Asn Gly Phe Phe Trp Asn Phe Ile Ser Glu Glu His Gly Trp1235
1240 1245Gln Glu Lys12501125PRTArtificial
SequenceDOMAIN(1)...(25)BoNT/A di-chain loop region 11Cys Val Arg Gly Ile
Ile Thr Ser Lys Thr Lys Ser Leu Asp Lys Gly1 5
10 15Tyr Asn Lys Ala Leu Asn Asp Leu Cys20
251210PRTArtificial SequenceDOMAIN(1)...(10)BoNT/B di-chain loop
region 12Cys Lys Ser Val Lys Ala Pro Gly Ile Cys1 5
101317PRTArtificial SequenceDOMAIN(1)...(17)BoNT/C1 di-chain
loop region 13Cys His Lys Ala Ile Asp Gly Arg Ser Leu Tyr Asn Lys Thr Leu
Asp1 5 10
15Cys1414PRTArtificial SequenceDOMAIN(1)...(14)BoNT/D di-chain loop
region 14Cys Leu Arg Leu Thr Lys Asn Ser Arg Asp Asp Ser Thr Cys1
5 101515PRTArtificial
SequenceDOMAIN(1)...(15)BoNT/E di-chain loop region 15Cys Lys Asn Ile Val
Ser Val Lys Gly Ile Arg Lys Ser Ile Cys1 5
10 151617PRTArtificial SequenceDOMAIN(1)...(17)BoNT/F
di-chain loop region 16Cys Lys Ser Val Ile Pro Arg Lys Gly Thr Lys Ala
Pro Pro Arg Leu1 5 10
15Cys1715PRTArtificial SequenceDOMAIN(1)...(15)BoNT/G di-chain loop
region 17Cys Lys Pro Val Met Tyr Lys Asn Thr Gly Lys Ser Glu Gln Cys1
5 10 151829PRTArtificial
SequenceDOMAIN(1)...(29)TeNT di-chain loop region 18Cys Lys Lys Ile Ile
Pro Pro Thr Asn Ile Arg Glu Asn Leu Tyr Asn1 5
10 15Arg Thr Ala Ser Leu Thr Asp Leu Gly Gly Glu Leu
Cys20 251915PRTArtificial SequenceDOMAIN(1)...(15)BaNT
di-chain loop region 19Cys Lys Ser Ile Val Ser Lys Lys Gly Thr Lys Asn
Ser Leu Cys1 5 10
152015PRTArtificial SequenceDOMAIN(1)...(15)BuNT di-chain loop region
20Cys Lys Asn Ile Val Ser Val Lys Gly Ile Arg Lys Ser Ile Cys1
5 10 15215PRTArtificial
SequenceSITE(1)...(5)Bovine enterokinase protease cleavage site. 21Asp
Asp Asp Asp Lys1 5227PRTArtificial
SequenceSITE(1)...(1)Tobacco Etch Virus protease cleavage site
consensus sequence 22Glu Xaa Xaa Tyr Xaa Gln Gly1
5237PRTArtificial SequenceSITE(1)...(7)Tobacco Etch Virus protease
cleavage site consensus sequence 23Glu Xaa Xaa Tyr Xaa Gln Ser1
5247PRTArtificial SequenceSITE(1)...(7)Tobacco Etch Virus
protease cleavage site. 24Glu Asn Leu Tyr Phe Gln Gly1
5257PRTArtificial SequenceSITE(1)...(7)Tobacco Etch Virus protease
cleavage site. 25Glu Asn Leu Tyr Phe Gln Ser1
5267PRTArtificial SequenceSITE(1)...(7)Tobacco Etch Virus protease
cleavage site. 26Glu Asn Ile Tyr Thr Gln Gly1
5277PRTArtificial SequenceSITE(1)...(7)Tobacco Etch Virus protease
cleavage site. 27Glu Asn Ile Tyr Thr Gln Ser1
5287PRTArtificial SequenceSITE(1)...(7)Tobacco Etch Virus protease
cleavage site. 28Glu Asn Ile Tyr Leu Gln Gly1
5297PRTArtificial SequenceSITE(1)...(7)Tobacco Etch Virus protease
cleavage site. 29Glu Asn Ile Tyr Leu Gln Ser1
5307PRTArtificial SequenceSITE(1)...(7)Tobacco Etch Virus protease
cleavage site. 30Glu Asn Val Tyr Phe Gln Gly1
5317PRTArtificial SequenceSITE(1)...(7)Tobacco Etch Virus protease
cleavage site. 31Glu Asn Val Tyr Ser Gln Ser1
5327PRTArtificial SequenceSITE(1)...(7)Tobacco Etch Virus protease
cleavage site. 32Glu Asn Val Tyr Ser Gln Gly1
5337PRTArtificial SequenceSITE(0)...(0)Tobacco Etch Virus protease
cleavage site. 33Glu Asn Val Tyr Ser Gln Ser1
5347PRTArtificial SequenceSITE(1)...(7)Consensus sequence for a Tobacco
Vein Mottling Virus protease cleavage site 34Xaa Xaa Val Arg Phe Gln
Gly1 5357PRTArtificial SequenceSITE(1)...(7)human
rhinovirus 3C protease cleavage site consensus sequence 35Xaa Xaa
Leu Phe Gln Gly Pro1 5367PRTArtificial
SequenceSITE(1)...(7)Tobacco Vein Mottling Virus protease cleavage
site 36Glu Thr Val Arg Phe Gln Gly1 5377PRTArtificial
SequenceSITE(1)...(7)Tobacco Vein Mottling Virus protease cleavage
site 37Glu Thr Val Arg Phe Gln Ser1 5387PRTArtificial
SequenceSITE(1)...(7)Tobacco Vein Mottling Virus protease cleavage
site 38Asn Asn Val Arg Phe Gln Gly1 5397PRTArtificial
SequenceSITE(1)...(7)Tobacco Vein Mottling Virus protease cleavage
site 39Asn Asn Val Arg Phe Gln Ser1 5407PRTArtificial
SequenceSITE(1)...(7)Consensus Sequence for human rhinovirus 3C
protease cleavage site 40Xaa Xaa Leu Phe Gln Gly Pro1
5417PRTArtificial SequenceSITE(1)...(7)Human rhinovirus 3C protease
cleavage site 41Glu Ala Leu Phe Gln Gly Pro1
5427PRTArtificial SequenceSITE(1)...(7)Human Rhinovirus 3C protease
cleavage site. 42Glu Val Leu Phe Gln Gly Pro1
5437PRTArtificial SequenceSITE(1)...(7)Human Rhinovirus 3C protease
cleavage site. 43Glu Leu Leu Phe Gln Gly Pro1
5447PRTArtificial SequenceSITE(1)...(7)Human Rhinovirus 3C protease
cleavage site. 44Asp Ala Leu Phe Gln Gly Pro1
5457PRTArtificial SequenceSITE(1)...(7)Human Rhinovirus 3C protease
cleavage site. 45Asp Val Leu Phe Gln Gly Pro1
5467PRTArtificial SequenceSITE(0)...(0)Human Rhinovirus 3C protease
cleavage site. 46Asp Leu Leu Phe Gln Gly Pro1
5476PRTArtificial SequenceSITE(1)...(6)subtilisin cleavage site consensus
sequence 47Xaa Xaa Xaa Xaa His Tyr1 5486PRTArtificial
SequenceSITE(1)...(6)Conseqnsus sequence for a subtilisin cleavage
site 48Xaa Xaa Xaa Xaa Tyr His1 5492PRTArtificial
SequenceSITE(1)...(2)subtilisin cleavage site 49His Tyr1502PRTArtificial
SequenceSITE(1)...(2)Subtilisin cleavage site 50Tyr His1516PRTArtificial
SequenceSITE(1)...(6)Subtilisin cleavage site 51Pro Gly Ala Ala His Tyr1
5522PRTArtificial SequenceSITE(1)...(2)Hydroxylamine
cleavage site 52Asn Gly1534PRTArtificial
SequenceSITE(1)...(4)Hydroxylamine cleavage site 53Asn Gly Asn
Gly1546PRTArtificial SequenceSITE(1)...(6)Hydroxylamine cleavage site
54Asn Gly Asn Gly Asn Gly1 5555PRTArtificial
SequenceSITE(1)...(5)Consensus sequence for a SUMO/ULP-1 protease
cleavage site 55Gly Gly Xaa Xaa Xaa1 55698PRTArtificial
SequenceSITE(1)...(98)SUMO/ULP-1 protease cleavage site. 56Met Ala Asp
Ser Glu Val Asn Gln Glu Ala Lys Pro Glu Val Lys Pro1 5
10 15Glu Val Lys Pro Glu Thr His Ile Asn Leu
Lys Val Ser Asp Gly Ser20 25 30Ser Glu
Ile Phe Phe Lys Ile Lys Lys Thr Thr Pro Leu Arg Arg Leu35
40 45Met Glu Ala Phe Ala Lys Arg Gln Gly Lys Glu Met
Asp Ser Leu Arg50 55 60Phe Leu Tyr Asp
Gly Ile Arg Ile Gln Ala Asp Gln Thr Pro Glu Asp65 70
75 80Leu Asp Met Glu Asp Asn Asp Ile Ile
Glu Ala His Arg Glu Gln Ile85 90 95Gly
Gly575PRTArtificial SequenceSITE(1)...(6)Non-human Caspase 3 consensus
sequence 57Asp Xaa Xaa Asp Xaa1 5585PRTArtificial
SequenceSITE(1)...(5)Non-human Caspase 3 protease cleavage site 58Asp Glu
Val Asp Gly1 5595PRTArtificial
SequenceSITE(1)...(5)Non-human Caspase 3 protease cleavage site 59Asp Glu
Val Asp Ser1 5605PRTArtificial
SequenceSITE(1)...(5)Non-human Caspase 3 protease cleavage site 60Asp Glu
Pro Asp Gly1 5615PRTArtificial
SequenceSITE(1)...(5)Non-human Caspase 3 protease cleavage site 61Asp Glu
Pro Asp Ser1 5625PRTArtificial
SequenceSITE(1)...(5)Non-human Caspase 3 protease cleavage site 62Asp Glu
Leu Asp Gly1 5635PRTArtificial
SequenceSITE(1)...(5)Non-human Caspase 3 protease cleavage site 63Asp Glu
Leu Asp Ser1 5645PRTArtificial
SequenceDOMAIN(1)...(5)flexible G-spacer 64Gly Gly Gly Gly Ser1
5655PRTArtificial SequenceDOMAIN(1)...(5)flexible A-spacer 65Glu Ala
Ala Ala Lys1 5665PRTArtificial
SequenceZN_FING(1)...(5)Zinc-finger motif 66His Glu Xaa Xaa His1
56744DNAArtificial Sequenceprimer_bind(1)...(44)Oligonucleotide
primer 67gactggtgga cagcaagtcg accggaagct ttacgacgat gacg
446844DNAArtificial Sequenceprimer_bind(1)...(44)Oligonucleotide
primer 68cgtcatcgtc gtaaagcttc cggtcgactt gctgtccacc agtc
446930DNAArtificial Sequenceprimer_bind(1)...(30)Oligonucleotide
primer 69aatagatcta gatcattaac agatttagga
307027DNAArtificial Sequenceprimer_bind(1)...(27)Oligonucleotide
primer 70ttctaaagat ctatacattt gataact
277127DNAArtificial Sequenceprimer_bind(1)...(27)Oligonucleotide
primer 71atgtatagat ctttagaata tcaagta
277245DNAArtificial Sequenceprimer_bind(1)...(45)Oligonucleotide
primer 72atcgataagc ttttatcagt cgacccaaca atccagattt ttaga
457365PRTArtificial SequenceDOMAIN(1)...(65)Modified di-chain loop
region 73Ser Lys Leu Ile Gly Leu Cys Lys Lys Ile Ile Pro Pro Thr Asn Ile1
5 10 15Arg Glu Asn Leu
Tyr Asn Arg Thr Ala Gly Glu Lys Leu Tyr Asp Asp20 25
30Asp Asp Lys Asp Arg Trp Gly Ser Ser Arg Ser Leu Thr Asp
Leu Gly35 40 45Gly Glu Leu Cys Ile Lys
Asn Glu Asp Leu Thr Phe Ile Ala Glu Lys50 55
60Asn657436DNAArtificial SequenceOligonucleotide primer 74aatagaactg
caggagaaaa gctttacgac gatgac
367536DNAArtificial SequenceOligonucleotide primer 75gtcatcgtcg
taaagctttt ctcctgcagt tctatt
36764016DNAClostridia botulinum serotype E 76gaattcaagt agtagataat
aaaaataatg ccacagattt ttattattaa taatgatata 60tttatctcta actgtttaac
tttaacttat aacaatgtaa atatatattt gtctataaaa 120aatcaagatt acaattgggt
tatatgtgat cttaatcatg atataccaaa aaagtcatat 180ctatggatat taaaaaatat
ataaatttaa aattaggaga tgctgtatat gccaaaaatt 240aatagtttta attataatga
tcctgttaat gatagaacaa ttttatatat taaaccaggc 300ggttgtcaag aattttataa
atcatttaat attatgaaaa atatttggat aattccagag 360agaaatgtaa ttggtacaac
cccccaagat tttcatccgc ctacttcatt aaaaaatgga 420gatagtagtt attatgaccc
taattattta caaagtgatg aagaaaagga tagattttta 480aaaatagtca caaaaatatt
taatagaata aataataatc tttcaggagg gattttatta 540gaagaactgt caaaagctaa
tccatattta gggaatgata atactccaga taatcaattc 600catattggtg atgcatcagc
agttgagatt aaattctcaa atggtagcca agacatacta 660ttacctaatg ttattataat
gggagcagag cctgatttat ttgaaactaa cagttccaat 720atttctctaa gaaataatta
tatgccaagc aatcaccgtt ttggatcaat agctatagta 780acattctcac ctgaatattc
ttttagattt aatgataatt gtatgaatga atttattcaa 840gatcctgctc ttacattaat
gcatgaatta atacattcat tacatggact atatggggct 900aaagggatta ctacaaagta
tactataaca caaaaacaaa atcccctaat aacaaatata 960agaggtacaa atattgaaga
attcttaact tttggaggta ctgatttaaa cattattact 1020agtgctcagt ccaatgatat
ctatactaat cttctagctg attataaaaa aatagcgtct 1080aaacttagca aagtacaagt
atctaatcca ctacttaatc cttataaaga tgtttttgaa 1140gcaaagtatg gattagataa
agatgctagc ggaatttatt cggtaaatat aaacaaattt 1200aatgatattt ttaaaaaatt
atacagcttt acggaatttg atttacgaac taaatttcaa 1260gttaaatgta ggcaaactta
tattggacag tataaatact tcaaactttc aaacttgtta 1320aatgattcta tttataatat
atcagaaggc tataatataa ataatttaaa ggtaaatttt 1380agaggacaga atgcaaattt
aaatcctaga attattacac caattacagg tagaggacta 1440gtaaaaaaaa tcattagatt
ttgtaaaaat attgtttctg taaaaggcat aaggaaatca 1500atatgtatcg aaataaataa
tggtgagtta ttttttgtgg cttccgagaa tagttataat 1560gatgataata taaatactcc
taaagaaatt gacgatacag taacttcaaa taataattat 1620gaaaatgatt tagatcaggt
tattttaaat tttaatagtg aatcagcacc tggactttca 1680gatgaaaaat taaatttaac
tatccaaaat gatgcttata taccaaaata tgattctaat 1740ggaacaagtg atatagaaca
acatgatgtt aatgaactta atgtattttt ctatttagat 1800gcacagaaag tgcccgaagg
tgaaaataat gtcaatctca cctcttcaat tgatacagca 1860ttattagaac aacctaaaat
atatacattt ttttcatcag aatttattaa taatgtcaat 1920aaacctgtgc aagcagcatt
atttgtaagc tggatacaac aagtgttagt agattttact 1980actgaagcta accaaaaaag
tactgttgat aaaattgcag atatttctat agttgttcca 2040tatataggtc ttgctttaaa
tataggaaat gaagcacaaa aaggaaattt taaagatgca 2100cttgaattat taggagcagg
tattttatta gaatttgaac ccgagctttt aattcctaca 2160attttagtat tcacgataaa
atctttttta ggttcatctg ataataaaaa taaagttatt 2220aaagcaataa ataatgcatt
gaaagaaaga gatgaaaaat ggaaagaagt atatagtttt 2280atagtatcga attggatgac
taaaattaat acacaattta ataaaagaaa agaacaaatg 2340tatcaagctt tacaaaatca
agtaaatgca attaaaacaa taatagaatc taagtataat 2400agttatactt tagaggaaaa
aaatgagctt acaaataaat atgatattaa gcaaatagaa 2460aatgaactta atcaaaaggt
ttctatagca atgaataata tagacaggtt cttaactgaa 2520agttctatat cctatttaat
gaaaataata aatgaagtaa aaattaataa attaagagaa 2580tatgatgaga atgtcaaaac
gtatttattg aattatatta tacaacatgg atcaatcttg 2640ggagagagtc agcaagaact
aaattctatg gtaactgata ccctaaataa tagtattcct 2700tttaagcttt cttcttatac
agatgataaa attttaattt catattttaa taaattcttt 2760aagagaatta aaagtagttc
agttttaaat atgagatata aaaatgataa atacgtagat 2820acttcaggat atgattcaaa
tataaatatt aatggagatg tatataaata tccaactaat 2880aaaaatcaat ttggaatata
taatgataaa cttagtgaag ttaatatatc tcaaaatgat 2940tacattatat atgataataa
atataaaaat tttagtatta gtttttgggt aagaattcct 3000aactatgata ataagatagt
aaatgttaat aatgaataca ctataataaa ttgtatgaga 3060gataataatt caggatggaa
agtatctctt aatcataatg aaataatttg gacattcgaa 3120gataatcgag gaattaatca
aaaattagca tttaactatg gtaacgcaaa tggtatttct 3180gattatataa ataagtggat
ttttgtaact ataactaatg atagattagg agattctaaa 3240ctttatatta atggaaattt
aatagatcaa aaatcaattt taaatttagg taatattcat 3300gttagtgaca atatattatt
taaaatagtt aattgtagtt atacaagata tattggtatt 3360agatatttta atatttttga
taaagaatta gatgaaacag aaattcaaac tttatatagc 3420aatgaaccta atacaaatat
tttgaaggat ttttggggaa attatttgct ttatgacaaa 3480gaatactatt tattaaatgt
gttaaaacca aataacttta ttgataggag aaaagattct 3540actttaagca ttaataatat
aagaagcact attcttttag ctaatagatt atatagtgga 3600ataaaagtta aaatacaaag
agttaataat agtagtacta acgataatct tgttagaaag 3660aatgatcagg tatatattaa
ttttgtagcc agcaaaactc acttatttcc attatatgct 3720gatacagcta ccacaaataa
agagaaaaca ataaaaatat catcatctgg caatagattt 3780aatcaagtag tagttatgaa
ttcagtagga aattgtacaa tgaattttaa aaataataat 3840ggaaataata ttgggttgtt
aggtttcaag gcagatactg tcgttgctag tacttggtat 3900tatacacata tgagagatca
tacaaacagc aatggatgtt tttggaactt tatttctgaa 3960gaacatggat ggcaagaaaa
ataaaaatta gattaaacgg ctaaagtcat aaattc 40167737DNAArtificial
Sequenceprimer_bind(1)...(37)Oligonucleotide primer 77cccggatccc
caaaaattaa tagttttaat tataatg
377836DNAArtificial Sequenceprimer_bind(1)...(36)Oligonucleotide primer
78cccctgcagt catttttctt gccatccatg ttcttc
367931DNAArtificial Sequenceprimer_bind(1)...(31)Oligonucleotide primer
79cagttaatac attcattaca tggactatat g
318026DNAArtificial Sequenceprimer_bind(1)...(26)Oligonucleotide primer
80atgcattaat gtaagagcag gatctt
2681211PRTHomo sapiens 81Met Lys Leu Trp Asp Val Val Ala Val Cys Leu Val
Leu Leu His Thr1 5 10
15Ala Ser Ala Phe Pro Leu Pro Ala Gly Lys Arg Pro Pro Glu Ala Pro20
25 30Ala Glu Asp Arg Ser Leu Gly Arg Arg Arg
Ala Pro Phe Ala Leu Ser35 40 45Ser Asp
Ser Asn Met Pro Glu Asp Tyr Pro Asp Gln Phe Asp Asp Val50
55 60Met Asp Phe Ile Gln Ala Thr Ile Lys Arg Leu Lys
Arg Ser Pro Asp65 70 75
80Lys Gln Met Ala Val Leu Pro Arg Arg Glu Arg Asn Arg Gln Ala Ala85
90 95Ala Ala Asn Pro Glu Asn Ser Arg Gly Lys
Gly Arg Arg Gly Gln Arg100 105 110Gly Lys
Asn Arg Gly Cys Val Leu Thr Ala Ile His Leu Asn Val Thr115
120 125Asp Leu Gly Leu Gly Tyr Glu Thr Lys Glu Glu Leu
Ile Phe Arg Tyr130 135 140Cys Ser Gly Ser
Cys Asp Ala Ala Glu Thr Thr Tyr Asp Lys Ile Leu145 150
155 160Lys Asn Leu Ser Arg Asn Arg Arg Leu
Val Ser Asp Lys Val Gly Gln165 170 175Ala
Cys Cys Arg Pro Ile Ala Phe Asp Asp Asp Leu Ser Phe Leu Asp180
185 190Asp Asn Leu Val Tyr His Ile Leu Arg Lys His
Ser Ala Lys Arg Cys195 200 205Gly Cys
Ile21082197PRTHomo sapiens 82Met Gln Arg Trp Lys Ala Ala Ala Leu Ala Ser
Val Leu Cys Ser Ser1 5 10
15Val Leu Ser Ile Trp Met Cys Arg Glu Gly Leu Leu Leu Ser His Arg20
25 30Leu Gly Pro Ala Leu Val Pro Leu His Arg
Leu Pro Arg Thr Leu Asp35 40 45Ala Arg
Ile Ala Arg Leu Ala Gln Tyr Arg Ala Leu Leu Gln Gly Ala50
55 60Pro Asp Ala Met Glu Leu Arg Glu Leu Thr Pro Trp
Ala Gly Arg Pro65 70 75
80Pro Gly Pro Arg Arg Arg Ala Gly Pro Arg Arg Arg Arg Ala Arg Ala85
90 95Arg Leu Gly Ala Arg Pro Cys Gly Leu Arg
Glu Leu Glu Val Arg Val100 105 110Ser Glu
Leu Gly Leu Gly Tyr Ala Ser Asp Glu Thr Val Leu Phe Arg115
120 125Tyr Cys Ala Gly Ala Cys Glu Ala Ala Ala Arg Val
Tyr Asp Leu Gly130 135 140Leu Arg Arg Leu
Arg Gln Arg Arg Arg Leu Arg Arg Glu Arg Val Arg145 150
155 160Ala Gln Pro Cys Cys Arg Pro Thr Ala
Tyr Glu Asp Glu Val Ser Phe165 170 175Leu
Asp Ala His Ser Arg Tyr His Thr Val His Glu Leu Ser Ala Arg180
185 190Glu Cys Ala Cys Val19583156PRTHomo sapiens
83Met Ala Val Gly Lys Phe Leu Leu Gly Ser Leu Leu Leu Leu Ser Leu1
5 10 15Gln Leu Gly Gln Gly Trp
Gly Pro Asp Ala Arg Gly Val Pro Val Ala20 25
30Asp Gly Glu Phe Ser Ser Glu Gln Val Ala Lys Ala Gly Gly Thr Trp35
40 45Leu Gly Thr His Arg Pro Leu Ala Arg
Leu Arg Arg Ala Leu Ser Gly50 55 60Pro
Cys Gln Leu Trp Ser Leu Thr Leu Ser Val Ala Glu Leu Gly Leu65
70 75 80Gly Tyr Ala Ser Glu Glu
Lys Val Ile Phe Arg Tyr Cys Ala Gly Ser85 90
95Cys Pro Arg Gly Ala Arg Thr Gln His Gly Leu Ala Leu Ala Arg Leu100
105 110Gln Gly Gln Gly Arg Ala His Gly
Gly Pro Cys Cys Arg Pro Thr Arg115 120
125Tyr Thr Asp Val Ala Phe Leu Asp Asp Arg His Arg Trp Gln Arg Leu130
135 140Pro Gln Leu Ser Ala Ala Ala Cys Gly
Cys Gly Gly145 150 15584220PRTHomo
sapiens 84Met Glu Leu Gly Leu Gly Gly Leu Ser Thr Leu Ser His Cys Pro
Trp1 5 10 15Pro Arg Gln
Gln Pro Ala Leu Trp Pro Thr Leu Ala Ala Leu Ala Leu20 25
30Leu Ser Ser Val Ala Glu Ala Ser Leu Gly Ser Ala Pro
Arg Ser Pro35 40 45Ala Pro Arg Glu Gly
Pro Pro Pro Val Leu Ala Ser Pro Ala Gly His50 55
60Leu Pro Gly Gly Arg Thr Ala Arg Trp Cys Ser Gly Arg Ala Arg
Arg65 70 75 80Pro Pro
Pro Gln Pro Ser Arg Pro Ala Pro Pro Pro Pro Ala Pro Pro85
90 95Ser Ala Leu Pro Arg Gly Gly Arg Ala Ala Arg Ala
Gly Gly Pro Gly100 105 110Ser Arg Ala Arg
Ala Ala Gly Ala Arg Gly Cys Arg Leu Arg Ser Gln115 120
125Leu Val Pro Val Arg Ala Leu Gly Leu Gly His Arg Ser Asp
Glu Leu130 135 140Val Arg Phe Arg Phe Cys
Ser Gly Ser Cys Arg Arg Ala Arg Ser Pro145 150
155 160His Asp Leu Ser Leu Ala Ser Leu Leu Gly Ala
Gly Ala Leu Arg Pro165 170 175Pro Pro Gly
Ser Arg Pro Val Ser Gln Pro Cys Cys Arg Pro Thr Arg180
185 190Tyr Glu Ala Val Ser Phe Met Asp Val Asn Ser Thr
Trp Arg Thr Val195 200 205Asp Arg Leu Ser
Ala Thr Ala Cys Gly Cys Leu Gly210 215
22085390PRTHomo sapiens 85Met Pro Pro Ser Gly Leu Arg Leu Leu Leu Leu Leu
Leu Pro Leu Leu1 5 10
15Trp Leu Leu Val Leu Thr Pro Gly Arg Pro Ala Ala Gly Leu Ser Thr20
25 30Cys Lys Thr Ile Asp Met Glu Leu Val Lys
Arg Lys Arg Ile Glu Ala35 40 45Ile Arg
Gly Gln Ile Leu Ser Lys Leu Arg Leu Ala Ser Pro Pro Ser50
55 60Gln Gly Glu Val Pro Pro Gly Pro Leu Pro Glu Ala
Val Leu Ala Leu65 70 75
80Tyr Asn Ser Thr Arg Asp Arg Val Ala Gly Glu Ser Ala Glu Pro Glu85
90 95Pro Glu Pro Glu Ala Asp Tyr Tyr Ala Lys
Glu Val Thr Arg Val Leu100 105 110Met Val
Glu Thr His Asn Glu Ile Tyr Asp Lys Phe Lys Gln Ser Thr115
120 125His Ser Ile Tyr Met Phe Phe Asn Thr Ser Glu Leu
Arg Glu Ala Val130 135 140Pro Glu Pro Val
Leu Leu Ser Arg Ala Glu Leu Arg Leu Leu Arg Leu145 150
155 160Lys Leu Lys Val Glu Gln His Val Glu
Leu Tyr Gln Lys Tyr Ser Asn165 170 175Asn
Ser Trp Arg Tyr Leu Ser Asn Arg Leu Leu Ala Pro Ser Asp Ser180
185 190Pro Glu Trp Leu Ser Phe Asp Val Thr Gly Val
Val Arg Gln Trp Leu195 200 205Ser Arg Gly
Gly Glu Ile Glu Gly Phe Arg Leu Ser Ala His Cys Ser210
215 220Cys Asp Ser Arg Asp Asn Thr Leu Gln Val Asp Ile
Asn Gly Phe Thr225 230 235
240Thr Gly Arg Arg Gly Asp Leu Ala Thr Ile His Gly Met Asn Arg Pro245
250 255Phe Leu Leu Leu Met Ala Thr Pro Leu
Glu Arg Ala Gln His Leu Gln260 265 270Ser
Ser Arg His Arg Arg Ala Leu Asp Thr Asn Tyr Cys Phe Ser Ser275
280 285Thr Glu Lys Asn Cys Cys Val Arg Gln Leu Tyr
Ile Asp Phe Arg Lys290 295 300Asp Leu Gly
Trp Lys Trp Ile His Glu Pro Lys Gly Tyr His Ala Asn305
310 315 320Phe Cys Leu Gly Pro Cys Pro
Tyr Ile Trp Ser Leu Asp Thr Gln Tyr325 330
335Ser Lys Val Leu Ala Leu Tyr Asn Gln His Asn Pro Gly Ala Ser Ala340
345 350Ala Pro Cys Cys Val Pro Gln Ala Leu
Glu Pro Leu Pro Ile Val Tyr355 360 365Tyr
Val Gly Arg Lys Pro Lys Val Glu Gln Leu Ser Asn Met Ile Val370
375 380Arg Ser Cys Lys Cys Ser385
39086413PRTHomo sapiens 86Met His Tyr Cys Val Leu Ser Ala Phe Leu Ile Leu
His Leu Val Thr1 5 10
15Val Ala Leu Ser Leu Ser Thr Cys Ser Thr Leu Asp Met Asp Gln Phe20
25 30Met Arg Lys Arg Ile Glu Ala Ile Arg Gly
Gln Ile Leu Ser Lys Leu35 40 45Lys Leu
Thr Ser Pro Pro Glu Asp Tyr Pro Glu Pro Glu Glu Val Pro50
55 60Pro Glu Val Ile Ser Ile Tyr Asn Ser Thr Arg Asp
Leu Leu Gln Glu65 70 75
80Lys Ala Ser Arg Arg Ala Ala Ala Cys Glu Arg Glu Arg Ser Asp Glu85
90 95Glu Tyr Tyr Ala Lys Glu Val Tyr Lys Ile
Asp Met Pro Pro Phe Phe100 105 110Pro Ser
Glu Ala Ile Pro Pro Thr Phe Tyr Arg Pro Tyr Phe Arg Ile115
120 125Val Arg Phe Asp Val Ser Ala Met Glu Lys Asn Ala
Ser Asn Leu Val130 135 140Lys Ala Glu Phe
Arg Val Phe Arg Leu Gln Asn Pro Lys Ala Arg Val145 150
155 160Pro Glu Gln Arg Ile Glu Leu Tyr Gln
Ile Leu Lys Ser Lys Asp Leu165 170 175Thr
Ser Pro Thr Gln Arg Tyr Ile Asp Ser Lys Val Val Lys Thr Arg180
185 190Ala Glu Gly Glu Trp Leu Ser Phe Asp Val Thr
Asp Ala Val His Glu195 200 205Trp Leu His
His Lys Asp Arg Asn Leu Gly Phe Lys Ile Ser Leu His210
215 220Cys Pro Cys Cys Thr Phe Val Pro Ser Asn Asn Tyr
Ile Ile Pro Asn225 230 235
240Lys Ser Glu Glu Leu Glu Ala Arg Phe Ala Gly Ile Asp Gly Thr Ser245
250 255Thr Tyr Thr Ser Gly Asp Gln Lys Thr
Ile Lys Ser Thr Arg Lys Lys260 265 270Asn
Ser Gly Lys Thr Pro His Leu Leu Leu Met Leu Leu Pro Ser Tyr275
280 285Arg Leu Glu Ser Gln Gln Thr Asn Arg Arg Lys
Lys Arg Ala Leu Asp290 295 300Ala Ala Tyr
Cys Phe Arg Asn Val Gln Asp Asn Cys Cys Leu Arg Pro305
310 315 320Leu Tyr Ile Asp Phe Lys Arg
Asp Leu Gly Trp Lys Trp Ile His Glu325 330
335Pro Lys Gly Tyr Asn Ala Asn Phe Cys Ala Gly Ala Cys Pro Tyr Leu340
345 350Trp Ser Ser Asp Thr Gln His Ser Arg
Val Leu Ser Leu Tyr Asn Thr355 360 365Ile
Asn Pro Glu Ala Ser Ala Ser Pro Cys Cys Val Ser Gln Asp Leu370
375 380Glu Pro Leu Thr Ile Leu Tyr Tyr Ile Gly Lys
Thr Pro Lys Ile Glu385 390 395
400Gln Leu Ser Asn Met Ile Val Lys Ser Cys Lys Cys Ser405
41087412PRTHomo sapiens 87Met Lys Met His Leu Gln Arg Ala Leu Val
Val Leu Ala Leu Leu Asn1 5 10
15Phe Ala Thr Val Ser Leu Ser Leu Ser Thr Cys Thr Thr Leu Asp Phe20
25 30Gly His Ile Lys Lys Lys Arg Val Glu
Ala Ile Arg Gly Gln Ile Leu35 40 45Ser
Lys Leu Arg Leu Thr Ser Pro Pro Glu Pro Thr Val Met Thr His50
55 60Val Pro Tyr Gln Val Leu Ala Leu Tyr Asn Ser
Thr Arg Glu Leu Leu65 70 75
80Glu Glu Met His Gly Glu Arg Glu Glu Gly Cys Thr Gln Glu Asn Thr85
90 95Glu Ser Glu Tyr Tyr Ala Lys Glu Ile
His Lys Phe Asp Met Ile Gln100 105 110Gly
Leu Ala Glu His Asn Glu Leu Ala Val Cys Pro Lys Gly Ile Thr115
120 125Ser Lys Val Phe Arg Phe Asn Val Ser Ser Val
Glu Lys Asn Arg Thr130 135 140Asn Leu Phe
Arg Ala Glu Phe Arg Val Leu Arg Val Pro Asn Pro Ser145
150 155 160Ser Lys Arg Asn Glu Gln Arg
Ile Glu Leu Phe Gln Ile Leu Arg Pro165 170
175Asp Glu His Ile Ala Lys Gln Arg Tyr Ile Gly Gly Lys Asn Leu Pro180
185 190Thr Arg Gly Thr Ala Glu Trp Leu Ser
Phe Asp Val Thr Asp Thr Val195 200 205Arg
Glu Trp Leu Leu Arg Arg Glu Ser Asn Leu Gly Leu Glu Ile Ser210
215 220Ile His Cys Pro Cys His Thr Phe Gln Pro Asn
Gly Asp Ile Leu Glu225 230 235
240Asn Ile His Glu Val Met Glu Ile Lys Phe Lys Gly Val Asp Asn
Glu245 250 255Asp Asp His Gly Arg Gly Asp
Leu Gly Arg Leu Lys Lys Gln Lys Asp260 265
270His His Asn Pro His Leu Ile Leu Met Met Ile Pro Pro His Arg Leu275
280 285Asp Asn Pro Gly Gln Gly Gly Gln Arg
Lys Lys Arg Ala Leu Asp Thr290 295 300Asn
Tyr Cys Phe Arg Asn Leu Glu Glu Asn Cys Cys Val Arg Pro Leu305
310 315 320Tyr Ile Asp Phe Arg Gln
Asp Leu Gly Trp Lys Trp Val His Glu Pro325 330
335Lys Gly Tyr Tyr Ala Asn Phe Cys Ser Gly Pro Cys Pro Tyr Leu
Arg340 345 350Ser Ala Asp Thr Thr His Ser
Thr Val Leu Gly Leu Tyr Asn Thr Leu355 360
365Asn Pro Glu Ala Ser Ala Ser Pro Cys Cys Val Pro Gln Asp Leu Glu370
375 380Pro Leu Thr Ile Leu Tyr Tyr Val Gly
Arg Thr Pro Lys Val Glu Gln385 390 395
400Leu Ser Asn Met Val Val Lys Ser Cys Lys Cys Ser405
41088304PRTHomo sapiens 88Met Asp Pro Met Ser Ile Gly Pro Lys
Ser Cys Gly Gly Ser Pro Trp1 5 10
15Arg Pro Pro Gly Thr Ala Pro Trp Ser Ile Gly Ser Arg Arg Ala
Thr20 25 30Ala Ser Ser Ser Cys Ser Thr
Ser Ser Arg Val Arg Ala Glu Val Gly35 40
45Gly Arg Ala Leu Leu His Arg Ala Glu Leu Arg Met Leu Arg Gln Lys50
55 60Ala Ala Ala Asp Ser Ala Gly Thr Glu Gln
Arg Leu Glu Leu Tyr Gln65 70 75
80Gly Tyr Gly Asn Ala Ser Trp Arg Tyr Leu His Gly Arg Ser Val
Arg85 90 95Ala Thr Ala Asp Asp Glu Trp
Leu Ser Phe Asp Val Thr Asp Ala Val100 105
110His Gln Trp Leu Ser Gly Ser Glu Leu Leu Gly Val Phe Lys Leu Ser115
120 125Val His Cys Pro Cys Glu Met Gly Pro
Gly His Ala Asp Glu Met Arg130 135 140Ile
Ser Ile Glu Gly Phe Glu Gln Gln Arg Gly Asp Met Gln Ser Ile145
150 155 160Ala Lys Lys His Arg Arg
Val Pro Tyr Val Leu Ala Met Ala Leu Pro165 170
175Ala Glu Arg Ala Asn Glu Leu His Ser Ala Arg Arg Arg Arg Asp
Leu180 185 190Asp Thr Asp Tyr Cys Phe Gly
Pro Gly Thr Asp Glu Lys Asn Cys Cys195 200
205Val Arg Pro Leu Tyr Ile Asp Phe Arg Lys Asp Leu Gln Trp Lys Trp210
215 220Ile His Glu Pro Lys Gly Tyr Met Ala
Asn Phe Cys Met Gly Pro Cys225 230 235
240Pro Tyr Ile Trp Ser Ala Asp Thr Gln Tyr Thr Lys Val Leu
Ala Leu245 250 255Tyr Asn Gln His Asn Pro
Gly Ala Ser Ala Ala Pro Cys Cys Val Pro260 265
270Gln Thr Leu Asp Pro Leu Pro Ile Ile Tyr Tyr Val Gly Arg Asn
Val275 280 285Arg Val Glu Gln Leu Ser Asn
Met Val Val Arg Ala Cys Lys Cys Ser290 295
30089396PRTHomo sapiens 89Met Val Ala Gly Thr Arg Cys Leu Leu Ala Leu
Leu Leu Pro Gln Val1 5 10
15Leu Leu Gly Gly Ala Ala Gly Leu Val Pro Glu Leu Gly Arg Arg Lys20
25 30Phe Ala Ala Ala Ser Ser Gly Arg Pro Ser
Ser Gln Pro Ser Asp Glu35 40 45Val Leu
Ser Glu Phe Glu Leu Arg Leu Leu Ser Met Phe Gly Leu Lys50
55 60Gln Arg Pro Thr Pro Ser Arg Asp Ala Val Val Pro
Pro Tyr Met Leu65 70 75
80Asp Leu Tyr Arg Arg His Ser Gly Gln Pro Gly Ser Pro Ala Pro Asp85
90 95His Arg Leu Glu Arg Ala Ala Ser Arg Ala
Asn Thr Val Arg Ser Phe100 105 110His His
Glu Glu Ser Leu Glu Glu Leu Pro Glu Thr Ser Gly Lys Thr115
120 125Thr Arg Arg Phe Phe Phe Asn Leu Ser Ser Ile Pro
Thr Glu Glu Phe130 135 140Ile Thr Ser Ala
Glu Leu Gln Val Phe Arg Glu Gln Met Gln Asp Ala145 150
155 160Leu Gly Asn Asn Ser Ser Phe His His
Arg Ile Asn Ile Tyr Glu Ile165 170 175Ile
Lys Pro Ala Thr Ala Asn Ser Lys Phe Pro Val Thr Arg Leu Leu180
185 190Asp Thr Arg Leu Val Asn Gln Asn Ala Ser Arg
Trp Glu Ser Phe Asp195 200 205Val Thr Pro
Ala Val Met Arg Trp Thr Ala Gln Gly His Ala Asn His210
215 220Gly Phe Val Val Glu Val Ala His Leu Glu Glu Lys
Gln Gly Val Ser225 230 235
240Lys Arg His Val Arg Ile Ser Arg Ser Leu His Gln Asp Glu His Ser245
250 255Trp Ser Gln Ile Arg Pro Leu Leu Val
Thr Phe Gly His Asp Gly Lys260 265 270Gly
His Pro Leu His Lys Arg Glu Lys Arg Gln Ala Lys His Lys Gln275
280 285Arg Lys Arg Leu Lys Ser Ser Cys Lys Arg His
Pro Leu Tyr Val Asp290 295 300Phe Ser Asp
Val Gly Trp Asn Asp Trp Ile Val Ala Pro Pro Gly Tyr305
310 315 320His Ala Phe Tyr Cys His Gly
Glu Cys Pro Phe Pro Leu Ala Asp His325 330
335Leu Asn Ser Thr Asn His Ala Ile Val Gln Thr Leu Val Asn Ser Val340
345 350Asn Ser Lys Ile Pro Lys Ala Cys Cys
Val Pro Thr Glu Leu Ser Ala355 360 365Ile
Ser Met Leu Tyr Leu Asp Glu Asn Glu Lys Val Val Leu Lys Asn370
375 380Tyr Gln Asp Met Val Val Glu Gly Cys Gly Cys
Arg385 390 39590472PRTHomo sapiens 90Met
Ala Gly Ala Ser Arg Leu Leu Phe Leu Trp Leu Gly Cys Phe Cys1
5 10 15Val Ser Leu Ala Gln Gly Glu Arg
Pro Lys Pro Pro Phe Pro Glu Leu20 25
30Arg Lys Ala Val Pro Gly Asp Arg Thr Ala Gly Gly Gly Pro Asp Ser35
40 45Glu Leu Gln Pro Gln Asp Lys Val Ser Glu
His Met Leu Arg Leu Tyr50 55 60Asp Arg
Tyr Ser Thr Val Gln Ala Ala Arg Thr Pro Gly Ser Leu Glu65
70 75 80Gly Gly Ser Gln Pro Trp Arg
Pro Arg Leu Leu Arg Glu Gly Asn Thr85 90
95Val Arg Ser Phe Arg Ala Ala Ala Ala Glu Thr Leu Glu Arg Lys Gly100
105 110Leu Tyr Ile Phe Asn Leu Thr Ser Leu
Thr Lys Ser Glu Asn Ile Leu115 120 125Ser
Ala Thr Leu Tyr Phe Cys Ile Gly Glu Leu Gly Asn Ile Ser Leu130
135 140Ser Cys Pro Val Ser Gly Gly Cys Ser His His
Ala Gln Arg Lys His145 150 155
160Ile Gln Ile Asp Leu Ser Ala Trp Thr Leu Lys Phe Ser Arg Asn
Gln165 170 175Ser Gln Leu Leu Gly His Leu
Ser Val Asp Met Ala Lys Ser His Arg180 185
190Asp Ile Met Ser Trp Leu Ser Lys Asp Ile Thr Gln Phe Leu Arg Lys195
200 205Ala Lys Glu Asn Glu Glu Phe Leu Ile
Gly Phe Asn Ile Thr Ser Lys210 215 220Gly
Arg Gln Leu Pro Lys Arg Arg Leu Pro Phe Pro Glu Pro Tyr Ile225
230 235 240Leu Val Tyr Ala Asn Asp
Ala Ala Ile Ser Glu Pro Glu Ser Val Val245 250
255Ser Ser Leu Gln Gly His Arg Asn Phe Pro Thr Gly Thr Val Pro
Lys260 265 270Trp Asp Ser His Ile Arg Ala
Ala Leu Ser Ile Glu Arg Arg Lys Lys275 280
285Arg Ser Thr Gly Val Leu Leu Pro Leu Gln Asn Asn Glu Leu Pro Gly290
295 300Ala Glu Tyr Gln Tyr Lys Lys Asp Glu
Val Trp Glu Glu Arg Lys Pro305 310 315
320Tyr Lys Thr Leu Gln Ala Gln Ala Pro Glu Lys Ser Lys Asn
Lys Lys325 330 335Lys Gln Arg Lys Gly Pro
His Arg Lys Ser Gln Thr Leu Gln Phe Asp340 345
350Glu Gln Thr Leu Lys Lys Ala Arg Arg Lys Gln Trp Ile Glu Pro
Arg355 360 365Asn Cys Ala Arg Arg Tyr Leu
Lys Val Asp Phe Ala Asp Ile Gly Trp370 375
380Ser Glu Trp Ile Ile Ser Pro Lys Ser Phe Asp Ala Tyr Tyr Cys Ser385
390 395 400Gly Ala Cys Gln
Phe Pro Met Pro Lys Ser Leu Lys Pro Ser Asn His405 410
415Ala Thr Ile Gln Ser Ile Val Arg Ala Val Gly Val Val Pro
Gly Ile420 425 430Pro Glu Pro Cys Cys Val
Pro Glu Lys Met Ser Ser Leu Ser Ile Leu435 440
445Phe Phe Asp Glu Asn Lys Asn Val Val Leu Lys Val Tyr Pro Asn
Met450 455 460Thr Val Glu Ser Cys Ala Cys
Arg465 47091408PRTHomo sapiens 91Met Ile Pro Gly Asn Arg
Met Leu Met Val Val Leu Leu Cys Gln Val1 5
10 15Leu Leu Gly Gly Ala Ser His Ala Ser Leu Ile Pro Glu
Thr Gly Lys20 25 30Lys Lys Val Ala Glu
Ile Gln Gly His Ala Gly Gly Arg Arg Ser Gly35 40
45Gln Ser His Glu Leu Leu Arg Asp Phe Glu Ala Thr Leu Leu Gln
Met50 55 60Phe Gly Leu Arg Arg Arg Pro
Gln Pro Ser Lys Ser Ala Val Ile Pro65 70
75 80Asp Tyr Met Arg Asp Leu Tyr Arg Leu Gln Ser Gly
Glu Glu Glu Glu85 90 95Glu Gln Ile His
Ser Thr Gly Leu Glu Tyr Pro Glu Arg Pro Ala Ser100 105
110Arg Ala Asn Thr Val Arg Ser Phe His His Glu Glu His Leu
Glu Asn115 120 125Ile Pro Gly Thr Ser Glu
Asn Ser Ala Phe Arg Phe Leu Phe Asn Leu130 135
140Ser Ser Ile Pro Glu Asn Glu Val Ile Ser Ser Ala Glu Leu Arg
Leu145 150 155 160Phe Arg
Glu Gln Val Asp Gln Gly Pro Asp Trp Glu Arg Gly Phe His165
170 175Arg Ile Asn Ile Tyr Glu Val Met Lys Pro Pro Ala
Glu Val Val Pro180 185 190Gly His Leu Ile
Thr Arg Leu Leu Asp Thr Arg Leu Val His His Asn195 200
205Val Thr Arg Trp Glu Thr Phe Asp Val Ser Pro Ala Val Leu
Arg Trp210 215 220Thr Arg Glu Lys Gln Pro
Asn Tyr Gly Leu Ala Ile Glu Val Thr His225 230
235 240Leu His Gln Thr Arg Thr His Gln Gly Gln His
Val Arg Ile Ser Arg245 250 255Ser Leu Pro
Gln Gly Ser Gly Asn Trp Ala Gln Leu Arg Pro Leu Leu260
265 270Val Thr Phe Gly His Asp Gly Arg Gly His Ala Leu
Thr Arg Arg Arg275 280 285Arg Ala Lys Arg
Ser Pro Lys His His Ser Gln Arg Ala Arg Lys Lys290 295
300Asn Lys Asn Cys Arg Arg His Ser Leu Tyr Val Asp Phe Ser
Asp Val305 310 315 320Gly
Trp Asn Asp Trp Ile Val Ala Pro Pro Gly Tyr Gln Ala Phe Tyr325
330 335Cys His Gly Asp Cys Pro Phe Pro Leu Ala Asp
His Leu Asn Ser Thr340 345 350Asn His Ala
Ile Val Gln Thr Leu Val Asn Ser Val Asn Ser Ser Ile355
360 365Pro Lys Ala Cys Cys Val Pro Thr Glu Leu Ser Ala
Ile Ser Met Leu370 375 380Tyr Leu Asp Glu
Tyr Asp Lys Val Val Leu Lys Asn Tyr Gln Glu Met385 390
395 400Val Val Glu Gly Cys Gly Cys
Arg40592454PRTHomo sapiens 92Met His Leu Thr Val Phe Leu Leu Lys Gly Ile
Val Gly Phe Leu Trp1 5 10
15Ser Cys Trp Val Leu Val Gly Tyr Ala Lys Gly Gly Leu Gly Asp Asn20
25 30His Val His Ser Ser Phe Ile Tyr Arg Arg
Leu Arg Asn His Glu Arg35 40 45Arg Glu
Ile Gln Arg Glu Ile Leu Ser Ile Leu Gly Leu Pro His Arg50
55 60Pro Arg Pro Phe Ser Pro Gly Lys Gln Ala Ser Ser
Ala Pro Leu Phe65 70 75
80Met Leu Asp Leu Tyr Asn Ala Met Thr Asn Glu Glu Asn Pro Glu Glu85
90 95Ser Glu Tyr Ser Val Arg Ala Ser Leu Ala
Glu Glu Thr Arg Gly Ala100 105 110Arg Lys
Gly Tyr Pro Ala Ser Pro Asn Gly Tyr Pro Arg Arg Ile Gln115
120 125Leu Ser Arg Thr Thr Pro Leu Thr Thr Gln Ser Pro
Pro Leu Ala Ser130 135 140Leu His Asp Thr
Asn Phe Leu Asn Asp Ala Asp Met Val Met Ser Phe145 150
155 160Val Asn Leu Val Glu Arg Asp Lys Asp
Phe Ser His Gln Arg Arg His165 170 175Tyr
Lys Glu Phe Arg Phe Asp Leu Thr Gln Ile Pro His Gly Glu Ala180
185 190Val Thr Ala Ala Glu Phe Arg Ile Tyr Lys Asp
Arg Ser Asn Asn Arg195 200 205Phe Glu Asn
Glu Thr Ile Lys Ile Ser Ile Tyr Gln Ile Ile Lys Glu210
215 220Tyr Thr Asn Arg Asp Ala Asp Leu Phe Leu Leu Asp
Thr Arg Lys Ala225 230 235
240Gln Ala Leu Asp Val Gly Trp Leu Val Phe Asp Ile Thr Val Thr Ser245
250 255Asn His Trp Val Ile Asn Pro Gln Asn
Asn Leu Gly Leu Gln Leu Cys260 265 270Ala
Glu Thr Gly Asp Gly Arg Ser Ile Asn Val Lys Ser Ala Gly Leu275
280 285Val Gly Arg Gln Gly Pro Gln Ser Lys Gln Pro
Phe Met Val Ala Phe290 295 300Phe Lys Ala
Ser Glu Val Leu Leu Arg Ser Val Arg Ala Ala Asn Lys305
310 315 320Arg Lys Asn Gln Asn Arg Asn
Lys Ser Ser Ser His Gln Asp Ser Ser325 330
335Arg Met Ser Ser Val Gly Asp Tyr Asn Thr Ser Glu Gln Lys Gln Ala340
345 350Cys Lys Lys His Glu Leu Tyr Val Ser
Phe Arg Asp Leu Gly Trp Gln355 360 365Asp
Trp Ile Ile Ala Pro Glu Gly Tyr Ala Ala Phe Tyr Cys Asp Gly370
375 380Glu Cys Ser Phe Pro Leu Asn Ala His Met Asn
Ala Thr Asn His Ala385 390 395
400Ile Val Gln Thr Leu Val His Leu Met Phe Pro Asp His Val Pro
Lys405 410 415Pro Cys Cys Ala Pro Thr Lys
Leu Asn Ala Ile Ser Val Leu Tyr Phe420 425
430Asp Asp Ser Ser Asn Val Ile Leu Lys Lys Tyr Arg Asn Met Val Val435
440 445Arg Ser Cys Gly Cys
His45093513PRTHomo sapiens 93Met Pro Gly Leu Gly Arg Arg Ala Gln Trp Leu
Cys Trp Trp Trp Gly1 5 10
15Leu Leu Cys Ser Cys Cys Gly Pro Pro Pro Leu Arg Pro Pro Leu Pro20
25 30Ala Ala Ala Ala Ala Ala Ala Gly Gly Gln
Leu Leu Gly Asp Gly Gly35 40 45Ser Pro
Gly Arg Thr Glu Gln Pro Pro Pro Ser Pro Gln Ser Ser Ser50
55 60Gly Phe Leu Tyr Arg Arg Leu Lys Thr Gln Glu Lys
Arg Glu Met Gln65 70 75
80Lys Glu Ile Leu Ser Val Leu Gly Leu Pro His Arg Pro Arg Pro Leu85
90 95His Gly Leu Gln Gln Pro Gln Pro Pro Ala
Leu Arg Gln Gln Glu Glu100 105 110Gln Gln
Gln Gln Gln Gln Leu Pro Arg Gly Glu Pro Pro Pro Gly Arg115
120 125Leu Lys Ser Ala Pro Leu Phe Met Leu Asp Leu Tyr
Asn Ala Leu Ser130 135 140Ala Asp Asn Asp
Glu Asp Gly Ala Ser Glu Gly Glu Arg Gln Gln Ser145 150
155 160Trp Pro His Glu Ala Ala Ser Ser Ser
Gln Arg Arg Gln Pro Pro Pro165 170 175Gly
Ala Ala His Pro Leu Asn Arg Lys Ser Leu Leu Ala Pro Gly Ser180
185 190Gly Ser Gly Gly Ala Ser Pro Leu Thr Ser Ala
Gln Asp Ser Ala Phe195 200 205Leu Asn Asp
Ala Asp Met Val Met Ser Phe Val Asn Leu Val Glu Tyr210
215 220Asp Lys Glu Phe Ser Pro Arg Gln Arg His His Lys
Glu Phe Lys Phe225 230 235
240Asn Leu Ser Gln Ile Pro Glu Gly Glu Val Val Thr Ala Ala Glu Phe245
250 255Arg Ile Tyr Lys Asp Cys Val Met Gly
Ser Phe Lys Asn Gln Thr Phe260 265 270Leu
Ile Ser Ile Tyr Gln Val Leu Gln Glu His Gln His Arg Asp Ser275
280 285Asp Leu Phe Leu Leu Asp Thr Arg Val Val Trp
Ala Ser Glu Glu Gly290 295 300Trp Leu Glu
Phe Asp Ile Thr Ala Thr Ser Asn Leu Trp Val Val Thr305
310 315 320Pro Gln His Asn Met Gly Leu
Gln Leu Ser Val Val Thr Arg Asp Gly325 330
335Val His Val His Pro Arg Ala Ala Gly Leu Val Gly Arg Asp Gly Pro340
345 350Tyr Asp Lys Gln Pro Phe Met Val Ala
Phe Phe Lys Val Ser Glu Val355 360 365His
Val Arg Thr Thr Arg Ser Ala Ser Ser Arg Arg Arg Gln Gln Ser370
375 380Arg Asn Arg Ser Thr Gln Ser Gln Asp Val Ala
Arg Val Ser Ser Ala385 390 395
400Ser Asp Tyr Asn Ser Ser Glu Leu Lys Thr Ala Cys Arg Lys His
Glu405 410 415Leu Tyr Val Ser Phe Gln Asp
Leu Gly Trp Gln Asp Trp Ile Ile Ala420 425
430Pro Lys Gly Tyr Ala Ala Asn Tyr Cys Asp Gly Glu Cys Ser Phe Pro435
440 445Leu Asn Ala His Met Asn Ala Thr Asn
His Ala Ile Val Gln Thr Leu450 455 460Val
His Leu Met Asn Pro Glu Tyr Val Pro Lys Pro Cys Cys Ala Pro465
470 475 480Thr Lys Leu Asn Ala Ile
Ser Val Leu Tyr Phe Asp Asp Asn Ser Asn485 490
495Val Ile Leu Lys Lys Tyr Arg Asn Met Val Val Arg Ala Cys Gly
Cys500 505 510His94431PRTHomo sapiens
94Met His Val Arg Ser Leu Arg Ala Ala Ala Pro His Ser Phe Val Ala1
5 10 15Leu Trp Ala Pro Leu Phe
Leu Leu Arg Ser Ala Leu Ala Asp Phe Ser20 25
30Leu Asp Asn Glu Val His Ser Ser Phe Ile His Arg Arg Leu Arg Ser35
40 45Gln Glu Arg Arg Glu Met Gln Arg Glu
Ile Leu Ser Ile Leu Gly Leu50 55 60Pro
His Arg Pro Arg Pro His Leu Gln Gly Lys His Asn Ser Ala Pro65
70 75 80Met Phe Met Leu Asp Leu
Tyr Asn Ala Met Ala Val Glu Glu Gly Gly85 90
95Gly Pro Gly Gly Gln Gly Phe Ser Tyr Pro Tyr Lys Ala Val Phe Ser100
105 110Thr Gln Gly Pro Pro Leu Ala Ser
Leu Gln Asp Ser His Phe Leu Thr115 120
125Asp Ala Asp Met Val Met Ser Phe Val Asn Leu Val Glu His Asp Lys130
135 140Glu Phe Phe His Pro Arg Tyr His His
Arg Glu Phe Arg Phe Asp Leu145 150 155
160Ser Lys Ile Pro Glu Gly Glu Ala Val Thr Ala Ala Glu Phe
Arg Ile165 170 175Tyr Lys Asp Tyr Ile Arg
Glu Arg Phe Asp Asn Glu Thr Phe Arg Ile180 185
190Ser Val Tyr Gln Val Leu Gln Glu His Leu Gly Arg Glu Ser Asp
Leu195 200 205Phe Leu Leu Asp Ser Arg Thr
Leu Trp Ala Ser Glu Glu Gly Trp Leu210 215
220Val Phe Asp Ile Thr Ala Thr Ser Asn His Trp Val Val Asn Pro Arg225
230 235 240His Asn Leu Gly
Leu Gln Leu Ser Val Glu Thr Leu Asp Gly Gln Ser245 250
255Ile Asn Pro Lys Leu Ala Gly Leu Ile Gly Arg His Gly Pro
Gln Asn260 265 270Lys Gln Pro Phe Met Val
Ala Phe Phe Lys Ala Thr Glu Val His Phe275 280
285Arg Ser Ile Arg Ser Thr Gly Ser Lys Gln Arg Ser Gln Asn Arg
Ser290 295 300Lys Thr Pro Lys Asn Gln Glu
Ala Leu Arg Met Ala Asn Val Ala Glu305 310
315 320Asn Ser Ser Ser Asp Gln Arg Gln Ala Cys Lys Lys
His Glu Leu Tyr325 330 335Val Ser Phe Arg
Asp Leu Gly Trp Gln Asp Trp Ile Ile Ala Pro Glu340 345
350Gly Tyr Ala Ala Tyr Tyr Cys Glu Gly Glu Cys Ala Phe Pro
Leu Asn355 360 365Ser Tyr Met Asn Ala Thr
Asn His Ala Ile Val Gln Thr Leu Val His370 375
380Phe Ile Asn Pro Glu Thr Val Pro Lys Pro Cys Cys Ala Pro Thr
Gln385 390 395 400Leu Asn
Ala Ile Ser Val Leu Tyr Phe Asp Asp Ser Ser Asn Val Ile405
410 415Leu Lys Lys Tyr Arg Asn Met Val Val Arg Ala Cys
Gly Cys His420 425 43095402PRTHomo
sapiens 95Met Thr Ala Leu Pro Gly Pro Leu Trp Leu Leu Gly Leu Ala Leu
Cys1 5 10 15Ala Leu Gly
Gly Gly Gly Pro Gly Leu Arg Pro Pro Pro Gly Cys Pro20 25
30Gln Arg Arg Leu Gly Ala Arg Glu Arg Arg Asp Val Gln
Arg Glu Ile35 40 45Leu Ala Val Leu Gly
Leu Pro Gly Arg Pro Arg Pro Arg Ala Pro Pro50 55
60Ala Ala Ser Arg Leu Pro Ala Ser Ala Pro Leu Phe Met Leu Asp
Leu65 70 75 80Tyr His
Ala Met Ala Gly Asp Asp Asp Glu Asp Gly Ala Pro Ala Glu85
90 95Arg Arg Leu Gly Arg Ala Asp Leu Val Met Ser Phe
Val Asn Met Val100 105 110Glu Arg Asp Arg
Ala Leu Gly His Gln Glu Pro His Trp Lys Glu Phe115 120
125Arg Phe Asp Leu Thr Gln Ile Pro Ala Gly Glu Ala Val Thr
Ala Ala130 135 140Glu Phe Arg Ile Tyr Lys
Val Pro Ser Ile His Leu Leu Asn Arg Thr145 150
155 160Leu His Val Ser Met Phe Gln Val Val Gln Glu
Gln Ser Asn Arg Glu165 170 175Ser Asp Leu
Phe Phe Leu Asp Leu Gln Thr Leu Arg Ala Gly Asp Glu180
185 190Gly Trp Leu Val Leu Asp Val Thr Ala Ala Ser Asp
Cys Trp Leu Leu195 200 205Lys Arg His Lys
Asp Leu Gly Leu Arg Leu Tyr Val Glu Thr Glu Asp210 215
220Gly His Ser Val Asp Pro Gly Leu Ala Gly Leu Leu Gly Gln
Arg Ala225 230 235 240Pro
Arg Ser Gln Gln Pro Phe Val Val Thr Phe Phe Arg Ala Ser Pro245
250 255Ser Pro Ile Arg Thr Pro Arg Ala Val Arg Pro
Leu Arg Arg Arg Gln260 265 270Pro Lys Lys
Ser Asn Glu Leu Pro Gln Ala Asn Arg Leu Pro Gly Ile275
280 285Phe Asp Asp Val His Gly Ser His Gly Arg Gln Val
Cys Arg Arg His290 295 300Glu Leu Tyr Val
Ser Phe Gln Asp Leu Gly Trp Leu Asp Trp Val Ile305 310
315 320Ala Pro Gln Gly Tyr Ser Ala Tyr Tyr
Cys Glu Gly Glu Cys Ser Phe325 330 335Pro
Leu Asp Ser Cys Met Asn Ala Thr Asn His Ala Ile Leu Gln Ser340
345 350Leu Val His Leu Met Lys Pro Asn Ala Val Pro
Lys Ala Cys Cys Ala355 360 365Pro Thr Lys
Leu Ser Ala Thr Ser Val Leu Tyr Tyr Asp Ser Ser Asn370
375 380Asn Val Ile Leu Arg Lys His Arg Asn Met Val Val
Lys Ala Cys Gly385 390 395
400Cys His96424PRTHomo sapiens 96Met Gly Ser Leu Val Leu Thr Leu Cys Ala
Leu Phe Cys Leu Ala Ala1 5 10
15Tyr Leu Val Ser Gly Ser Pro Ile Met Asn Leu Glu Gln Ser Pro Leu20
25 30Glu Glu Asp Met Ser Leu Phe Gly Asp
Val Phe Ser Glu Gln Asp Gly35 40 45Val
Asp Phe Asn Thr Leu Leu Gln Ser Met Lys Asp Glu Phe Leu Lys50
55 60Thr Leu Asn Leu Ser Asp Ile Pro Thr Gln Asp
Ser Ala Lys Val Asp65 70 75
80Pro Pro Glu Tyr Met Leu Glu Leu Tyr Asn Lys Phe Ala Thr Asp Arg85
90 95Thr Ser Met Pro Ser Ala Asn Ile Ile
Arg Ser Phe Lys Asn Glu Asp100 105 110Leu
Phe Ser Gln Pro Val Ser Phe Asn Gly Leu Arg Lys Tyr Pro Leu115
120 125Leu Phe Asn Val Ser Ile Pro His His Glu Glu
Val Ile Met Ala Glu130 135 140Leu Arg Leu
Tyr Thr Leu Val Gln Arg Asp Arg Met Ile Tyr Asp Gly145
150 155 160Val Asp Arg Lys Ile Thr Ile
Phe Glu Val Leu Glu Ser Lys Gly Asp165 170
175Asn Glu Gly Glu Arg Asn Met Leu Val Leu Val Ser Gly Glu Ile Tyr180
185 190Gly Thr Asn Ser Glu Trp Glu Thr Phe
Asp Val Thr Asp Ala Ile Arg195 200 205Arg
Trp Gln Lys Ser Gly Ser Ser Thr His Gln Leu Glu Val His Ile210
215 220Glu Ser Lys His Asp Glu Ala Glu Asp Ala Ser
Ser Gly Arg Leu Glu225 230 235
240Ile Asp Thr Ser Ala Gln Asn Lys His Asn Pro Leu Leu Ile Val
Phe245 250 255Ser Asp Asp Gln Ser Ser Asp
Lys Glu Arg Lys Glu Glu Leu Asn Glu260 265
270Met Ile Ser His Glu Gln Leu Pro Glu Leu Asp Asn Leu Gly Leu Asp275
280 285Ser Phe Ser Ser Gly Pro Gly Glu Glu
Ala Leu Leu Gln Met Arg Ser290 295 300Asn
Ile Ile Tyr Asp Ser Thr Ala Arg Ile Arg Arg Asn Ala Lys Gly305
310 315 320Asn Tyr Cys Lys Arg Thr
Pro Leu Tyr Ile Asp Phe Lys Glu Ile Gly325 330
335Trp Asp Ser Trp Ile Ile Ala Pro Pro Gly Tyr Glu Ala Tyr Glu
Cys340 345 350Arg Gly Val Cys Asn Tyr Pro
Leu Ala Glu His Leu Thr Pro Thr Lys355 360
365His Ala Ile Ile Gln Ala Leu Val His Leu Lys Asn Ser Gln Lys Ala370
375 380Ser Lys Ala Cys Cys Val Pro Thr Lys
Leu Glu Pro Ile Ser Ile Leu385 390 395
400Tyr Leu Asp Lys Gly Val Val Thr Tyr Lys Phe Lys Tyr Glu
Gly Met405 410 415Ala Val Ser Glu Cys Gly
Cys Arg42097372PRTHomo sapiens 97Met Pro Pro Pro Gln Gln Gly Pro Cys Gly
His His Leu Leu Leu Leu1 5 10
15Leu Ala Leu Leu Leu Pro Ser Leu Pro Leu Thr Arg Ala Pro Val Pro20
25 30Pro Gly Pro Ala Ala Ala Leu Leu Gln
Ala Leu Gly Leu Arg Asp Glu35 40 45Pro
Gln Gly Ala Pro Arg Leu Arg Pro Val Pro Pro Val Met Trp Arg50
55 60Leu Phe Arg Arg Arg Asp Pro Gln Glu Thr Arg
Ser Gly Ser Arg Arg65 70 75
80Thr Ser Pro Gly Val Thr Leu Gln Pro Cys His Val Glu Glu Leu Gly85
90 95Val Ala Gly Asn Ile Val Arg His Ile
Pro Asp Arg Gly Ala Pro Thr100 105 110Arg
Ala Ser Glu Pro Ala Ser Ala Ala Gly His Cys Pro Glu Trp Thr115
120 125Val Val Phe Asp Leu Ser Ala Val Glu Pro Ala
Glu Arg Pro Ser Arg130 135 140Ala Arg Leu
Glu Leu Arg Phe Ala Ala Ala Ala Ala Ala Ala Pro Glu145
150 155 160Gly Gly Trp Glu Leu Ser Val
Ala Gln Ala Gly Gln Gly Ala Gly Ala165 170
175Asp Pro Gly Pro Val Leu Leu Arg Gln Leu Val Pro Ala Leu Gly Pro180
185 190Pro Val Arg Ala Glu Leu Leu Gly Ala
Ala Trp Ala Arg Asn Ala Ser195 200 205Trp
Pro Arg Ser Leu Arg Leu Ala Leu Ala Leu Arg Pro Arg Ala Pro210
215 220Ala Ala Cys Ala Arg Leu Ala Glu Ala Ser Leu
Leu Leu Val Thr Leu225 230 235
240Asp Pro Arg Leu Cys His Pro Leu Ala Arg Pro Arg Arg Asp Ala
Glu245 250 255Pro Val Leu Gly Gly Gly Pro
Gly Gly Ala Cys Arg Ala Arg Arg Leu260 265
270Tyr Val Ser Phe Arg Glu Val Gly Trp His Arg Trp Val Ile Ala Pro275
280 285Arg Gly Phe Leu Ala Asn Tyr Cys Gln
Gly Gln Cys Ala Leu Pro Val290 295 300Ala
Leu Ser Gly Ser Gly Gly Pro Pro Ala Leu Asn His Ala Val Leu305
310 315 320Arg Ala Leu Met His Ala
Ala Ala Pro Gly Ala Ala Asp Leu Pro Cys325 330
335Cys Val Pro Ala Arg Leu Ser Pro Ile Ser Val Leu Phe Phe Asp
Asn340 345 350Ser Asp Asn Val Val Leu Arg
Gln Tyr Glu Asp Met Val Val Asp Glu355 360
365Cys Gly Cys Arg37098429PRTHomo sapiens 98Met Cys Pro Gly Ala Leu Trp
Val Ala Leu Pro Leu Leu Ser Leu Leu1 5 10
15Ala Gly Ser Leu Gln Gly Lys Pro Leu Gln Ser Trp Gly Arg
Gly Ser20 25 30Ala Gly Gly Asn Ala His
Ser Pro Leu Gly Val Pro Gly Gly Gly Leu35 40
45Pro Glu His Thr Phe Asn Leu Lys Met Phe Leu Glu Asn Val Lys Val50
55 60Asp Phe Leu Arg Ser Leu Asn Leu Ser
Gly Val Pro Ser Gln Asp Lys65 70 75
80Thr Arg Val Glu Pro Pro Gln Tyr Met Ile Asp Leu Tyr Asn
Arg Tyr85 90 95Thr Ser Asp Lys Ser Thr
Thr Pro Ala Ser Asn Ile Val Arg Ser Phe100 105
110Ser Met Glu Asp Ala Ile Ser Ile Thr Ala Thr Glu Asp Phe Pro
Phe115 120 125Gln Lys His Ile Leu Leu Phe
Asn Ile Ser Ile Pro Arg His Glu Gln130 135
140Ile Thr Arg Ala Glu Leu Arg Leu Tyr Val Ser Cys Gln Asn His Val145
150 155 160Asp Pro Ser His
Asp Leu Lys Gly Ser Val Val Ile Tyr Asp Val Leu165 170
175Asp Gly Thr Asp Ala Trp Asp Ser Ala Thr Glu Thr Lys Thr
Phe Leu180 185 190Val Ser Gln Asp Ile Gln
Asp Glu Gly Trp Glu Thr Leu Glu Val Ser195 200
205Ser Ala Val Lys Arg Trp Val Arg Ser Asp Ser Thr Lys Ser Lys
Asn210 215 220Lys Leu Glu Val Thr Val Glu
Ser His Arg Lys Gly Cys Asp Thr Leu225 230
235 240Asp Ile Ser Val Pro Pro Gly Ser Arg Asn Leu Pro
Phe Phe Val Val245 250 255Phe Ser Asn Asp
His Ser Ser Gly Thr Lys Glu Thr Arg Leu Glu Leu260 265
270Arg Glu Met Ile Ser His Glu Gln Glu Ser Val Leu Lys Lys
Leu Ser275 280 285Lys Asp Gly Ser Thr Glu
Ala Gly Glu Ser Ser His Glu Glu Asp Thr290 295
300Asp Gly His Val Ala Ala Gly Ser Thr Leu Ala Arg Arg Lys Arg
Ser305 310 315 320Ala Gly
Ala Gly Ser His Cys Gln Lys Thr Ser Leu Arg Val Asn Phe325
330 335Glu Asp Ile Gly Trp Asp Ser Trp Ile Ile Ala Pro
Lys Glu Tyr Glu340 345 350Ala Tyr Glu Cys
Lys Gly Gly Cys Phe Phe Pro Leu Ala Asp Asp Val355 360
365Thr Pro Thr Lys His Ala Ile Val Gln Thr Leu Val His Leu
Lys Phe370 375 380Pro Thr Lys Val Gly Lys
Ala Cys Cys Val Pro Thr Lys Leu Ser Pro385 390
395 400Ile Ser Val Leu Tyr Lys Asp Asp Met Gly Val
Pro Thr Leu Lys Tyr405 410 415His Tyr Glu
Gly Met Ser Val Ala Glu Cys Gly Cys Arg420
42599364PRTHomo sapiens 99Met Leu Arg Phe Leu Pro Asp Leu Ala Phe Ser Phe
Leu Leu Ile Leu1 5 10
15Ala Leu Gly Gln Ala Val Gln Phe Gln Glu Tyr Val Phe Leu Gln Phe20
25 30Leu Gly Leu Asp Lys Ala Pro Ser Pro Gln
Lys Phe Gln Pro Val Pro35 40 45Tyr Ile
Leu Lys Lys Ile Phe Gln Asp Arg Glu Ala Ala Ala Thr Thr50
55 60Gly Val Ser Arg Asp Leu Cys Tyr Val Lys Glu Leu
Gly Val Arg Gly65 70 75
80Asn Val Leu Arg Phe Leu Pro Asp Gln Gly Phe Phe Leu Tyr Pro Lys85
90 95Lys Ile Ser Gln Ala Ser Ser Cys Leu Gln
Lys Leu Leu Tyr Phe Asn100 105 110Leu Ser
Ala Ile Lys Glu Arg Glu Gln Leu Thr Leu Ala Gln Leu Gly115
120 125Leu Asp Leu Gly Pro Asn Ser Tyr Tyr Asn Leu Gly
Pro Glu Leu Glu130 135 140Leu Ala Leu Phe
Leu Val Gln Glu Pro His Val Trp Gly Gln Thr Thr145 150
155 160Pro Lys Pro Gly Lys Met Phe Val Leu
Arg Ser Val Pro Trp Pro Gln165 170 175Gly
Ala Val His Phe Asn Leu Leu Asp Val Ala Lys Asp Trp Asn Asp180
185 190Asn Pro Arg Lys Asn Phe Gly Leu Phe Leu Glu
Ile Leu Val Lys Glu195 200 205Asp Arg Asp
Ser Gly Val Asn Phe Gln Pro Glu Asp Thr Cys Ala Arg210
215 220Leu Arg Cys Ser Leu His Ala Ser Leu Leu Val Val
Thr Leu Asn Pro225 230 235
240Asp Gln Cys His Pro Ser Arg Lys Arg Arg Ala Ala Ile Pro Val Pro245
250 255Lys Leu Ser Cys Lys Asn Leu Cys His
Arg His Gln Leu Phe Ile Asn260 265 270Phe
Arg Asp Leu Gly Trp His Lys Trp Ile Ile Ala Pro Lys Gly Phe275
280 285Met Ala Asn Tyr Cys His Gly Glu Cys Pro Phe
Ser Leu Thr Ile Ser290 295 300Leu Asn Ser
Ser Asn Tyr Ala Phe Met Gln Ala Leu Met His Ala Val305
310 315 320Asp Pro Glu Ile Pro Gln Ala
Val Cys Ile Pro Thr Lys Leu Ser Pro325 330
335Ile Ser Met Leu Tyr Gln Asp Asn Asn Asp Asn Val Ile Leu Arg His340
345 350Tyr Glu Asp Met Val Val Asp Glu Cys
Gly Cys Gly355 360100501PRTHomo sapiens 100Met Arg Leu
Pro Lys Leu Leu Thr Phe Leu Leu Trp Tyr Leu Ala Trp1 5
10 15Leu Asp Leu Glu Phe Ile Cys Thr Val Leu
Gly Ala Pro Asp Leu Gly20 25 30Gln Arg
Pro Gln Gly Ser Arg Pro Gly Leu Ala Lys Ala Glu Ala Lys35
40 45Glu Arg Pro Pro Leu Ala Arg Asn Val Phe Arg Pro
Gly Gly His Ser50 55 60Tyr Gly Gly Gly
Ala Thr Asn Ala Asn Ala Arg Ala Lys Gly Gly Thr65 70
75 80Gly Gln Thr Gly Gly Leu Thr Gln Pro
Lys Lys Asp Glu Pro Lys Lys85 90 95Leu
Pro Pro Arg Pro Gly Gly Pro Glu Pro Lys Pro Gly His Pro Pro100
105 110Gln Thr Arg Gln Ala Thr Ala Arg Thr Val Thr
Pro Lys Gly Gln Leu115 120 125Pro Gly Gly
Lys Ala Pro Pro Lys Ala Gly Ser Val Pro Ser Ser Phe130
135 140Leu Leu Lys Lys Ala Arg Glu Pro Gly Pro Pro Arg
Glu Pro Lys Glu145 150 155
160Pro Phe Arg Pro Pro Pro Ile Thr Pro His Glu Tyr Met Leu Ser Leu165
170 175Tyr Arg Thr Leu Ser Asp Ala Asp Arg
Lys Gly Gly Asn Ser Ser Val180 185 190Lys
Leu Glu Ala Gly Leu Ala Asn Thr Ile Thr Ser Phe Ile Asp Lys195
200 205Gly Gln Asp Asp Arg Gly Pro Val Val Arg Lys
Gln Arg Tyr Val Phe210 215 220Asp Ile Ser
Ala Leu Glu Lys Asp Gly Leu Leu Gly Ala Glu Leu Arg225
230 235 240Ile Leu Arg Lys Lys Pro Ser
Asp Thr Ala Lys Pro Ala Val Pro Arg245 250
255Ser Arg Arg Ala Ala Gln Leu Lys Leu Ser Ser Cys Pro Ser Gly Arg260
265 270Gln Pro Ala Ala Leu Leu Asp Val Arg
Ser Val Pro Gly Leu Asp Gly275 280 285Ser
Gly Trp Glu Val Phe Asp Ile Trp Lys Leu Phe Arg Asn Phe Lys290
295 300Asn Ser Ala Gln Leu Cys Leu Glu Leu Glu Ala
Trp Glu Arg Gly Arg305 310 315
320Thr Val Asp Leu Arg Gly Leu Gly Phe Asp Arg Ala Ala Arg Gln
Val325 330 335His Glu Lys Ala Leu Phe Leu
Val Phe Gly Arg Thr Lys Lys Arg Asp340 345
350Leu Phe Phe Asn Glu Ile Lys Ala Arg Ser Gly Gln Asp Asp Lys Thr355
360 365Val Tyr Glu Tyr Leu Phe Ser Gln Arg
Arg Lys Arg Arg Ala Pro Ser370 375 380Ala
Thr Arg Gln Gly Lys Arg Pro Ser Lys Asn Leu Lys Ala Arg Cys385
390 395 400Ser Arg Lys Ala Leu His
Val Asn Phe Lys Asp Met Gly Trp Asp Asp405 410
415Trp Ile Ile Ala Pro Leu Glu Tyr Glu Ala Phe His Cys Glu Gly
Leu420 425 430Cys Glu Phe Pro Leu Arg Ser
His Leu Glu Pro Thr Asn His Ala Val435 440
445Ile Gln Thr Leu Met Asn Ser Met Asp Pro Glu Ser Thr Pro Pro Thr450
455 460Cys Cys Val Pro Thr Arg Leu Ser Pro
Ile Ser Ile Leu Phe Ile Asp465 470 475
480Ser Ala Asn Asn Val Val Tyr Lys Gln Tyr Glu Asp Met Val
Val Glu485 490 495Ser Cys Gly Cys
Arg500101321PRTHomo sapiens 101Asn Ser Asp Leu Ser His Thr Pro Leu Arg
Arg Gln Lys Tyr Leu Phe1 5 10
15Asp Val Ser Met Leu Ser Asp Lys Glu Glu Leu Val Gly Ala Glu Leu20
25 30Arg Leu Phe Arg Gln Ala Pro Ser Ala
Pro Trp Gly Pro Pro Ala Gly35 40 45Pro
Leu His Val Gln Leu Phe Pro Cys Leu Ser Pro Leu Leu Leu Asp50
55 60Ala Arg Thr Leu Asp Pro Gln Gly Ala Pro Pro
Ala Gly Trp Glu Val65 70 75
80Phe Asp Val Trp Gln Gly Leu Arg His Gln Pro Trp Lys Gln Leu Cys85
90 95Leu Glu Leu Arg Ala Ala Trp Gly Glu
Leu Asp Ala Gly Glu Ala Glu100 105 110Ala
Arg Ala Arg Gly Pro Gln Gln Pro Pro Pro Pro Asp Leu Arg Ser115
120 125Leu Gly Phe Gly Arg Arg Val Arg Pro Pro Gln
Glu Arg Ala Leu Leu130 135 140Val Val Phe
Thr Arg Ser Gln Arg Lys Asn Leu Phe Ala Glu Met Arg145
150 155 160Glu Gln Leu Gly Ser Ala Glu
Ala Ala Gly Pro Gly Ala Gly Ala Glu165 170
175Gly Ser Trp Pro Pro Pro Ser Gly Ala Pro Asp Ala Arg Pro Trp Leu180
185 190Pro Ser Pro Gly Arg Arg Arg Arg Arg
Thr Ala Phe Ala Ser Arg His195 200 205Gly
Lys Arg His Gly Lys Lys Ser Arg Leu Arg Cys Ser Lys Lys Pro210
215 220Leu His Val Asn Phe Lys Glu Leu Gly Trp Asp
Asp Trp Ile Ile Ala225 230 235
240Pro Leu Glu Tyr Glu Ala Tyr His Cys Glu Gly Val Cys Asp Phe
Pro245 250 255Leu Arg Ser His Leu Glu Pro
Thr Asn His Ala Ile Ile Gln Thr Leu260 265
270Met Asn Ser Met Asp Pro Gly Ser Thr Pro Pro Ser Cys Cys Val Pro275
280 285Thr Lys Leu Thr Pro Ile Ser Ile Leu
Tyr Ile Asp Ala Gly Asn Asn290 295 300Val
Val Tyr Lys Gln Tyr Glu Asp Met Val Val Glu Ser Cys Gly Cys305
310 315 320Arg102388PRTHomo sapiens
102Pro Gly Arg Arg Arg Pro Leu Leu Trp Ala Arg Leu Ala Ala Phe Arg1
5 10 15Leu Gly Gln Arg Arg Gly
Val Gly Arg Trp Leu Gln Gln Ala Trp Leu20 25
30Pro His Arg Arg Gln Leu Gly His Leu Leu Leu Gly Gly Pro Ala Leu35
40 45Thr Val Cys Arg Ile Cys Ser Tyr Thr
Ala Leu Ser Leu Cys Pro Cys50 55 60Arg
Ser Pro Ala Asp Glu Ser Ala Ala Glu Thr Gly Gln Ser Phe Leu65
70 75 80Phe Asp Val Ser Ser Leu
Asn Asp Ala Asp Glu Val Val Gly Ala Glu85 90
95Leu Arg Val Leu Arg Arg Gly Ser Pro Glu Ser Gly Pro Gly Ser Trp100
105 110Thr Ser Pro Pro Leu Leu Leu Leu
Ser Thr Cys Pro Gly Ala Ala Arg115 120
125Ala Pro Arg Leu Leu Tyr Ser Arg Ala Ala Glu Pro Leu Val Gly Gln130
135 140Arg Trp Glu Ala Phe Asp Val Ala Asp
Ala Met Arg Arg His Arg Arg145 150 155
160Glu Pro Arg Pro Pro Arg Ala Phe Cys Leu Leu Leu Arg Ala
Val Ala165 170 175Gly Pro Val Pro Ser Pro
Leu Ala Leu Arg Arg Leu Gly Phe Gly Trp180 185
190Pro Gly Gly Gly Gly Ser Ala Ala Glu Glu Arg Ala Val Leu Val
Val195 200 205Ser Ser Arg Thr Gln Arg Lys
Glu Ser Leu Phe Arg Glu Ile Arg Ala210 215
220Gln Ala Arg Ala Leu Gly Ala Ala Leu Ala Ser Glu Pro Leu Pro Asp225
230 235 240Pro Gly Thr Gly
Thr Ala Ser Pro Arg Ala Val Ile Gly Gly Arg Arg245 250
255Arg Arg Arg Thr Ala Leu Ala Gly Thr Arg Thr Ala Gln Gly
Ser Gly260 265 270Gly Gly Ala Gly Arg Gly
His Gly Arg Arg Gly Arg Ser Arg Cys Ser275 280
285Arg Lys Pro Leu His Val Asp Phe Lys Glu Leu Gly Trp Asp Asp
Trp290 295 300Ile Ile Ala Pro Leu Asp Tyr
Glu Ala Tyr His Cys Glu Gly Leu Cys305 310
315 320Asp Phe Pro Leu Arg Ser His Leu Glu Pro Thr Asn
His Ala Ile Ile325 330 335Gln Thr Leu Leu
Asn Ser Met Ala Pro Asp Ala Ala Pro Ala Ser Cys340 345
350Cys Val Pro Ala Arg Leu Ser Pro Ile Ser Ile Leu Tyr Ile
Asp Ala355 360 365Ala Asn Asn Val Val Tyr
Lys Gln Tyr Glu Asp Met Val Val Glu Ala370 375
380Cys Gly Cys Arg385103375PRTHomo sapiens 103Met Gln Lys Leu Gln
Leu Cys Val Tyr Ile Tyr Leu Phe Met Leu Ile1 5
10 15Val Ala Gly Pro Val Asp Leu Asn Glu Asn Ser Glu
Gln Lys Glu Asn20 25 30Val Glu Lys Glu
Gly Leu Cys Asn Ala Cys Thr Trp Arg Gln Asn Thr35 40
45Lys Ser Ser Arg Ile Glu Ala Ile Lys Ile Gln Ile Leu Ser
Lys Leu50 55 60Arg Leu Glu Thr Ala Pro
Asn Ile Ser Lys Asp Val Ile Arg Gln Leu65 70
75 80Leu Pro Lys Ala Pro Pro Leu Arg Glu Leu Ile
Asp Gln Tyr Asp Val85 90 95Gln Arg Asp
Asp Ser Ser Asp Gly Ser Leu Glu Asp Asp Asp Tyr His100
105 110Ala Thr Thr Glu Thr Ile Ile Thr Met Pro Thr Glu
Ser Asp Phe Leu115 120 125Met Gln Val Asp
Gly Lys Pro Lys Cys Cys Phe Phe Lys Phe Ser Ser130 135
140Lys Ile Gln Tyr Asn Lys Val Val Lys Ala Gln Leu Trp Ile
Tyr Leu145 150 155 160Arg
Pro Val Glu Thr Pro Thr Thr Val Phe Val Gln Ile Leu Arg Leu165
170 175Ile Lys Pro Met Lys Asp Gly Thr Arg Tyr Thr
Gly Ile Arg Ser Leu180 185 190Lys Leu Asp
Met Asn Pro Gly Thr Gly Ile Trp Gln Ser Ile Asp Val195
200 205Lys Thr Val Leu Gln Asn Trp Leu Lys Gln Pro Glu
Ser Asn Leu Gly210 215 220Ile Glu Ile Lys
Ala Leu Asp Glu Asn Gly His Asp Leu Ala Val Thr225 230
235 240Phe Pro Gly Pro Gly Glu Asp Gly Leu
Asn Pro Phe Leu Glu Val Lys245 250 255Val
Thr Asp Thr Pro Lys Arg Ser Arg Arg Asp Phe Gly Leu Asp Cys260
265 270Asp Glu His Ser Thr Glu Ser Arg Cys Cys Arg
Tyr Pro Leu Thr Val275 280 285Asp Phe Glu
Ala Phe Gly Trp Asp Trp Ile Ile Ala Pro Lys Arg Tyr290
295 300Lys Ala Asn Tyr Cys Ser Gly Glu Cys Glu Phe Val
Phe Leu Gln Lys305 310 315
320Tyr Pro His Thr His Leu Val His Gln Ala Asn Pro Arg Gly Ser Ala325
330 335Gly Pro Cys Cys Thr Pro Thr Lys Met
Ser Pro Ile Asn Met Leu Tyr340 345 350Phe
Asn Gly Lys Glu Gln Ile Ile Tyr Gly Lys Ile Pro Ala Met Val355
360 365Val Asp Arg Cys Gly Cys Ser370
375104478PRTHomo sapiens 104Met Ala His Val Pro Ala Arg Thr Ser Pro Gly
Pro Gly Pro Gln Leu1 5 10
15Leu Leu Leu Leu Leu Pro Leu Phe Leu Leu Leu Leu Arg Asp Val Ala20
25 30Gly Ser His Arg Ala Pro Ala Trp Ser Ala
Leu Pro Ala Ala Ala Asp35 40 45Gly Leu
Gln Gly Asp Arg Asp Leu Gln Arg His Pro Gly Asp Ala Ala50
55 60Ala Thr Leu Gly Pro Ser Ala Gln Asp Met Val Ala
Val His Met His65 70 75
80Arg Leu Tyr Glu Lys Tyr Ser Arg Gln Gly Ala Arg Pro Gly Gly Gly85
90 95Asn Thr Val Arg Ser Phe Arg Ala Arg Leu
Glu Val Val Asp Gln Lys100 105 110Ala Val
Tyr Phe Phe Asn Leu Thr Ser Met Gln Asp Ser Glu Met Ile115
120 125Leu Thr Ala Thr Phe His Phe Tyr Ser Glu Pro Pro
Arg Trp Pro Arg130 135 140Ala Leu Glu Val
Leu Cys Lys Pro Arg Ala Lys Asn Ala Ser Gly Arg145 150
155 160Pro Leu Pro Leu Gly Pro Pro Thr Arg
Gln His Leu Leu Phe Arg Ser165 170 175Leu
Ser Gln Asn Thr Ala Thr Gln Gly Leu Leu Arg Gly Ala Met Ala180
185 190Leu Ala Pro Pro Pro Arg Gly Leu Trp Gln Ala
Lys Asp Ile Ser Pro195 200 205Ile Val Lys
Ala Ala Arg Arg Asp Gly Glu Leu Leu Leu Ser Ala Gln210
215 220Leu Asp Ser Glu Glu Arg Asp Pro Gly Val Pro Arg
Pro Ser Pro Tyr225 230 235
240Ala Pro Tyr Ile Leu Val Tyr Ala Asn Asp Leu Ala Ile Ser Glu Pro245
250 255Asn Ser Val Ala Val Thr Leu Gln Arg
Tyr Asp Pro Phe Pro Ala Gly260 265 270Asp
Pro Glu Pro Arg Ala Ala Pro Asn Asn Ser Ala Asp Pro Arg Val275
280 285Arg Arg Ala Ala Gln Ala Thr Gly Pro Leu Gln
Asp Asn Glu Leu Pro290 295 300Gly Leu Asp
Glu Arg Pro Pro Arg Ala His Ala Gln His Phe His Lys305
310 315 320His Gln Leu Trp Pro Ser Pro
Phe Arg Ala Leu Lys Pro Arg Pro Gly325 330
335Arg Lys Asp Arg Arg Lys Lys Gly Gln Glu Val Phe Met Ala Ala Ser340
345 350Gln Val Leu Asp Phe Asp Glu Lys Thr
Met Gln Lys Ala Arg Arg Lys355 360 365Gln
Trp Asp Glu Pro Arg Val Cys Ser Arg Arg Tyr Leu Lys Val Asp370
375 380Phe Ala Asp Ile Gly Trp Asn Glu Trp Ile Ile
Ser Pro Lys Ser Phe385 390 395
400Asp Ala Tyr Tyr Cys Ala Gly Ala Cys Glu Phe Pro Met Pro Lys
Ile405 410 415Val Arg Pro Ser Asn His Ala
Thr Ile Gln Ser Ile Val Arg Ala Val420 425
430Gly Ile Ile Pro Gly Ile Pro Glu Pro Cys Cys Val Pro Asp Lys Met435
440 445Asn Ser Leu Gly Val Leu Phe Leu Asp
Glu Asn Arg Asn Val Val Leu450 455 460Lys
Val Tyr Pro Asn Met Ser Val Asp Thr Cys Ala Cys Arg465
470 475105407PRTHomo sapiens 105Met Val Leu Ala Ala Pro
Leu Leu Leu Gly Phe Leu Leu Leu Ala Leu1 5
10 15Glu Leu Arg Pro Arg Gly Glu Ala Ala Glu Gly Pro Ala
Ala Ala Ala20 25 30Ala Ala Ala Ala Ala
Ala Ala Ala Ala Gly Val Gly Gly Glu Arg Ser35 40
45Ser Arg Pro Ala Pro Ser Val Ala Pro Glu Pro Asp Gly Cys Pro
Val50 55 60Cys Val Trp Arg Gln His Ser
Arg Glu Leu Arg Leu Glu Ser Ile Lys65 70
75 80Ser Gln Ile Leu Ser Lys Leu Arg Leu Lys Glu Ala
Pro Asn Ile Ser85 90 95Arg Glu Val Val
Lys Gln Leu Leu Pro Lys Ala Pro Pro Leu Gln Gln100 105
110Ile Leu Asp Leu His Asp Phe Gln Gly Asp Ala Leu Gln Pro
Glu Asp115 120 125Phe Leu Glu Glu Asp Glu
Tyr His Ala Thr Thr Glu Thr Val Ile Ser130 135
140Met Ala Gln Glu Thr Asp Pro Ala Val Gln Thr Asp Gly Ser Pro
Leu145 150 155 160Cys Cys
His Phe His Phe Ser Pro Lys Val Met Phe Thr Lys Val Leu165
170 175Lys Ala Gln Leu Trp Val Tyr Leu Arg Pro Val Pro
Arg Pro Ala Thr180 185 190Val Tyr Leu Gln
Ile Leu Arg Leu Lys Pro Leu Thr Gly Glu Gly Thr195 200
205Ala Gly Gly Gly Gly Gly Gly Arg Arg His Ile Arg Ile Arg
Ser Leu210 215 220Lys Ile Glu Leu His Ser
Arg Ser Gly His Trp Gln Ser Ile Asp Phe225 230
235 240Lys Gln Val Leu His Ser Trp Phe Arg Gln Pro
Gln Ser Asn Trp Gly245 250 255Ile Glu Ile
Asn Ala Phe Asp Pro Ser Gly Thr Asp Leu Ala Val Thr260
265 270Ser Leu Gly Pro Gly Ala Glu Gly Leu His Pro Phe
Met Glu Leu Arg275 280 285Val Leu Glu Asn
Thr Lys Arg Ser Arg Arg Asn Leu Gly Leu Asp Cys290 295
300Asp Glu His Ser Ser Glu Ser Arg Cys Cys Arg Tyr Pro Leu
Thr Val305 310 315 320Asp
Phe Glu Ala Phe Gly Trp Asp Trp Ile Ile Ala Pro Lys Arg Tyr325
330 335Lys Ala Asn Tyr Cys Ser Gly Gln Cys Glu Tyr
Met Phe Met Gln Lys340 345 350Tyr Pro His
Thr His Leu Val Gln Gln Ala Asn Pro Arg Gly Ser Ala355
360 365Gly Pro Cys Cys Thr Pro Thr Lys Met Ser Pro Ile
Asn Met Leu Tyr370 375 380Phe Asn Asp Lys
Gln Gln Ile Ile Tyr Gly Lys Ile Pro Gly Met Val385 390
395 400Val Asp Arg Cys Gly Cys
Ser405106309PRTHomo sapiens 106Met Pro Gly Gln Glu Leu Arg Thr Leu Asn
Gly Ser Gln Met Leu Leu1 5 10
15Val Leu Leu Val Leu Ser Trp Leu Pro His Gly Gly Ala Leu Ser Leu20
25 30Ala Glu Ala Ser Arg Ala Ser Phe Pro
Gly Pro Ser Glu Glu Leu His35 40 45Thr
Glu Asp Ser Phe Arg Arg Glu Leu Arg Lys Arg Tyr Glu Asp Leu50
55 60Leu Thr Arg Leu Arg Ala Asn Gln Ser Trp Glu
Asp Ser Asn Thr Asp65 70 75
80Leu Val Pro Ala Pro Ala Val Arg Ile Leu Thr Pro Glu Val Arg Leu85
90 95Gly Ser Gly Gly His Leu His Leu Arg
Ile Ser Arg Ala Ala Leu Pro100 105 110Glu
Gly Leu Pro Glu Ala Ser Arg Leu His Arg Ala Leu Phe Arg Leu115
120 125Ser Pro Thr Ala Ser Arg Ser Trp Asp Val Thr
Arg Pro Leu Arg Arg130 135 140Gln Leu Ser
Leu Ala Arg Pro Gln Ala Pro Ala Leu His Leu Arg Leu145
150 155 160Ser Pro Pro Pro Ser Gln Ser
Asp Gln Leu Leu Ala Glu Ser Ser Ser165 170
175Ala Arg Pro Gln Leu Glu Leu His Leu Arg Pro Gln Ala Ala Arg Gly180
185 190Arg Arg Arg Ala Arg Ala Arg Asn Gly
Asp His Cys Pro Leu Gly Pro195 200 205Gly
Arg Cys Cys Arg Leu His Thr Val Arg Ala Ser Leu Glu Asp Leu210
215 220Gly Trp Ala Asp Trp Val Leu Ser Pro Arg Glu
Val Gln Val Thr Met225 230 235
240Cys Ile Gly Ala Cys Pro Ser Gln Phe Arg Ala Ala Asn Met His
Ala245 250 255Gln Ile Lys Thr Ser Leu His
Arg Leu Lys Pro Asp Thr Val Pro Ala260 265
270Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro Met Val Leu Ile Gln Lys275
280 285Thr Asp Thr Gly Val Ser Leu Gln Thr
Tyr Asp Asp Leu Leu Ala Lys290 295 300Asp
Cys His Cys Ile305107426PRTHomo sapiens 107Met Pro Leu Leu Trp Leu Arg
Gly Phe Leu Leu Ala Ser Cys Trp Ile1 5 10
15Ile Val Arg Ser Ser Pro Thr Pro Gly Ser Glu Gly His Ser
Ala Ala20 25 30Pro Asp Cys Pro Ser Cys
Ala Leu Ala Ala Leu Pro Lys Asp Val Pro35 40
45Asn Ser Gln Pro Glu Met Val Glu Ala Val Lys Lys His Ile Leu Asn50
55 60Met Leu His Leu Lys Lys Arg Pro Asp
Val Thr Gln Pro Val Pro Lys65 70 75
80Ala Ala Leu Leu Asn Ala Ile Arg Lys Leu His Val Gly Lys
Val Gly85 90 95Glu Asn Gly Tyr Val Glu
Ile Glu Asp Asp Ile Gly Arg Arg Ala Glu100 105
110Met Asn Glu Leu Met Glu Gln Thr Ser Glu Ile Ile Thr Phe Ala
Glu115 120 125Ser Gly Thr Ala Arg Lys Thr
Leu His Phe Glu Ile Ser Lys Glu Gly130 135
140Ser Asp Leu Ser Val Val Glu Arg Ala Glu Val Trp Leu Phe Leu Lys145
150 155 160Val Pro Lys Ala
Asn Arg Thr Arg Thr Lys Val Thr Ile Arg Leu Phe165 170
175Gln Gln Gln Lys His Pro Gln Gly Ser Leu Asp Thr Gly Glu
Glu Ala180 185 190Glu Glu Val Gly Leu Lys
Gly Glu Arg Ser Glu Leu Leu Leu Ser Glu195 200
205Lys Val Val Asp Ala Arg Lys Ser Thr Trp His Val Phe Pro Val
Ser210 215 220Ser Ser Ile Gln Arg Leu Leu
Asp Gln Gly Lys Ser Ser Leu Asp Val225 230
235 240Arg Ile Ala Cys Glu Gln Cys Gln Glu Ser Gly Ala
Ser Leu Val Leu245 250 255Leu Gly Lys Lys
Lys Lys Lys Glu Glu Glu Gly Glu Gly Lys Lys Lys260 265
270Gly Gly Gly Glu Gly Gly Ala Gly Ala Asp Glu Glu Lys Glu
Gln Ser275 280 285His Arg Pro Phe Leu Met
Leu Gln Ala Arg Gln Ser Glu Asp His Pro290 295
300His Arg Arg Arg Arg Arg Gly Leu Glu Cys Asp Gly Lys Val Asn
Ile305 310 315 320Cys Cys
Lys Lys Gln Phe Phe Val Ser Phe Lys Asp Ile Gly Trp Asn325
330 335Asp Trp Ile Ile Ala Pro Ser Gly Tyr His Ala Asn
Tyr Cys Glu Gly340 345 350Glu Cys Pro Ser
His Ile Ala Gly Thr Ser Gly Ser Ser Leu Ser Phe355 360
365His Ser Thr Val Ile Asn His Tyr Arg Met Arg Gly His Ser
Pro Phe370 375 380Ala Asn Leu Lys Ser Cys
Cys Val Pro Thr Lys Leu Arg Pro Met Ser385 390
395 400Met Leu Tyr Tyr Asp Asp Gly Gln Asn Ile Ile
Lys Lys Asp Ile Gln405 410 415Asn Met Ile
Val Glu Glu Cys Gly Cys Ser420 425108407PRTHomo sapiens
108Met Asp Gly Leu Pro Gly Arg Ala Leu Gly Ala Ala Cys Leu Leu Leu1
5 10 15Leu Ala Ala Gly Trp Leu
Gly Pro Glu Ala Trp Gly Ser Pro Thr Pro20 25
30Pro Pro Thr Pro Ala Ala Pro Pro Pro Pro Pro Pro Pro Gly Ala Pro35
40 45Gly Gly Ser Gln Asp Thr Cys Thr Ser
Cys Gly Gly Phe Arg Arg Pro50 55 60Glu
Glu Leu Gly Arg Val Asp Gly Asp Phe Leu Glu Ala Val Lys Arg65
70 75 80His Ile Leu Ser Arg Leu
Gln Met Arg Gly Arg Pro Asn Ile Thr His85 90
95Ala Val Pro Lys Ala Ala Met Val Thr Ala Leu Arg Lys Leu His Ala100
105 110Gly Lys Val Arg Glu Asp Gly Arg
Val Glu Ile Pro His Leu Asp Gly115 120
125His Ala Ser Pro Gly Ala Asp Gly Gln Glu Arg Val Ser Glu Ile Ile130
135 140Ser Phe Ala Glu Thr Asp Gly Leu Ala
Ser Ser Arg Val Arg Leu Tyr145 150 155
160Phe Phe Ile Ser Asn Glu Gly Asn Gln Asn Leu Phe Val Val
Gln Ala165 170 175Ser Leu Trp Leu Tyr Leu
Lys Leu Leu Pro Tyr Val Leu Glu Lys Gly180 185
190Ser Arg Arg Lys Val Arg Val Lys Val Tyr Phe Gln Glu Gln Gly
His195 200 205Gly Asp Arg Trp Asn Met Val
Glu Lys Arg Val Asp Leu Lys Arg Ser210 215
220Gly Trp His Thr Phe Pro Leu Thr Glu Ala Ile Gln Ala Leu Phe Glu225
230 235 240Arg Gly Glu Arg
Arg Leu Asn Leu Asp Val Gln Cys Asp Ser Cys Gln245 250
255Glu Leu Ala Val Val Pro Val Phe Val Asp Pro Gly Glu Glu
Ser His260 265 270Arg Pro Phe Val Val Val
Gln Ala Arg Leu Gly Asp Ser Arg His Arg275 280
285Ile Arg Lys Arg Gly Leu Glu Cys Asp Gly Arg Thr Asn Leu Cys
Cys290 295 300Arg Gln Gln Phe Phe Ile Asp
Phe Arg Leu Ile Gly Trp Asn Asp Trp305 310
315 320Ile Ile Ala Pro Thr Gly Tyr Tyr Gly Asn Tyr Cys
Glu Gly Ser Cys325 330 335Pro Ala Tyr Leu
Ala Gly Val Pro Gly Ser Ala Ser Ser Phe His Thr340 345
350Ala Val Val Asn Gln Tyr Arg Met Arg Gly Leu Asn Pro Gly
Thr Val355 360 365Asn Ser Cys Cys Ile Pro
Thr Lys Leu Ser Thr Met Ser Met Leu Tyr370 375
380Phe Asp Asp Glu Tyr Asn Ile Val Lys Arg Asp Val Pro Asn Met
Ile385 390 395 400Val Glu
Glu Cys Gly Cys Ala405109352PRTHomo sapiens 109Met Thr Ser Ser Leu Leu
Leu Ala Phe Leu Leu Leu Ala Pro Thr Thr1 5
10 15Val Ala Thr Pro Arg Ala Gly Gly Gln Cys Pro Ala Cys
Gly Gly Pro20 25 30Thr Leu Glu Leu Glu
Ser Gln Arg Glu Leu Leu Leu Asp Leu Ala Lys35 40
45Arg Ser Ile Leu Asp Lys Leu His Leu Thr Gln Arg Pro Thr Leu
Asn50 55 60Arg Pro Val Ser Arg Ala Ala
Leu Arg Thr Ala Leu Gln His Leu His65 70
75 80Gly Val Pro Gln Gly Ala Leu Leu Glu Asp Asn Arg
Glu Gln Glu Cys85 90 95Glu Ile Ile Ser
Phe Ala Glu Thr Gly Leu Ser Thr Ile Asn Gln Thr100 105
110Arg Leu Asp Phe His Phe Ser Ser Asp Arg Thr Ala Gly Asp
Arg Glu115 120 125Val Gln Gln Ala Ser Leu
Met Phe Phe Val Gln Leu Pro Ser Asn Thr130 135
140Thr Trp Thr Leu Lys Val Arg Val Leu Val Leu Gly Pro His Asn
Thr145 150 155 160Asn Leu
Thr Leu Ala Thr Gln Tyr Leu Leu Glu Val Asp Ala Ser Gly165
170 175Trp His Gln Leu Pro Leu Gly Pro Glu Ala Gln Ala
Ala Cys Ser Gln180 185 190Gly His Leu Thr
Leu Glu Leu Val Leu Glu Gly Gln Val Ala Gln Ser195 200
205Ser Val Ile Leu Gly Gly Ala Ala His Arg Pro Phe Val Ala
Ala Arg210 215 220Val Arg Val Gly Gly Lys
His Gln Ile His Arg Arg Gly Ile Asp Cys225 230
235 240Gln Gly Gly Ser Arg Met Cys Cys Arg Gln Glu
Phe Phe Val Asp Phe245 250 255Arg Glu Ile
Gly Trp His Asp Trp Ile Ile Gln Pro Glu Gly Tyr Ala260
265 270Met Asn Phe Cys Ile Gly Gln Cys Pro Leu His Ile
Ala Gly Met Pro275 280 285Gly Ile Ala Ala
Ser Phe His Thr Ala Val Leu Asn Leu Leu Lys Ala290 295
300Asn Thr Ala Ala Gly Thr Thr Gly Gly Gly Ser Cys Cys Val
Pro Thr305 310 315 320Ala
Arg Arg Pro Leu Ser Leu Leu Tyr Tyr Asp Arg Asp Ser Asn Ile325
330 335Val Lys Thr Asp Ile Pro Asp Met Val Val Glu
Ala Cys Gly Cys Ser340 345
350110350PRTMus musculus 110Met Lys Leu Pro Lys Ala Gln Leu Trp Leu Ile
Leu Leu Trp Ala Leu1 5 10
15Val Trp Val Gln Ser Arg Arg Ser Ala Cys Pro Ser Cys Gly Gly Pro20
25 30Thr Leu Ala Pro Gln Gly Glu Arg Ala Leu
Val Leu Glu Leu Ala Lys35 40 45Gln Gln
Ile Leu Glu Gly Leu His Leu Thr Ser Arg Pro Arg Ile Thr50
55 60Arg Pro Leu Pro Gln Ala Ala Leu Thr Arg Ala Leu
Arg Arg Leu Gln65 70 75
80Pro Lys Ser Met Val Pro Gly Asn Arg Glu Lys Val Ile Ser Phe Ala85
90 95Thr Ile Ile Asp Lys Ser Thr Ser Thr Tyr
Arg Ser Met Leu Thr Phe100 105 110Gln Leu
Ser Pro Leu Trp Ser His His Leu Tyr His Ala Arg Leu Trp115
120 125Leu His Val Pro Pro Ser Phe Pro Gly Thr Leu Tyr
Leu Arg Ile Phe130 135 140Arg Cys Gly Thr
Thr Arg Cys Arg Gly Phe Arg Thr Phe Leu Ala Glu145 150
155 160His Gln Thr Thr Ser Ser Gly Trp His
Ala Leu Thr Leu Pro Ser Ser165 170 175Gly
Leu Arg Ser Glu Asp Ser Gly Val Val Lys Leu Gln Leu Glu Phe180
185 190Arg Pro Leu Asp Leu Asn Ser Thr Ala Ala Gly
Leu Pro Arg Leu Leu195 200 205Leu Asp Thr
Ala Gly Gln Gln Arg Pro Phe Leu Glu Leu Lys Ile Arg210
215 220Ala Asn Glu Pro Gly Ala Gly Arg Ala Arg Arg Arg
Thr Pro Thr Cys225 230 235
240Glu Pro Glu Thr Pro Leu Cys Cys Arg Arg Asp His Tyr Val Asp Phe245
250 255Gln Glu Leu Gly Trp Arg Asp Trp Ile
Leu Gln Pro Glu Gly Tyr Gln260 265 270Leu
Asn Tyr Cys Ser Gly Gln Cys Pro Pro His Leu Ala Gly Ser Pro275
280 285Gly Ile Ala Ala Ser Phe His Ser Ala Val Phe
Ser Leu Leu Lys Ala290 295 300Asn Asn Pro
Trp Pro Ala Gly Ser Ser Cys Cys Val Pro Thr Ala Arg305
310 315 320Arg Pro Leu Ser Leu Leu Tyr
Leu Asp His Asn Gly Asn Val Val Lys325 330
335Thr Asp Val Pro Asp Met Val Val Glu Ala Cys Gly Cys Ser340
345 350111351PRTHomo sapiens 111Gly Val Ser Ser Gln
Gly Leu Glu Leu Ala Arg Glu Leu Val Leu Ala1 5
10 15Lys Val Arg Ala Leu Phe Leu Asp Ala Leu Gly Pro
Pro Ala Val Thr20 25 30Arg Glu Gly Gly
Asp Pro Gly Val Arg Arg Leu Pro Arg Arg His Ala35 40
45Leu Gly Gly Phe Thr His Arg Gly Ser Glu Pro Glu Glu Glu
Glu Asp50 55 60Val Ser Gln Ala Ile Leu
Phe Pro Ala Thr Asp Ala Ser Cys Glu Asp65 70
75 80Lys Ser Ala Ala Arg Gly Leu Ala Gln Glu Ala
Glu Glu Gly Leu Phe85 90 95Arg Tyr Met
Phe Arg Pro Ser Gln His Thr Arg Ser Arg Gln Val Thr100
105 110Ser Ala Gln Leu Trp Phe His Thr Gly Leu Asp Arg
Gln Gly Thr Ala115 120 125Ala Ser Asn Ser
Ser Glu Pro Leu Leu Gly Leu Leu Ala Leu Ser Pro130 135
140Gly Gly Pro Val Ala Val Pro Met Ser Leu Gly His Ala Pro
Pro His145 150 155 160Trp
Ala Val Leu His Leu Ala Thr Ser Ala Leu Ser Leu Leu Thr His165
170 175Pro Val Leu Val Leu Leu Leu Arg Cys Pro Leu
Cys Thr Cys Ser Ala180 185 190Arg Pro Glu
Ala Thr Pro Phe Leu Val Ala His Thr Arg Thr Arg Pro195
200 205Pro Ser Gly Gly Glu Arg Ala Arg Arg Ser Thr Pro
Leu Met Ser Trp210 215 220Pro Trp Ser Pro
Ser Ala Leu Arg Leu Leu Gln Arg Pro Pro Glu Glu225 230
235 240Pro Ala Ala His Ala Asn Cys His Arg
Val Ala Leu Asn Ile Ser Phe245 250 255Gln
Glu Leu Gly Trp Glu Arg Trp Ile Val Tyr Pro Pro Ser Phe Ile260
265 270Phe His Tyr Cys His Gly Gly Cys Gly Leu His
Ile Pro Pro Asn Leu275 280 285Ser Leu Pro
Val Pro Gly Ala Pro Pro Thr Pro Ala Gln Pro Tyr Ser290
295 300Leu Leu Pro Gly Ala Gln Pro Cys Cys Ala Ala Leu
Pro Gly Thr Met305 310 315
320Arg Pro Leu His Val Arg Thr Thr Ser Asp Gly Gly Tyr Ser Phe Lys325
330 335Tyr Glu Thr Val Pro Asn Leu Leu Thr
Gln His Cys Ala Cys Ile340 345
350112371PRTHomo sapiens 112Met Thr Asp Arg Gln Thr Asp Thr Ala Pro Ser
Pro Ser Tyr His Leu1 5 10
15Leu Pro Gly Arg Arg Arg Thr Val Asp Ala Ala Ala Ser Arg Gly Gln20
25 30Gly Pro Glu Pro Ala Pro Gly Gly Gly Val
Glu Gly Val Gly Ala Arg35 40 45Gly Val
Ala Leu Lys Leu Phe Val Gln Leu Leu Gly Cys Ser Arg Phe50
55 60Gly Gly Ala Val Val Arg Ala Gly Glu Ala Glu Pro
Ser Gly Ala Ala65 70 75
80Arg Ser Ala Ser Ser Gly Arg Glu Glu Pro Gln Pro Glu Glu Gly Glu85
90 95Glu Glu Glu Glu Lys Glu Glu Glu Arg Gly
Pro Gln Trp Arg Leu Gly100 105 110Ala Arg
Lys Pro Gly Ser Trp Thr Gly Glu Ala Ala Val Cys Ala Asp115
120 125Ser Ala Pro Ala Ala Arg Ala Pro Gln Ala Leu Ala
Arg Ala Ser Gly130 135 140Arg Gly Gly Arg
Val Ala Arg Arg Gly Ala Glu Glu Ser Gly Pro Pro145 150
155 160His Ser Pro Ser Arg Arg Gly Ser Ala
Ser Arg Ala Gly Pro Gly Arg165 170 175Ala
Ser Glu Thr Met Asn Phe Leu Leu Ser Trp Val His Trp Ser Leu180
185 190Ala Leu Leu Leu Tyr Leu His His Ala Lys Trp
Ser Gln Ala Ala Pro195 200 205Met Ala Glu
Gly Gly Gly Gln Asn His His Glu Val Val Lys Phe Met210
215 220Asp Val Tyr Gln Arg Ser Tyr Cys His Pro Ile Glu
Thr Leu Val Asp225 230 235
240Ile Phe Gln Glu Tyr Pro Asp Glu Ile Glu Tyr Ile Phe Lys Pro Ser245
250 255Cys Val Pro Leu Met Arg Cys Gly Gly
Cys Cys Asn Asp Glu Gly Leu260 265 270Glu
Cys Val Pro Thr Glu Glu Ser Asn Ile Thr Met Gln Ile Met Arg275
280 285Ile Lys Pro His Gln Gly Gln His Ile Gly Glu
Met Ser Phe Leu Gln290 295 300His Asn Lys
Cys Glu Cys Arg Pro Lys Lys Asp Arg Ala Arg Gln Glu305
310 315 320Asn Pro Cys Gly Pro Cys Ser
Glu Arg Arg Lys His Leu Phe Val Gln325 330
335Asp Pro Gln Thr Cys Lys Cys Ser Cys Lys Asn Thr Asp Ser Arg Cys340
345 350Lys Ala Arg Gln Leu Glu Leu Asn Glu
Arg Thr Cys Arg Ser Leu Thr355 360 365Arg
Lys Asp370113153PRTHomo sapiens 113Met Gly Lys Ile Ser Ser Leu Pro Thr
Gln Leu Phe Lys Cys Cys Phe1 5 10
15Cys Asp Phe Leu Lys Val Lys Met His Thr Met Ser Ser Ser His
Leu20 25 30Phe Tyr Leu Ala Leu Cys Leu
Leu Thr Phe Thr Ser Ser Ala Thr Ala35 40
45Gly Pro Glu Thr Leu Cys Gly Ala Glu Leu Val Asp Ala Leu Gln Phe50
55 60Val Cys Gly Asp Arg Gly Phe Tyr Phe Asn
Lys Pro Thr Gly Tyr Gly65 70 75
80Ser Ser Ser Arg Arg Ala Pro Gln Thr Gly Ile Val Asp Glu Cys
Cys85 90 95Phe Arg Ser Cys Asp Leu Arg
Arg Leu Glu Met Tyr Cys Ala Pro Leu100 105
110Lys Pro Ala Lys Ser Ala Arg Ser Val Arg Ala Gln Arg His Thr Asp115
120 125Met Pro Lys Thr Gln Lys Glu Val His
Leu Lys Asn Ala Ser Arg Gly130 135 140Ser
Ala Gly Asn Lys Asn Tyr Arg Met145 150114180PRTHomo
sapiens 114Met Gly Ile Pro Met Gly Lys Ser Met Leu Val Leu Leu Thr Phe
Leu1 5 10 15Ala Phe Ala
Ser Cys Cys Ile Ala Ala Tyr Arg Pro Ser Glu Thr Leu20 25
30Cys Gly Gly Glu Leu Val Asp Thr Leu Gln Phe Val Cys
Gly Asp Arg35 40 45Gly Phe Tyr Phe Ser
Arg Pro Ala Ser Arg Val Ser Arg Arg Ser Arg50 55
60Gly Ile Val Glu Glu Cys Cys Phe Arg Ser Cys Asp Leu Ala Leu
Leu65 70 75 80Glu Thr
Tyr Cys Ala Thr Pro Ala Lys Ser Glu Arg Asp Val Ser Thr85
90 95Pro Pro Thr Val Leu Pro Asp Asn Phe Pro Arg Tyr
Pro Val Gly Lys100 105 110Phe Phe Gln Tyr
Asp Thr Trp Lys Gln Ser Thr Gln Arg Leu Arg Arg115 120
125Gly Leu Pro Ala Leu Leu Arg Ala Arg Arg Gly His Val Leu
Ala Lys130 135 140Glu Leu Glu Ala Phe Arg
Glu Ala Lys Arg His Arg Pro Leu Ile Ala145 150
155 160Leu Pro Thr Gln Asp Pro Ala His Gly Gly Ala
Pro Pro Glu Met Ala165 170 175Ser Asn Arg
Lys18011554PRTHomo sapiens 115Met Asn Ser Asp Ser Glu Cys Pro Leu Ser His
Asp Gly Tyr Cys Leu1 5 10
15His Asp Gly Val Cys Met Tyr Ile Glu Ala Leu Asp Lys Tyr Ala Cys20
25 30Asn Cys Val Val Gly Tyr Ile Gly Glu Arg
Cys Gln Tyr Arg Asp Leu35 40 45Lys Trp
Trp Glu Leu Arg501161007PRTArtificial
SequencePEPTIDE(1)...(1007)BoNT/A-TEV-GDNFAP4A 116Met Gly Pro Arg Arg Leu
Leu Leu Val Ala Ala Cys Phe Ser Leu Cys1 5
10 15Gly Pro Leu Leu Ser Ala Arg Thr Arg Ala Arg Arg Pro
Glu Ser Lys20 25 30Ala Thr Asn Ala Thr
Asp Asp Asp Asp Lys Cys Val Leu Thr Ala Ile35 40
45His Leu Asn Val Thr Asp Leu Gly Leu Gly Tyr Glu Thr Lys Glu
Glu50 55 60Leu Ile Phe Arg Tyr Cys Ser
Gly Ser Cys Asp Ala Ala Glu Thr Thr65 70
75 80Tyr Asp Lys Ile Leu Lys Asn Leu Ser Arg Asn Arg
Arg Leu Val Ser85 90 95Asp Lys Val Gly
Gln Ala Cys Cys Arg Pro Ile Ala Phe Asp Asp Asp100 105
110Leu Ser Phe Leu Asp Asp Asn Leu Val Tyr His Ile Leu Arg
Lys His115 120 125Ser Ala Lys Arg Cys Gly
Cys Ile Ala Leu Asn Asp Leu Cys Ile Lys130 135
140Val Asn Asn Trp Asp Leu Phe Phe Ser Pro Ser Glu Asp Asn Phe
Thr145 150 155 160Asn Asp
Leu Asn Lys Gly Glu Glu Ile Thr Ser Asp Thr Asn Ile Glu165
170 175Ala Ala Glu Glu Asn Ile Ser Leu Asp Leu Ile Gln
Gln Tyr Tyr Leu180 185 190Thr Phe Asn Phe
Asp Asn Glu Pro Glu Asn Ile Ser Ile Glu Asn Leu195 200
205Ser Ser Asp Ile Ile Gly Gln Leu Glu Leu Met Pro Asn Ile
Glu Arg210 215 220Phe Pro Asn Gly Lys Lys
Tyr Glu Leu Asp Lys Tyr Thr Met Phe His225 230
235 240Tyr Leu Arg Ala Gln Glu Phe Glu His Gly Lys
Ser Arg Ile Ala Leu245 250 255Thr Asn Ser
Val Asn Glu Ala Leu Leu Asn Pro Ser Arg Val Tyr Thr260
265 270Phe Phe Ser Ser Asp Tyr Val Lys Lys Val Asn Lys
Ala Thr Glu Ala275 280 285Ala Met Phe Leu
Gly Trp Val Glu Gln Leu Val Tyr Asp Phe Thr Asp290 295
300Glu Thr Ser Glu Val Ser Thr Thr Asp Lys Ile Ala Asp Ile
Thr Ile305 310 315 320Ile
Ile Pro Tyr Ile Gly Pro Ala Leu Asn Ile Gly Asn Met Leu Tyr325
330 335Lys Asp Asp Phe Val Gly Ala Leu Ile Phe Ser
Gly Ala Val Ile Leu340 345 350Leu Glu Phe
Ile Pro Glu Ile Ala Ile Pro Val Leu Gly Thr Phe Ala355
360 365Leu Val Ser Tyr Ile Ala Asn Lys Val Leu Thr Val
Gln Thr Ile Asp370 375 380Asn Ala Leu Ser
Lys Arg Asn Glu Lys Trp Asp Glu Val Tyr Lys Tyr385 390
395 400Ile Val Thr Asn Trp Leu Ala Lys Val
Asn Thr Gln Ile Asp Leu Ile405 410 415Arg
Lys Lys Met Lys Glu Ala Leu Glu Asn Gln Ala Glu Ala Thr Lys420
425 430Ala Ile Ile Asn Tyr Gln Tyr Asn Gln Tyr Thr
Glu Glu Glu Lys Asn435 440 445Asn Ile Asn
Phe Asn Ile Asp Asp Leu Ser Ser Lys Leu Asn Glu Ser450
455 460Ile Asn Lys Ala Met Ile Asn Ile Asn Lys Phe Leu
Asn Gln Cys Ser465 470 475
480Val Ser Tyr Leu Met Asn Ser Met Ile Pro Tyr Gly Val Lys Arg Leu485
490 495Glu Asp Phe Asp Ala Ser Leu Lys Asp
Ala Leu Leu Lys Tyr Ile Tyr500 505 510Asp
Asn Arg Gly Thr Leu Ile Gly Gln Val Asp Arg Leu Lys Asp Lys515
520 525Val Asn Asn Thr Leu Ser Thr Asp Ile Pro Phe
Gln Leu Ser Lys Tyr530 535 540Val Asp Asn
Gln Arg Leu Leu Ser Thr Phe Thr Glu Tyr Ile Lys Glu545
550 555 560Asn Leu Tyr Phe Gln Gly Pro
Phe Val Asn Lys Gln Phe Asn Tyr Lys565 570
575Asp Pro Val Asn Gly Val Asp Ile Ala Tyr Ile Lys Ile Pro Asn Ala580
585 590Gly Gln Met Gln Pro Val Lys Ala Phe
Lys Ile His Asn Lys Ile Trp595 600 605Val
Ile Pro Glu Arg Asp Thr Phe Thr Asn Pro Glu Glu Gly Asp Leu610
615 620Asn Pro Pro Pro Glu Ala Lys Gln Val Pro Val
Ser Tyr Tyr Asp Ser625 630 635
640Thr Tyr Leu Ser Thr Asp Asn Glu Lys Asp Asn Tyr Leu Lys Gly
Val645 650 655Thr Lys Leu Phe Glu Arg Ile
Tyr Ser Thr Asp Leu Gly Arg Met Leu660 665
670Leu Thr Ser Ile Val Arg Gly Ile Pro Phe Trp Gly Gly Ser Thr Ile675
680 685Asp Thr Glu Leu Lys Val Ile Asp Thr
Asn Cys Ile Asn Val Ile Gln690 695 700Pro
Asp Gly Ser Tyr Arg Ser Glu Glu Leu Asn Leu Val Ile Ile Gly705
710 715 720Pro Ser Ala Asp Ile Ile
Gln Phe Glu Cys Lys Ser Phe Gly His Glu725 730
735Val Leu Asn Leu Thr Arg Asn Gly Tyr Gly Ser Thr Gln Tyr Ile
Arg740 745 750Phe Ser Pro Asp Phe Thr Phe
Gly Phe Glu Glu Ser Leu Glu Val Asp755 760
765Thr Asn Pro Leu Leu Gly Ala Gly Lys Phe Ala Thr Asp Pro Ala Val770
775 780Thr Leu Ala His Glu Leu Ile His Ala
Gly His Arg Leu Tyr Gly Ile785 790 795
800Ala Ile Asn Pro Asn Arg Val Phe Lys Val Asn Thr Asn Ala
Tyr Tyr805 810 815Glu Met Ser Gly Leu Glu
Val Ser Phe Glu Glu Leu Arg Thr Phe Gly820 825
830Gly His Asp Ala Lys Phe Ile Asp Ser Leu Gln Glu Asn Glu Phe
Arg835 840 845Leu Tyr Tyr Tyr Asn Lys Phe
Lys Asp Ile Ala Ser Thr Leu Asn Lys850 855
860Ala Lys Ser Ile Val Gly Thr Thr Ala Ser Leu Gln Tyr Met Lys Asn865
870 875 880Val Phe Lys Glu
Lys Tyr Leu Leu Ser Glu Asp Thr Ser Gly Lys Phe885 890
895Ser Val Asp Lys Leu Lys Phe Asp Lys Leu Tyr Lys Met Leu
Thr Glu900 905 910Ile Tyr Thr Glu Asp Asn
Phe Val Lys Phe Phe Lys Val Leu Asn Arg915 920
925Lys Thr Tyr Leu Asn Phe Asp Lys Ala Val Phe Lys Ile Asn Ile
Val930 935 940Pro Lys Val Asn Tyr Thr Ile
Tyr Asp Gly Phe Asn Leu Arg Asn Thr945 950
955 960Asn Leu Ala Ala Asn Phe Asn Gly Gln Asn Thr Glu
Ile Asn Asn Met965 970 975Asn Phe Thr Lys
Leu Lys Asn Phe Thr Gly Leu Phe Glu Phe Tyr Lys980 985
990Leu Leu Cys Val Arg Gly Ile Ile Thr Ser Lys Thr Lys Ser
Leu995 1000 10051171009PRTArtificial
SequencePEPTIDE(1)...(1009)BoNT/A-TEV-GDNFAP4B 117Met Gly Pro Arg Arg Leu
Leu Leu Val Ala Ala Cys Phe Ser Leu Cys1 5
10 15Gly Pro Leu Leu Ser Ala Arg Thr Arg Ala Arg Arg Pro
Glu Ser Lys20 25 30Ala Thr Asn Ala Thr
Asp Asp Asp Asp Lys Cys Val Leu Thr Ala Ile35 40
45His Leu Asn Val Thr Asp Leu Gly Leu Gly Tyr Glu Thr Lys Glu
Glu50 55 60Leu Ile Phe Arg Tyr Cys Ser
Gly Ser Cys Asp Ala Ala Glu Thr Thr65 70
75 80Tyr Asp Lys Ile Leu Lys Asn Leu Ser Arg Asn Arg
Arg Leu Val Ser85 90 95Asp Lys Val Gly
Gln Ala Cys Cys Arg Pro Ile Ala Phe Asp Asp Asp100 105
110Leu Ser Phe Leu Asp Asp Asn Leu Val Tyr His Ile Leu Arg
Lys His115 120 125Ser Ala Lys Arg Cys Gly
Cys Ile Pro Phe Val Asn Lys Gln Phe Asn130 135
140Tyr Lys Asp Pro Val Asn Gly Val Asp Ile Ala Tyr Ile Lys Ile
Pro145 150 155 160Asn Ala
Gly Gln Met Gln Pro Val Lys Ala Phe Lys Ile His Asn Lys165
170 175Ile Trp Val Ile Pro Glu Arg Asp Thr Phe Thr Asn
Pro Glu Glu Gly180 185 190Asp Leu Asn Pro
Pro Pro Glu Ala Lys Gln Val Pro Val Ser Tyr Tyr195 200
205Asp Ser Thr Tyr Leu Ser Thr Asp Asn Glu Lys Asp Asn Tyr
Leu Lys210 215 220Gly Val Thr Lys Leu Phe
Glu Arg Ile Tyr Ser Thr Asp Leu Gly Arg225 230
235 240Met Leu Leu Thr Ser Ile Val Arg Gly Ile Pro
Phe Trp Gly Gly Ser245 250 255Thr Ile Asp
Thr Glu Leu Lys Val Ile Asp Thr Asn Cys Ile Asn Val260
265 270Ile Gln Pro Asp Gly Ser Tyr Arg Ser Glu Glu Leu
Asn Leu Val Ile275 280 285Ile Gly Pro Ser
Ala Asp Ile Ile Gln Phe Glu Cys Lys Ser Phe Gly290 295
300His Glu Val Leu Asn Leu Thr Arg Asn Gly Tyr Gly Ser Thr
Gln Tyr305 310 315 320Ile
Arg Phe Ser Pro Asp Phe Thr Phe Gly Phe Glu Glu Ser Leu Glu325
330 335Val Asp Thr Asn Pro Leu Leu Gly Ala Gly Lys
Phe Ala Thr Asp Pro340 345 350Ala Val Thr
Leu Ala His Glu Leu Ile His Ala Gly His Arg Leu Tyr355
360 365Gly Ile Ala Ile Asn Pro Asn Arg Val Phe Lys Val
Asn Thr Asn Ala370 375 380Tyr Tyr Glu Met
Ser Gly Leu Glu Val Ser Phe Glu Glu Leu Arg Thr385 390
395 400Phe Gly Gly His Asp Ala Lys Phe Ile
Asp Ser Leu Gln Glu Asn Glu405 410 415Phe
Arg Leu Tyr Tyr Tyr Asn Lys Phe Lys Asp Ile Ala Ser Thr Leu420
425 430Asn Lys Ala Lys Ser Ile Val Gly Thr Thr Ala
Ser Leu Gln Tyr Met435 440 445Lys Asn Val
Phe Lys Glu Lys Tyr Leu Leu Ser Glu Asp Thr Ser Gly450
455 460Lys Phe Ser Val Asp Lys Leu Lys Phe Asp Lys Leu
Tyr Lys Met Leu465 470 475
480Thr Glu Ile Tyr Thr Glu Asp Asn Phe Val Lys Phe Phe Lys Val Leu485
490 495Asn Arg Lys Thr Tyr Leu Asn Phe Asp
Lys Ala Val Phe Lys Ile Asn500 505 510Ile
Val Pro Lys Val Asn Tyr Thr Ile Tyr Asp Gly Phe Asn Leu Arg515
520 525Asn Thr Asn Leu Ala Ala Asn Phe Asn Gly Gln
Asn Thr Glu Ile Asn530 535 540Asn Met Asn
Phe Thr Lys Leu Lys Asn Phe Thr Gly Leu Phe Glu Phe545
550 555 560Tyr Lys Leu Leu Cys Val Arg
Gly Ile Ile Thr Ser Lys Thr Lys Ser565 570
575Leu Glu Asn Leu Tyr Phe Gln Gly Ala Leu Asn Asp Leu Cys Ile Lys580
585 590Val Asn Asn Trp Asp Leu Phe Phe Ser
Pro Ser Glu Asp Asn Phe Thr595 600 605Asn
Asp Leu Asn Lys Gly Glu Glu Ile Thr Ser Asp Thr Asn Ile Glu610
615 620Ala Ala Glu Glu Asn Ile Ser Leu Asp Leu Ile
Gln Gln Tyr Tyr Leu625 630 635
640Thr Phe Asn Phe Asp Asn Glu Pro Glu Asn Ile Ser Ile Glu Asn
Leu645 650 655Ser Ser Asp Ile Ile Gly Gln
Leu Glu Leu Met Pro Asn Ile Glu Arg660 665
670Phe Pro Asn Gly Lys Lys Tyr Glu Leu Asp Lys Tyr Thr Met Phe His675
680 685Tyr Leu Arg Ala Gln Glu Phe Glu His
Gly Lys Ser Arg Ile Ala Leu690 695 700Thr
Asn Ser Val Asn Glu Ala Leu Leu Asn Pro Ser Arg Val Tyr Thr705
710 715 720Phe Phe Ser Ser Asp Tyr
Val Lys Lys Val Asn Lys Ala Thr Glu Ala725 730
735Ala Met Phe Leu Gly Trp Val Glu Gln Leu Val Tyr Asp Phe Thr
Asp740 745 750Glu Thr Ser Glu Val Ser Thr
Thr Asp Lys Ile Ala Asp Ile Thr Ile755 760
765Ile Ile Pro Tyr Ile Gly Pro Ala Leu Asn Ile Gly Asn Met Leu Tyr770
775 780Lys Asp Asp Phe Val Gly Ala Leu Ile
Phe Ser Gly Ala Val Ile Leu785 790 795
800Leu Glu Phe Ile Pro Glu Ile Ala Ile Pro Val Leu Gly Thr
Phe Ala805 810 815Leu Val Ser Tyr Ile Ala
Asn Lys Val Leu Thr Val Gln Thr Ile Asp820 825
830Asn Ala Leu Ser Lys Arg Asn Glu Lys Trp Asp Glu Val Tyr Lys
Tyr835 840 845Ile Val Thr Asn Trp Leu Ala
Lys Val Asn Thr Gln Ile Asp Leu Ile850 855
860Arg Lys Lys Met Lys Glu Ala Leu Glu Asn Gln Ala Glu Ala Thr Lys865
870 875 880Ala Ile Ile Asn
Tyr Gln Tyr Asn Gln Tyr Thr Glu Glu Glu Lys Asn885 890
895Asn Ile Asn Phe Asn Ile Asp Asp Leu Ser Ser Lys Leu Asn
Glu Ser900 905 910Ile Asn Lys Ala Met Ile
Asn Ile Asn Lys Phe Leu Asn Gln Cys Ser915 920
925Val Ser Tyr Leu Met Asn Ser Met Ile Pro Tyr Gly Val Lys Arg
Leu930 935 940Glu Asp Phe Asp Ala Ser Leu
Lys Asp Ala Leu Leu Lys Tyr Ile Tyr945 950
955 960Asp Asn Arg Gly Thr Leu Ile Gly Gln Val Asp Arg
Leu Lys Asp Lys965 970 975Val Asn Asn Thr
Leu Ser Thr Asp Ile Pro Phe Gln Leu Ser Lys Tyr980 985
990Val Asp Asn Gln Arg Leu Leu Ser Thr Phe Thr Glu Tyr Ile
Lys Asn995 1000 1005Ile118991PRTArtificial
SequencePEPTIDE(1)...(991)BoNT/A-ENT-BMP2CP5A 118Met Pro Phe Val Asn Lys
Gln Phe Asn Tyr Lys Asp Pro Val Asn Gly1 5
10 15Val Asp Ile Ala Tyr Ile Lys Ile Pro Asn Ala Gly Gln
Met Gln Pro20 25 30Val Lys Ala Phe Lys
Ile His Asn Lys Ile Trp Val Ile Pro Glu Arg35 40
45Asp Thr Phe Thr Asn Pro Glu Glu Gly Asp Leu Asn Pro Pro Pro
Glu50 55 60Ala Lys Gln Val Pro Val Ser
Tyr Tyr Asp Ser Thr Tyr Leu Ser Thr65 70
75 80Asp Asn Glu Lys Asp Asn Tyr Leu Lys Gly Val Thr
Lys Leu Phe Glu85 90 95Arg Ile Tyr Ser
Thr Asp Leu Gly Arg Met Leu Leu Thr Ser Ile Val100 105
110Arg Gly Ile Pro Phe Trp Gly Gly Ser Thr Ile Asp Thr Glu
Leu Lys115 120 125Val Ile Asp Thr Asn Cys
Ile Asn Val Ile Gln Pro Asp Gly Ser Tyr130 135
140Arg Ser Glu Glu Leu Asn Leu Val Ile Ile Gly Pro Ser Ala Asp
Ile145 150 155 160Ile Gln
Phe Glu Cys Lys Ser Phe Gly His Glu Val Leu Asn Leu Thr165
170 175Arg Asn Gly Tyr Gly Ser Thr Gln Tyr Ile Arg Phe
Ser Pro Asp Phe180 185 190Thr Phe Gly Phe
Glu Glu Ser Leu Glu Val Asp Thr Asn Pro Leu Leu195 200
205Gly Ala Gly Lys Phe Ala Thr Asp Pro Ala Val Thr Leu Ala
His Glu210 215 220Leu Ile His Ala Gly His
Arg Leu Tyr Gly Ile Ala Ile Asn Pro Asn225 230
235 240Arg Val Phe Lys Val Asn Thr Asn Ala Tyr Tyr
Glu Met Ser Gly Leu245 250 255Glu Val Ser
Phe Glu Glu Leu Arg Thr Phe Gly Gly His Asp Ala Lys260
265 270Phe Ile Asp Ser Leu Gln Glu Asn Glu Phe Arg Leu
Tyr Tyr Tyr Asn275 280 285Lys Phe Lys Asp
Ile Ala Ser Thr Leu Asn Lys Ala Lys Ser Ile Val290 295
300Gly Thr Thr Ala Ser Leu Gln Tyr Met Lys Asn Val Phe Lys
Glu Lys305 310 315 320Tyr
Leu Leu Ser Glu Asp Thr Ser Gly Lys Phe Ser Val Asp Lys Leu325
330 335Lys Phe Asp Lys Leu Tyr Lys Met Leu Thr Glu
Ile Tyr Thr Glu Asp340 345 350Asn Phe Val
Lys Phe Phe Lys Val Leu Asn Arg Lys Thr Tyr Leu Asn355
360 365Phe Asp Lys Ala Val Phe Lys Ile Asn Ile Val Pro
Lys Val Asn Tyr370 375 380Thr Ile Tyr Asp
Gly Phe Asn Leu Arg Asn Thr Asn Leu Ala Ala Asn385 390
395 400Phe Asn Gly Gln Asn Thr Glu Ile Asn
Asn Met Asn Phe Thr Lys Leu405 410 415Lys
Asn Phe Thr Gly Leu Phe Glu Phe Tyr Lys Leu Leu Cys Val Arg420
425 430Gly Ile Ile Thr Ser Lys Thr Lys Ser Leu Asp
Asp Asp Asp Lys Cys435 440 445Lys Arg His
Pro Leu Tyr Val Asp Phe Ser Asp Val Gly Trp Asn Asp450
455 460Trp Ile Val Ala Pro Pro Gly Tyr His Ala Phe Tyr
Cys His Gly Glu465 470 475
480Cys Pro Phe Pro Leu Ala Asp His Leu Asn Ser Thr Asn His Ala Ile485
490 495Val Gln Thr Leu Val Asn Ser Val Asn
Ser Lys Ile Pro Lys Ala Cys500 505 510Cys
Val Pro Thr Glu Leu Ser Ala Ile Ser Met Leu Tyr Leu Asp Glu515
520 525Asn Glu Lys Val Val Leu Lys Asn Tyr Gln Asp
Met Val Val Glu Gly530 535 540Cys Gly Cys
Arg Ala Leu Ala Gly Gly Gly Gly Ser Gly Gly Gly Gly545
550 555 560Ser Gly Gly Gly Gly Ser Ala
Leu Asn Asp Leu Cys Ile Lys Val Asn565 570
575Asn Trp Asp Leu Phe Phe Ser Pro Ser Glu Asp Asn Phe Thr Asn Asp580
585 590Leu Asn Lys Gly Glu Glu Ile Thr Ser
Asp Thr Asn Ile Glu Ala Ala595 600 605Glu
Glu Asn Ile Ser Leu Asp Leu Ile Gln Gln Tyr Tyr Leu Thr Phe610
615 620Asn Phe Asp Asn Glu Pro Glu Asn Ile Ser Ile
Glu Asn Leu Ser Ser625 630 635
640Asp Ile Ile Gly Gln Leu Glu Leu Met Pro Asn Ile Glu Arg Phe
Pro645 650 655Asn Gly Lys Lys Tyr Glu Leu
Asp Lys Tyr Thr Met Phe His Tyr Leu660 665
670Arg Ala Gln Glu Phe Glu His Gly Lys Ser Arg Ile Ala Leu Thr Asn675
680 685Ser Val Asn Glu Ala Leu Leu Asn Pro
Ser Arg Val Tyr Thr Phe Phe690 695 700Ser
Ser Asp Tyr Val Lys Lys Val Asn Lys Ala Thr Glu Ala Ala Met705
710 715 720Phe Leu Gly Trp Val Glu
Gln Leu Val Tyr Asp Phe Thr Asp Glu Thr725 730
735Ser Glu Val Ser Thr Thr Asp Lys Ile Ala Asp Ile Thr Ile Ile
Ile740 745 750Pro Tyr Ile Gly Pro Ala Leu
Asn Ile Gly Asn Met Leu Tyr Lys Asp755 760
765Asp Phe Val Gly Ala Leu Ile Phe Ser Gly Ala Val Ile Leu Leu Glu770
775 780Phe Ile Pro Glu Ile Ala Ile Pro Val
Leu Gly Thr Phe Ala Leu Val785 790 795
800Ser Tyr Ile Ala Asn Lys Val Leu Thr Val Gln Thr Ile Asp
Asn Ala805 810 815Leu Ser Lys Arg Asn Glu
Lys Trp Asp Glu Val Tyr Lys Tyr Ile Val820 825
830Thr Asn Trp Leu Ala Lys Val Asn Thr Gln Ile Asp Leu Ile Arg
Lys835 840 845Lys Met Lys Glu Ala Leu Glu
Asn Gln Ala Glu Ala Thr Lys Ala Ile850 855
860Ile Asn Tyr Gln Tyr Asn Gln Tyr Thr Glu Glu Glu Lys Asn Asn Ile865
870 875 880Asn Phe Asn Ile
Asp Asp Leu Ser Ser Lys Leu Asn Glu Ser Ile Asn885 890
895Lys Ala Met Ile Asn Ile Asn Lys Phe Leu Asn Gln Cys Ser
Val Ser900 905 910Tyr Leu Met Asn Ser Met
Ile Pro Tyr Gly Val Lys Arg Leu Glu Asp915 920
925Phe Asp Ala Ser Leu Lys Asp Ala Leu Leu Lys Tyr Ile Tyr Asp
Asn930 935 940Arg Gly Thr Leu Ile Gly Gln
Val Asp Arg Leu Lys Asp Lys Val Asn945 950
955 960Asn Thr Leu Ser Thr Asp Ile Pro Phe Gln Leu Ser
Lys Tyr Val Asp965 970 975Asn Gln Arg Leu
Leu Ser Thr Phe Thr Glu Tyr Ile Lys Asn Ile980 985
990119997PRTArtificial
SequencePEPTIDE(1)...(997)BoNT/A-ENT-BMP2CP5B 119Met Glu Ala Ala Ala Lys
Glu Ala Ala Ala Lys Ala Leu Asn Asp Leu1 5
10 15Cys Ile Lys Val Asn Asn Trp Asp Leu Phe Phe Ser Pro
Ser Glu Asp20 25 30Asn Phe Thr Asn Asp
Leu Asn Lys Gly Glu Glu Ile Thr Ser Asp Thr35 40
45Asn Ile Glu Ala Ala Glu Glu Asn Ile Ser Leu Asp Leu Ile Gln
Gln50 55 60Tyr Tyr Leu Thr Phe Asn Phe
Asp Asn Glu Pro Glu Asn Ile Ser Ile65 70
75 80Glu Asn Leu Ser Ser Asp Ile Ile Gly Gln Leu Glu
Leu Met Pro Asn85 90 95Ile Glu Arg Phe
Pro Asn Gly Lys Lys Tyr Glu Leu Asp Lys Tyr Thr100 105
110Met Phe His Tyr Leu Arg Ala Gln Glu Phe Glu His Gly Lys
Ser Arg115 120 125Ile Ala Leu Thr Asn Ser
Val Asn Glu Ala Leu Leu Asn Pro Ser Arg130 135
140Val Tyr Thr Phe Phe Ser Ser Asp Tyr Val Lys Lys Val Asn Lys
Ala145 150 155 160Thr Glu
Ala Ala Met Phe Leu Gly Trp Val Glu Gln Leu Val Tyr Asp165
170 175Phe Thr Asp Glu Thr Ser Glu Val Ser Thr Thr Asp
Lys Ile Ala Asp180 185 190Ile Thr Ile Ile
Ile Pro Tyr Ile Gly Pro Ala Leu Asn Ile Gly Asn195 200
205Met Leu Tyr Lys Asp Asp Phe Val Gly Ala Leu Ile Phe Ser
Gly Ala210 215 220Val Ile Leu Leu Glu Phe
Ile Pro Glu Ile Ala Ile Pro Val Leu Gly225 230
235 240Thr Phe Ala Leu Val Ser Tyr Ile Ala Asn Lys
Val Leu Thr Val Gln245 250 255Thr Ile Asp
Asn Ala Leu Ser Lys Arg Asn Glu Lys Trp Asp Glu Val260
265 270Tyr Lys Tyr Ile Val Thr Asn Trp Leu Ala Lys Val
Asn Thr Gln Ile275 280 285Asp Leu Ile Arg
Lys Lys Met Lys Glu Ala Leu Glu Asn Gln Ala Glu290 295
300Ala Thr Lys Ala Ile Ile Asn Tyr Gln Tyr Asn Gln Tyr Thr
Glu Glu305 310 315 320Glu
Lys Asn Asn Ile Asn Phe Asn Ile Asp Asp Leu Ser Ser Lys Leu325
330 335Asn Glu Ser Ile Asn Lys Ala Met Ile Asn Ile
Asn Lys Phe Leu Asn340 345 350Gln Cys Ser
Val Ser Tyr Leu Met Asn Ser Met Ile Pro Tyr Gly Val355
360 365Lys Arg Leu Glu Asp Phe Asp Ala Ser Leu Lys Asp
Ala Leu Leu Lys370 375 380Tyr Ile Tyr Asp
Asn Arg Gly Thr Leu Ile Gly Gln Val Asp Arg Leu385 390
395 400Lys Asp Lys Val Asn Asn Thr Leu Ser
Thr Asp Ile Pro Phe Gln Leu405 410 415Ser
Lys Tyr Val Asp Asn Gln Arg Leu Leu Ser Thr Phe Thr Glu Tyr420
425 430Ile Lys Asn Ile Asp Asp Asp Asp Lys Cys Lys
Arg His Pro Leu Tyr435 440 445Val Asp Phe
Ser Asp Val Gly Trp Asn Asp Trp Ile Val Ala Pro Pro450
455 460Gly Tyr His Ala Phe Tyr Cys His Gly Glu Cys Pro
Phe Pro Leu Ala465 470 475
480Asp His Leu Asn Ser Thr Asn His Ala Ile Val Gln Thr Leu Val Asn485
490 495Ser Val Asn Ser Lys Ile Pro Lys Ala
Cys Cys Val Pro Thr Glu Leu500 505 510Ser
Ala Ile Ser Met Leu Tyr Leu Asp Glu Asn Glu Lys Val Val Leu515
520 525Lys Asn Tyr Gln Asp Met Val Val Glu Gly Cys
Gly Cys Arg Ala Leu530 535 540Ala Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser545
550 555 560Pro Phe Val Asn Lys Gln Phe
Asn Tyr Lys Asp Pro Val Asn Gly Val565 570
575Asp Ile Ala Tyr Ile Lys Ile Pro Asn Ala Gly Gln Met Gln Pro Val580
585 590Lys Ala Phe Lys Ile His Asn Lys Ile
Trp Val Ile Pro Glu Arg Asp595 600 605Thr
Phe Thr Asn Pro Glu Glu Gly Asp Leu Asn Pro Pro Pro Glu Ala610
615 620Lys Gln Val Pro Val Ser Tyr Tyr Asp Ser Thr
Tyr Leu Ser Thr Asp625 630 635
640Asn Glu Lys Asp Asn Tyr Leu Lys Gly Val Thr Lys Leu Phe Glu
Arg645 650 655Ile Tyr Ser Thr Asp Leu Gly
Arg Met Leu Leu Thr Ser Ile Val Arg660 665
670Gly Ile Pro Phe Trp Gly Gly Ser Thr Ile Asp Thr Glu Leu Lys Val675
680 685Ile Asp Thr Asn Cys Ile Asn Val Ile
Gln Pro Asp Gly Ser Tyr Arg690 695 700Ser
Glu Glu Leu Asn Leu Val Ile Ile Gly Pro Ser Ala Asp Ile Ile705
710 715 720Gln Phe Glu Cys Lys Ser
Phe Gly His Glu Val Leu Asn Leu Thr Arg725 730
735Asn Gly Tyr Gly Ser Thr Gln Tyr Ile Arg Phe Ser Pro Asp Phe
Thr740 745 750Phe Gly Phe Glu Glu Ser Leu
Glu Val Asp Thr Asn Pro Leu Leu Gly755 760
765Ala Gly Lys Phe Ala Thr Asp Pro Ala Val Thr Leu Ala His Glu Leu770
775 780Ile His Ala Gly His Arg Leu Tyr Gly
Ile Ala Ile Asn Pro Asn Arg785 790 795
800Val Phe Lys Val Asn Thr Asn Ala Tyr Tyr Glu Met Ser Gly
Leu Glu805 810 815Val Ser Phe Glu Glu Leu
Arg Thr Phe Gly Gly His Asp Ala Lys Phe820 825
830Ile Asp Ser Leu Gln Glu Asn Glu Phe Arg Leu Tyr Tyr Tyr Asn
Lys835 840 845Phe Lys Asp Ile Ala Ser Thr
Leu Asn Lys Ala Lys Ser Ile Val Gly850 855
860Thr Thr Ala Ser Leu Gln Tyr Met Lys Asn Val Phe Lys Glu Lys Tyr865
870 875 880Leu Leu Ser Glu
Asp Thr Ser Gly Lys Phe Ser Val Asp Lys Leu Lys885 890
895Phe Asp Lys Leu Tyr Lys Met Leu Thr Glu Ile Tyr Thr Glu
Asp Asn900 905 910Phe Val Lys Phe Phe Lys
Val Leu Asn Arg Lys Thr Tyr Leu Asn Phe915 920
925Asp Lys Ala Val Phe Lys Ile Asn Ile Val Pro Lys Val Asn Tyr
Thr930 935 940Ile Tyr Asp Gly Phe Asn Leu
Arg Asn Thr Asn Leu Ala Ala Asn Phe945 950
955 960Asn Gly Gln Asn Thr Glu Ile Asn Asn Met Asn Phe
Thr Lys Leu Lys965 970 975Asn Phe Thr Gly
Leu Phe Glu Phe Tyr Lys Leu Leu Cys Val Arg Gly980 985
990Ile Ile Thr Ser Lys995120950PRTArtificial
SequencePEPTIDE(1)...(950)BoNT/A-TEV-IGF1XP6A 120Met Pro Phe Val Asn Lys
Gln Phe Asn Tyr Lys Asp Pro Val Asn Gly1 5
10 15Val Asp Ile Ala Tyr Ile Lys Ile Pro Asn Ala Gly Gln
Met Gln Pro20 25 30Val Lys Ala Phe Lys
Ile His Asn Lys Ile Trp Val Ile Pro Glu Arg35 40
45Asp Thr Phe Thr Asn Pro Glu Glu Gly Asp Leu Asn Pro Pro Pro
Glu50 55 60Ala Lys Gln Val Pro Val Ser
Tyr Tyr Asp Ser Thr Tyr Leu Ser Thr65 70
75 80Asp Asn Glu Lys Asp Asn Tyr Leu Lys Gly Val Thr
Lys Leu Phe Glu85 90 95Arg Ile Tyr Ser
Thr Asp Leu Gly Arg Met Leu Leu Thr Ser Ile Val100 105
110Arg Gly Ile Pro Phe Trp Gly Gly Ser Thr Ile Asp Thr Glu
Leu Lys115 120 125Val Ile Asp Thr Asn Cys
Ile Asn Val Ile Gln Pro Asp Gly Ser Tyr130 135
140Arg Ser Glu Glu Leu Asn Leu Val Ile Ile Gly Pro Ser Ala Asp
Ile145 150 155 160Ile Gln
Phe Glu Cys Lys Ser Phe Gly His Glu Val Leu Asn Leu Thr165
170 175Arg Asn Gly Tyr Gly Ser Thr Gln Tyr Ile Arg Phe
Ser Pro Asp Phe180 185 190Thr Phe Gly Phe
Glu Glu Ser Leu Glu Val Asp Thr Asn Pro Leu Leu195 200
205Gly Ala Gly Lys Phe Ala Thr Asp Pro Ala Val Thr Leu Ala
His Glu210 215 220Leu Ile His Ala Gly His
Arg Leu Tyr Gly Ile Ala Ile Asn Pro Asn225 230
235 240Arg Val Phe Lys Val Asn Thr Asn Ala Tyr Tyr
Glu Met Ser Gly Leu245 250 255Glu Val Ser
Phe Glu Glu Leu Arg Thr Phe Gly Gly His Asp Ala Lys260
265 270Phe Ile Asp Ser Leu Gln Glu Asn Glu Phe Arg Leu
Tyr Tyr Tyr Asn275 280 285Lys Phe Lys Asp
Ile Ala Ser Thr Leu Asn Lys Ala Lys Ser Ile Val290 295
300Gly Thr Thr Ala Ser Leu Gln Tyr Met Lys Asn Val Phe Lys
Glu Lys305 310 315 320Tyr
Leu Leu Ser Glu Asp Thr Ser Gly Lys Phe Ser Val Asp Lys Leu325
330 335Lys Phe Asp Lys Leu Tyr Lys Met Leu Thr Glu
Ile Tyr Thr Glu Asp340 345 350Asn Phe Val
Lys Phe Phe Lys Val Leu Asn Arg Lys Thr Tyr Leu Asn355
360 365Phe Asp Lys Ala Val Phe Lys Ile Asn Ile Val Pro
Lys Val Asn Tyr370 375 380Thr Ile Tyr Asp
Gly Phe Asn Leu Arg Asn Thr Asn Leu Ala Ala Asn385 390
395 400Phe Asn Gly Gln Asn Thr Glu Ile Asn
Asn Met Asn Phe Thr Lys Leu405 410 415Lys
Asn Phe Thr Gly Leu Phe Glu Phe Tyr Lys Leu Leu Cys Val Arg420
425 430Gly Ile Ile Thr Ser Lys Thr Lys Ser Leu Glu
Asn Leu Tyr Phe Gln435 440 445Gly Ala Leu
Asn Asp Leu Cys Ile Lys Val Asn Asn Trp Asp Leu Phe450
455 460Phe Ser Pro Ser Glu Asp Asn Phe Thr Asn Asp Leu
Asn Lys Gly Glu465 470 475
480Glu Ile Thr Ser Asp Thr Asn Ile Glu Ala Ala Glu Glu Asn Ile Ser485
490 495Leu Asp Leu Ile Gln Gln Tyr Tyr Leu
Thr Phe Asn Phe Asp Asn Glu500 505 510Pro
Glu Asn Ile Ser Ile Glu Asn Leu Ser Ser Asp Ile Ile Gly Gln515
520 525Leu Glu Leu Met Pro Asn Ile Glu Arg Phe Pro
Asn Gly Lys Lys Tyr530 535 540Glu Leu Asp
Lys Tyr Thr Met Phe His Tyr Leu Arg Ala Gln Glu Phe545
550 555 560Glu His Gly Lys Ser Arg Ile
Ala Leu Thr Asn Ser Val Asn Glu Ala565 570
575Leu Leu Asn Pro Ser Arg Val Tyr Thr Phe Phe Ser Ser Asp Tyr Val580
585 590Lys Lys Val Asn Lys Ala Thr Glu Ala
Ala Met Phe Leu Gly Trp Val595 600 605Glu
Gln Leu Val Tyr Asp Phe Thr Asp Glu Thr Ser Glu Val Ser Thr610
615 620Thr Asp Lys Ile Ala Asp Ile Thr Ile Ile Ile
Pro Tyr Ile Gly Pro625 630 635
640Ala Leu Asn Ile Gly Asn Met Leu Tyr Lys Asp Asp Phe Val Gly
Ala645 650 655Leu Ile Phe Ser Gly Ala Val
Ile Leu Leu Glu Phe Ile Pro Glu Ile660 665
670Ala Ile Pro Val Leu Gly Thr Phe Ala Leu Val Ser Tyr Ile Ala Asn675
680 685Lys Val Leu Thr Val Gln Thr Ile Asp
Asn Ala Leu Ser Lys Arg Asn690 695 700Glu
Lys Trp Asp Glu Val Tyr Lys Tyr Ile Val Thr Asn Trp Leu Ala705
710 715 720Lys Val Asn Thr Gln Ile
Asp Leu Ile Arg Lys Lys Met Lys Glu Ala725 730
735Leu Glu Asn Gln Ala Glu Ala Thr Lys Ala Ile Ile Asn Tyr Gln
Tyr740 745 750Asn Gln Tyr Thr Glu Glu Glu
Lys Asn Asn Ile Asn Phe Asn Ile Asp755 760
765Asp Leu Ser Ser Lys Leu Asn Glu Ser Ile Asn Lys Ala Met Ile Asn770
775 780Ile Asn Lys Phe Leu Asn Gln Cys Ser
Val Ser Tyr Leu Met Asn Ser785 790 795
800Met Ile Pro Tyr Gly Val Lys Arg Leu Glu Asp Phe Asp Ala
Ser Leu805 810 815Lys Asp Ala Leu Leu Lys
Tyr Ile Tyr Asp Asn Arg Gly Thr Leu Ile820 825
830Gly Gln Val Asp Arg Leu Lys Asp Lys Val Asn Asn Thr Leu Ser
Thr835 840 845Asp Ile Pro Phe Gln Leu Ser
Lys Tyr Val Asp Asn Gln Arg Leu Leu850 855
860Ser Thr Phe Thr Glu Tyr Ile Lys Asn Ile Ala Leu Ala Gly Gly Gly865
870 875 880Gly Ser Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Thr Leu Cys Gly885 890
895Ala Glu Leu Val Asp Ala Leu Gln Phe Val Cys Gly Asp Arg
Gly Phe900 905 910Tyr Phe Asn Lys Pro Thr
Gly Tyr Gly Ser Ser Ser Arg Arg Ala Pro915 920
925Gln Thr Gly Ile Val Asp Glu Cys Cys Phe Arg Ser Cys Asp Leu
Arg930 935 940Arg Leu Glu Met Tyr Cys945
950121951PRTArtificial
SequencePEPTIDE(1)...(951)BoNT/A-TEV-IGF1XP6B 121Met Glu Ala Ala Ala Lys
Glu Ala Ala Ala Lys Ala Leu Asn Asp Leu1 5
10 15Cys Ile Lys Val Asn Asn Trp Asp Leu Phe Phe Ser Pro
Ser Glu Asp20 25 30Asn Phe Thr Asn Asp
Leu Asn Lys Gly Glu Glu Ile Thr Ser Asp Thr35 40
45Asn Ile Glu Ala Ala Glu Glu Asn Ile Ser Leu Asp Leu Ile Gln
Gln50 55 60Tyr Tyr Leu Thr Phe Asn Phe
Asp Asn Glu Pro Glu Asn Ile Ser Ile65 70
75 80Glu Asn Leu Ser Ser Asp Ile Ile Gly Gln Leu Glu
Leu Met Pro Asn85 90 95Ile Glu Arg Phe
Pro Asn Gly Lys Lys Tyr Glu Leu Asp Lys Tyr Thr100 105
110Met Phe His Tyr Leu Arg Ala Gln Glu Phe Glu His Gly Lys
Ser Arg115 120 125Ile Ala Leu Thr Asn Ser
Val Asn Glu Ala Leu Leu Asn Pro Ser Arg130 135
140Val Tyr Thr Phe Phe Ser Ser Asp Tyr Val Lys Lys Val Asn Lys
Ala145 150 155 160Thr Glu
Ala Ala Met Phe Leu Gly Trp Val Glu Gln Leu Val Tyr Asp165
170 175Phe Thr Asp Glu Thr Ser Glu Val Ser Thr Thr Asp
Lys Ile Ala Asp180 185 190Ile Thr Ile Ile
Ile Pro Tyr Ile Gly Pro Ala Leu Asn Ile Gly Asn195 200
205Met Leu Tyr Lys Asp Asp Phe Val Gly Ala Leu Ile Phe Ser
Gly Ala210 215 220Val Ile Leu Leu Glu Phe
Ile Pro Glu Ile Ala Ile Pro Val Leu Gly225 230
235 240Thr Phe Ala Leu Val Ser Tyr Ile Ala Asn Lys
Val Leu Thr Val Gln245 250 255Thr Ile Asp
Asn Ala Leu Ser Lys Arg Asn Glu Lys Trp Asp Glu Val260
265 270Tyr Lys Tyr Ile Val Thr Asn Trp Leu Ala Lys Val
Asn Thr Gln Ile275 280 285Asp Leu Ile Arg
Lys Lys Met Lys Glu Ala Leu Glu Asn Gln Ala Glu290 295
300Ala Thr Lys Ala Ile Ile Asn Tyr Gln Tyr Asn Gln Tyr Thr
Glu Glu305 310 315 320Glu
Lys Asn Asn Ile Asn Phe Asn Ile Asp Asp Leu Ser Ser Lys Leu325
330 335Asn Glu Ser Ile Asn Lys Ala Met Ile Asn Ile
Asn Lys Phe Leu Asn340 345 350Gln Cys Ser
Val Ser Tyr Leu Met Asn Ser Met Ile Pro Tyr Gly Val355
360 365Lys Arg Leu Glu Asp Phe Asp Ala Ser Leu Lys Asp
Ala Leu Leu Lys370 375 380Tyr Ile Tyr Asp
Asn Arg Gly Thr Leu Ile Gly Gln Val Asp Arg Leu385 390
395 400Lys Asp Lys Val Asn Asn Thr Leu Ser
Thr Asp Ile Pro Phe Gln Leu405 410 415Ser
Lys Tyr Val Asp Asn Gln Arg Leu Leu Ser Thr Phe Thr Glu Tyr420
425 430Ile Lys Asn Ile Glu Asn Leu Tyr Phe Gln Gly
Pro Phe Val Asn Lys435 440 445Gln Phe Asn
Tyr Lys Asp Pro Val Asn Gly Val Asp Ile Ala Tyr Ile450
455 460Lys Ile Pro Asn Ala Gly Gln Met Gln Pro Val Lys
Ala Phe Lys Ile465 470 475
480His Asn Lys Ile Trp Val Ile Pro Glu Arg Asp Thr Phe Thr Asn Pro485
490 495Glu Glu Gly Asp Leu Asn Pro Pro Pro
Glu Ala Lys Gln Val Pro Val500 505 510Ser
Tyr Tyr Asp Ser Thr Tyr Leu Ser Thr Asp Asn Glu Lys Asp Asn515
520 525Tyr Leu Lys Gly Val Thr Lys Leu Phe Glu Arg
Ile Tyr Ser Thr Asp530 535 540Leu Gly Arg
Met Leu Leu Thr Ser Ile Val Arg Gly Ile Pro Phe Trp545
550 555 560Gly Gly Ser Thr Ile Asp Thr
Glu Leu Lys Val Ile Asp Thr Asn Cys565 570
575Ile Asn Val Ile Gln Pro Asp Gly Ser Tyr Arg Ser Glu Glu Leu Asn580
585 590Leu Val Ile Ile Gly Pro Ser Ala Asp
Ile Ile Gln Phe Glu Cys Lys595 600 605Ser
Phe Gly His Glu Val Leu Asn Leu Thr Arg Asn Gly Tyr Gly Ser610
615 620Thr Gln Tyr Ile Arg Phe Ser Pro Asp Phe Thr
Phe Gly Phe Glu Glu625 630 635
640Ser Leu Glu Val Asp Thr Asn Pro Leu Leu Gly Ala Gly Lys Phe
Ala645 650 655Thr Asp Pro Ala Val Thr Leu
Ala His Glu Leu Ile His Ala Gly His660 665
670Arg Leu Tyr Gly Ile Ala Ile Asn Pro Asn Arg Val Phe Lys Val Asn675
680 685Thr Asn Ala Tyr Tyr Glu Met Ser Gly
Leu Glu Val Ser Phe Glu Glu690 695 700Leu
Arg Thr Phe Gly Gly His Asp Ala Lys Phe Ile Asp Ser Leu Gln705
710 715 720Glu Asn Glu Phe Arg Leu
Tyr Tyr Tyr Asn Lys Phe Lys Asp Ile Ala725 730
735Ser Thr Leu Asn Lys Ala Lys Ser Ile Val Gly Thr Thr Ala Ser
Leu740 745 750Gln Tyr Met Lys Asn Val Phe
Lys Glu Lys Tyr Leu Leu Ser Glu Asp755 760
765Thr Ser Gly Lys Phe Ser Val Asp Lys Leu Lys Phe Asp Lys Leu Tyr770
775 780Lys Met Leu Thr Glu Ile Tyr Thr Glu
Asp Asn Phe Val Lys Phe Phe785 790 795
800Lys Val Leu Asn Arg Lys Thr Tyr Leu Asn Phe Asp Lys Ala
Val Phe805 810 815Lys Ile Asn Ile Val Pro
Lys Val Asn Tyr Thr Ile Tyr Asp Gly Phe820 825
830Asn Leu Arg Asn Thr Asn Leu Ala Ala Asn Phe Asn Gly Gln Asn
Thr835 840 845Glu Ile Asn Asn Met Asn Phe
Thr Lys Leu Lys Asn Phe Thr Gly Leu850 855
860Phe Glu Phe Tyr Lys Leu Leu Cys Val Arg Gly Ile Ile Thr Gly Gly865
870 875 880Gly Gly Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Thr Leu Cys885 890
895Gly Ala Glu Leu Val Asp Ala Leu Gln Phe Val Cys Gly Asp
Arg Gly900 905 910Phe Tyr Phe Asn Lys Pro
Thr Gly Tyr Gly Ser Ser Ser Arg Arg Ala915 920
925Pro Gln Thr Gly Ile Val Asp Glu Cys Cys Phe Arg Ser Cys Asp
Leu930 935 940Arg Arg Leu Glu Met Tyr
Cys945 950
User Contributions:
comments("1"); ?> comment_form("1"); ?>Inventors list |
Agents list |
Assignees list |
List by place |
Classification tree browser |
Top 100 Inventors |
Top 100 Agents |
Top 100 Assignees |
Usenet FAQ Index |
Documents |
Other FAQs |
User Contributions:
Comment about this patent or add new information about this topic: