Patent application title: Therapeutic Agent For Alzheimer's Disease
Inventors:
Makoto Inoue (Ibaraki, JP)
Yumiko Tokusumi (Ibaraki, JP)
Hitoshi Iwasaki (Ibaraki, JP)
Hiroto Hara (Ibaraki, JP)
Toshiaki Tabata (Ibaraki, JP)
Mamoru Hasegawa (Ibaraki, JP)
Assignees:
DNAVEC CORPORATION
IPC8 Class: AA61K3820FI
USPC Class:
424 852
Class name: Drug, bio-affecting and body treating compositions lymphokine interleukin
Publication date: 2009-10-01
Patent application number: 20090246170
Inventors list |
Agents list |
Assignees list |
List by place |
Classification tree browser |
Top 100 Inventors |
Top 100 Agents |
Top 100 Assignees |
Usenet FAQ Index |
Documents |
Other FAQs |
Patent application title: Therapeutic Agent For Alzheimer's Disease
Inventors:
Mamoru Hasegawa
Makoto Inoue
Toshiaki Tabata
Hitoshi Iwasaki
Yumiko Tokusumi
Hiroto Hara
Agents:
CLARK & ELBING LLP
Assignees:
DNAVEC Corporation
Origin: BOSTON, MA US
IPC8 Class: AA61K3820FI
USPC Class:
424 852
Patent application number: 20090246170
Abstract:
The present invention provides novel therapeutic methods and agents for
treating Alzheimer's disease. Specifically, the present invention relates
to anti-inflammatory cytokines, anti-inflammatory cytokine genes,
negative-strand RNA viral vectors carrying an anti-inflammatory cytokine
gene, which are used for treating Alzheimer's disease or developing
therapeutic agents for Alzheimer's disease. The present invention also
provides pharmaceutical compositions for treating or preventing
Alzheimer's disease, which comprise the cytokines or vectors. The present
invention further provides methods for treating Alzheimer's disease,
which comprise the step of administering an anti-inflammatory cytokine,
or a vector such as a negative-strand RNA viral vector carrying an
anti-inflammatory cytokine gene. The present invention enables novel gene
therapies for Alzheimer's disease.Claims:
1. A pharmaceutical composition for treating or preventing Alzheimer's
disease, wherein the composition comprisesa negative-strand RNA viral
vector carrying a gene encoding an anti-inflammatory cytokine or a
partial peptide thereof, oran anti-inflammatory cytokine or a partial
peptide thereof.
2. The composition of claim 1, wherein the composition comprises a negative-strand RNA viral vector carrying a gene encoding an anti-inflammatory cytokine or a partial peptide thereof.
3. The composition of claim 1, wherein the composition comprises an anti-inflammatory cytokine or a partial peptide thereof.
4. The composition of claim 1 or 2, wherein the negative-strand RNA viral vector is a paramyxovirus vector.
5. The composition of claim 1 or 2, wherein the negative-strand RNA viral vector is a Sendai virus vector.
6. The composition of any one of claims 1 to 5, wherein the anti-inflammatory cytokine is selected from the group consisting of interleukin-4, interleukin-10, interleukin-13, and partial peptides thereof.
7. The composition of any one of claims 1 to 6, wherein the composition is used for nasal administration.
8. A negative-strand RNA viral vector carrying a gene for an anti-inflammatory cytokine or a partial peptide thereof, wherein the vector is used for treating Alzheimer's disease or developing a therapeutic agent for Alzheimer's disease.
9. An anti-inflammatory cytokine protein, wherein the protein is used for treating Alzheimer's disease or developing a therapeutic agent for Alzheimer's disease.
10. The vector of claim 8, wherein the negative-strand RNA viral vector is a paramyxovirus vector.
11. The vector of claim 8, wherein the negative-strand RNA viral vector is a Sendai virus vector.
12. The vector of any one of claims 8, 10, and 11, wherein the anti-inflammatory cytokine is selected from the group consisting of interleukin-4, interleukin-10, interleukin-13, and partial peptides thereof.
13. A method for treating or preventing Alzheimer's disease, wherein the method comprises the step of administeringa negative-strand RNA viral vector carrying a gene encoding an anti-inflammatory cytokine or a partial peptide thereof, oran anti-inflammatory cytokine or a partial peptide thereof.
14. The method of claim 13, wherein the administration is nasal administration.
Description:
TECHNICAL FIELD
[0001]The present invention relates to the treatment of Alzheimer's disease. Specifically, the present invention relates to the treatment of Alzheimer's disease using anti-inflammatory cytokines or vectors expressing anti-inflammatory cytokines, such as negative-strand RNA viral vectors carrying an anti-inflammatory cytokine gene.
BACKGROUND ART
[0002]It has been reported that about 10% of the people aged 65 years or older suffer from senile dementia in Japan's rapidly aging society. Alzheimer's disease is one of the two major causes of dementia, and accounts for about 50% of the dementia. Alzheimer's disease is becoming a serious social problem including the problem of nursing care.
[0003]Agents currently used for the therapy of Alzheimer's disease include acetylcholine modulators such as activators of the acetylcholine system, and acetylcholine esterase inhibitors; β-amyloid modulators such as P-secretase (BACE) inhibitors, which inhibit generation of amyloid peptides, and inhibitors of amyloid peptide aggregation; neuroprotection and neurotrophic therapeutic agents such as neuropeptides and nerve growth factors; chelators; antioxidants; and anti-inflammatory agents.
[0004]In terms of therapeutic effect, therapeutic agents for Alzheimer's disease can be categorized into the following three types. First-generation drugs can hardly suppress the progression of dementia itself, although they can improve the intellectual function to some extent when used at earlier stages of Alzheimer's disease; second-generation drugs have the effect of improving intellectual function, and more than that, they are expected to have an effect on suppression of the progression of Alzheimer's disease; and third-generation drugs are radical preventive/therapeutic drugs.
[0005]Most of the drugs currently under evaluation are thought to be first-generation drugs. The "amyloid cascade hypothesis", which ascribes senile plaque formation via aggregation and deposition of amyloid peptides as the cause of the disease, is widely accepted as the mechanism of onset and progression in Alzheimer's disease. Some of the drugs that target amyloid peptides are expected to be further developed into second- or third-generation drugs. Thus, currently, there are strong demands for second- and third-generation drugs as radical therapeutic drugs for Alzheimer's disease, as well as truly effective first-generation drugs.
[0006]On the other hand, the "inflammation hypothesis", which indicates that enhanced activity of inflammatory microglia induces neuronal cell death in the brain with Alzheimer's disease, has been proposed as the mechanism of onset in Alzheimer's disease. In fact, the microglial activity is enhanced and microglia are accumulated particularly around senile plaques in the brains of patients with Alzheimer's disease. It has also been demonstrated that the lymphocytes infiltrate the brains of patients with Alzheimer's disease, and that substances which are activated upon inflammation, such as complements, are accumulated in the brains. From the analytical results of epidemiological investigation, it was expected that anti-inflammatory drugs, in particular, non-steroidal anti-inflammatory drugs (NSAIDs) suppress the progression of Alzheimer's disease. Furthermore, indomethacin was reported to significantly suppress the progression of Alzheimer's disease in pilot clinical trials (Rogers J et al., Neurology. 1993 August; 43(8):1609-11). Thus, large-scale clinical trials were conducted mainly for Cox-2-specific inhibitors which are less likely to cause gastrointestinal disorders. However, it has been reported in a one-year study of patients with mild to moderate Alzheimer's disease, that first-generation NSAIDs and new-generation NSAIDs could not be demonstrated to have effect of suppressing the progression in Alzheimer's disease (Aisen P S et al., JAMA. 2003 Jun. 4; 289(21):2819-26; Imbimbo BP. Expert Opin Investig Drugs. 2004 November; 13(11):1469-81; Townsend K P et al., FASEB J. 2005 October; 19(12):1592-601). It has also been reported that oral administration of a compound called MW01-5-188WH, which is a selective inhibitor of inflammation-induced cytokine production in glial cells, to mice suppresses the amyloid β1-42-induced up-regulation of interleukin-1β, tumor necrosis factor-α, and S100B in the hippocampus, recovers synaptic failures in the hippocampus, and improves hippocampus-dependent Y-maze behavior (Ralay Ranaivo H et al., J. Neurosci. 2006 Jan. 11; 26(2):662-70).
[Non-Patent Document 1]
Rogers J et al., Neurology. 1993 August; 43(8):1609-11
[Non-Patent Document 2]
Aisen P S et al., JAMA. 2003 Jun. 4; 289(21):2819-26
[Non-Patent Document 3]
Imbimbo B P. Expert Opin Investig Drugs. 2004 November; 13(11):1469-81
[Non-Patent Document 4]
Townsend K P et al., FASEB J. 2005 October; 19(12):1592-601
[Non-Patent Document 5]
Ralay Ranaivo H et al., J. Neurosci. 2006 Jan. 11; 26(2):662-70
DISCLOSURE OF THE INVENTION
Problems to be Solved by the Invention
[0007]The present invention was achieved in view of the circumstances described above. An objective of the present invention is to provide novel treatment methods and pharmaceutical agents for the therapy of Alzheimer's disease.
Means for Solving the Problems
[0008]To achieve the above-described objective, the present inventors conducted dedicated studies to develop novel methods that are effective for treating Alzheimer's disease. Interleukin-10 (IL-10), which is one of the anti-inflammatory cytokines, regulates the inflammatory response by acting competitively against the activity of pro-inflammatory cytokines. It has been pointed out that in Alzheimer's disease, polymorphisms present in the promoter region of IL-10 are associated with the progression of the disease (Lio D et al., Genes Immun. 2003 April; 4(3):234-8; Scassellati C et al., Neurosci Lett. 2004 Feb. 12; 356(2):119-22; Arosio B et al., Neurobiol Aging. 2004 September; 25(8): 1009-15; Ma S L et al., Neurobiol Aging. 2005 July; 26(7):1005-10). However, there are no cases that examined such anti-inflammatory cytokines for the purpose of treating Alzheimer's disease. The present invention provides novel methods for treating Alzheimer's disease using anti-inflammatory cytokines or vectors expressing anti-inflammatory cytokine genes, such as negative-strand RNA viral vectors. The present invention provides novel gene therapy methods and such for treating and preventing Alzheimer's disease.
[0009]Specifically, the present invention relates to negative-strand RNA viral vectors carrying an anti-inflammatory cytokine gene for treating Alzheimer's disease or developing therapeutic agents for Alzheimer's disease; pharmaceutical compositions comprising the negative-strand RNA viral vectors for Alzheimer's disease; and methods for treating and preventing Alzheimer's disease using the negative-strand RNA viral vectors. More specifically, the present invention includes the following:
[1] a pharmaceutical composition for treating or preventing Alzheimer's disease, wherein the composition comprises
[0010]a negative-strand RNA viral vector carrying a gene encoding an anti-inflammatory cytokine or a partial peptide thereof, or
[0011]an anti-inflammatory cytokine or a partial peptide thereof;
[2] the composition of [1], wherein the composition comprises a negative-strand RNA viral vector carrying a gene encoding an anti-inflammatory cytokine or a partial peptide thereof;[3] the composition of [1], wherein the composition comprises an anti-inflammatory cytokine or a partial peptide thereof;[4] the composition of [1] or [2], wherein the negative-strand RNA viral vector is a paramyxovirus vector;[5] the composition of [1] or [2], wherein the negative-strand RNA viral vector is a Sendai virus vector;[6] the composition of any one of [1] to [5], wherein the anti-inflammatory cytokine is selected from the group consisting of interleukin-4, interleukin-10, interleukin-13, and partial peptides thereof;[7] the composition of any one of [1] to [6], wherein the composition is used for nasal administration;[8] a negative-strand RNA viral vector carrying a gene for an anti-inflammatory cytokine or a partial peptide thereof, wherein the vector is used for treating Alzheimer's disease or developing a therapeutic agent for Alzheimer's disease;[9] an anti-inflammatory cytokine protein, wherein the protein is used for treating Alzheimer's disease or developing a therapeutic agent for Alzheimer's disease;[10] the vector of [8], wherein the negative-strand RNA viral vector is a paramyxovirus vector;[11] the vector of [8], wherein the negative-strand RNA viral vector is a Sendai virus vector;[12] the vector of any one of [8], [10], and [11], wherein the anti-inflammatory cytokine is selected from the group consisting of interleukin-4, interleukin-10, interleukin-13, and partial peptides thereof;[13] a method for treating or preventing Alzheimer's disease, wherein the method comprises the step of administering a negative-strand RNA viral vector carrying a gene encoding an anti-inflammatory cytokine or a partial peptide thereof, or an anti-inflammatory cytokine or a partial peptide thereof;[14] the method of [13], wherein the administration is nasal administration.
[0012]The present invention also includes the following:
(1) a negative-strand RNA viral vector carrying a gene for an anti-inflammatory cytokine or a partial peptide thereof, wherein the vector is used for treating Alzheimer's disease or developing a therapeutic agent for Alzheimer's disease;(2) the vector of (1), wherein the negative-strand RNA viral vector is a paramyxovirus vector;(3) the vector of (1), wherein the negative-strand RNA viral vector is a Sendai virus vector;(4) the vector of any one of (1) to (3), wherein the anti-inflammatory cytokine is selected from the group consisting of interleukin-4, interleukin-10, interleukin-13, and partial peptides thereof;(5) a pharmaceutical composition for treating or preventing Alzheimer's disease, which comprises the vector of any one of (1) to (4); and(6) the pharmaceutical composition of (5), which is used for nasal administration.
[0013]The present invention also relates to methods for treating or preventing Alzheimer's disease, which comprise the step of administering an anti-inflammatory cytokine or a vector encoding it. In particular, the present invention relates to methods for treating or preventing Alzheimer's disease, which comprise the step of administering a vector capable of expressing an anti-inflammatory cytokine, such as a negative-strand RNA viral vector carrying an anti-inflammatory cytokine gene. The negative-strand RNA viral vector is preferably a paramyxovirus vector, more preferably a Sendai virus vector. The anti-inflammatory cytokine is preferably IL-10. The administration is preferably nasal administration.
[0014]The present invention also relates to the use of an anti-inflammatory cytokine or a vector encoding it in the production of pharmaceutical agents for treating or preventing Alzheimer's disease. In particular, the present invention provides the use of an anti-inflammatory cytokine, and a vector carrying an anti-inflammatory cytokine gene, specifically, a negative-strand RNA viral vector carrying an anti-inflammatory cytokine gene in the production of pharmaceutical agents for treating or preventing Alzheimer's disease. The negative-strand RNA viral vector is preferably a paramyxovirus vector, more preferably a Sendai virus vector. The anti-inflammatory cytokine is preferably IL-10. The pharmaceutical agents comprising a negative-strand RNA viral vector are formulated into dosage forms suitable for nasal administration.
EFFECTS OF THE INVENTION
[0015]The present invention provides novel therapeutic agents and methods for Alzheimer's disease using anti-inflammatory cytokines. In particular, the present invention provides therapeutic agents for Alzheimer's disease, which comprise negative-strand RNA viral vectors encoding an anti-inflammatory cytokine, and gene therapy methods for Alzheimer's disease using the vectors. The methods of the present invention can be novel therapeutic means that can be employed to substitute for or in combination with other therapeutic methods for Alzheimer's disease.
BRIEF DESCRIPTION OF THE DRAWINGS
[0016]FIG. 1 depicts the result of measurement of the blood IL-10 level after administration of an SeV vector expressing IL-10. An SeV vector expressing LacZ was used as a control. Blood IL-10 was detected in a manner specific to the IL-10-expressing SeV vector and dependent on the dosage.
[0017]FIG. 2 depicts senile plaques in the parietal lobe of cerebral neocortex and the hippocampus (anti-Aβ antibody staining). The number of senile plaques (reddish brown spots) in the cerebral neocortex is evidently smaller in the SeV18+mIL10/TSΔF group (right) than that in the SeV18+LacZ/TSΔF group (left), both four weeks (upper panels) and eight weeks (lower panels) after the vector administration.
[0018]FIG. 3 depicts the ratio (%) of the senile plaque area to the entire cerebral neocortex area (mean±SE). The ratio (%) of the area of senile plaques to that of the entire cerebral neocortex eight weeks after the administration was determined using an image analysis software. The ratio was significantly lower in the SeV18+mIL10/TSΔF group than in the control group (the SeV18+LacZ/TSΔF group) (p<0.01, Student t test).
[0019]FIG. 4 depicts the activation of microglia in the olfactory bulb (Iba-1 staining). The number of activated microglia (reddish brown amoeboid cells) in the olfactory bulb is evidently increased in the SeV18+mIL10/TSΔF group (right) as compared to the SeV18+LacZ/TSΔF group (left), both four weeks (upper panels) and eight weeks (lower panels) after the administration.
[0020]FIG. 5 depicts the ratio (%) of the area of microglia to that of a single optical field in an olfactory bulb section stained with Iba-1 (mean±SE). The ratio (%) of the area of Iba-1-positive microglia to that of the single optical field in the olfactory bulb eight weeks after the administration was determined using an image analysis software. The ratio was significantly higher in the SeV18+mIL10/TSΔF group than in the control group (the SeV18+LacZ/TSΔF group) (p<0.01, Student t test).
[0021]FIG. 6 depicts the result of measurement of the Aβ level in the brain tissue after administration of an IL-10-expressing SeV vector. An SeV vector expressing LacZ was used as a control. In the group to which the SeV vector expressing IL-10 was administered, Aβ was shown to be decreased in most of the fractions. In particular, soluble Aβ40 (in TBS fraction and 1% Triton fraction) and insoluble Aβ42 (in formic acid fraction) were shown to be significantly decreased.
[0022]FIG. 7 depicts the result of measurement of the blood IL-10 levels in normal mice after administration of an SeV vector expressing IL-10. Blood IL-10 was detected in a vector dosage-dependent manner.
[0023]FIG. 8 depicts the kinetics of blood IL-10 level after administration of an SeV vector expressing IL-10. A single dose of nasal drop of SeV18+mIL10/TSΔF (5×107 CIU/head) resulted in an AUC of 176,000 pgh/ml.
[0024]FIG. 9 depicts IL-10 transfer into the brain after nasal administration of an SeV vector expressing IL-10. SeV18+mIL10/TSΔF or SeV18+LacZ/TSΔF was nasally administered to normal C57BL/6N mice (N=5) at 5×108 CIU/head/53 μl. The same volume of DPBS(-) was administered as a control. Brain (divided into the following three parts: the olfactory bulb, cerebrum/hippocampus, and cerebellum/medulla oblongata), nasal mucosa, trachea/lung, and plasma were collected three days after the administration. mIL-10 in each tissue was quantified by ELISA. The expression levels of mIL-10 in olfactory bulb, cerebrum/hippocampus, and cerebellum/medulla oblongata shown in panel (A) are also shown in panel (B) which has a magnified scale of vertical axis.
[0025]FIG. 10 depicts IL-10 transfer into the brain after nasal administration of an SeV vector expressing IL-10. SeV18+mIL10/TSΔF or SeV18+LacZ/TSΔF was nasally administered to normal C57BL/6N mice (N=5) at 5×108 CIU/head/53 μl. The same volume of DPBS(-) was administered as a control. Perfusion was performed, and the brains were collected three days after the administration. mIL-10 in the brain (divided into the following three parts: the olfactory bulb, cerebrum/hippocampus, and cerebellum/medulla oblongata), nasal mucosa, trachea/lung, and plasma was quantified by ELISA. The expression levels of mIL-10 in olfactory bulb, cerebrum/hippocampus, and cerebellum/medulla oblongata shown in panel (A) are also shown in panel (B) which has a magnified scale of vertical axis.
[0026]FIG. 11 depicts IL-10 transfer into the brain after nasal administration of an SeV vector expressing IL-10. SeV18+mIL10/TSΔF or SeV18+LacZ/TSΔF was nasally administered to normal C57BL/6N mice (N=5) at 5×108 CIU/head/53 μl. The same volume of DPBS(-) was administered as a control. Brain (divided into the following three parts: the olfactory bulb, cerebrum/hippocampus, and cerebellum/medulla oblongata), nasal mucosa, trachea/lung, and plasma were collected after seven days from the administration. mIL-10 in each tissue was quantified by ELISA. The expression levels of mIL-10 in olfactory bulb, cerebrum/hippocampus, and cerebellum/medulla oblongata shown in panel (A) are also shown in panel (B) which has a magnified scale of vertical axis.
[0027]FIG. 12 depicts IL-10 transfer into the brain after nasal administration of an SeV vector expressing IL-10. SeV18+mIL10/TSΔF or SeV18+LacZ/TSΔF was nasally administered to normal C57BL/6N mice (N=5) at 5×108 CIU/head/53 μl. The same volume of DPBS(-) was administered as a control. Perfusion was performed, and the brains were collected seven days after the administration. mIL-10 in the brain (divided into the following three parts: the olfactory bulb, cerebrum/hippocampus, and cerebellum/medulla oblongata), nasal mucosa, trachea/lung, and plasma was quantified by ELISA. The expression levels of mIL-10 in olfactory bulb, cerebrum/hippocampus, and cerebellum/medulla oblongata shown in panel (A) are also shown in panel (B) which has a magnified scale of vertical axis.
[0028]FIG. 13 depicts IL-10 transfer into the brain (concentration in CSF) after nasal administration of an SeV vector expressing IL-10. SeV18+mIL10/TSΔF (rats #1-#5) or SeV18+LacZ/TSΔF (rats #6-#10) was nasally administered to normal Wistar rats (N=5) at 1×109 CIU/head/106 μl. The same volume of DPBS(-) was administered as a control (rats #11-#15). The plasma and cerebrospinal fluid were collected three days after the administration, and mIL-10 was quantified by ELISA.
[0029]FIG. 14 depicts the kinetics of blood IL-10 level in normal mice (C57BL/6N) after subcutaneous administration of the IL-10 protein. IL-10 from recombinant mice (2.0 μg/100 μl/head) was subcutaneously administered in the back, and blood mIL-10 was quantified by ELISA. The result is as follows: AUC=40,800 pgh/ml; Cmax=about 12,000 pg/ml; Tmax=about 1.5 hr; and t1/2=about 1 hr (initial value).
[0030]FIG. 15 depicts the IL-10 levels in APP mice after subcutaneous administration of the IL-10 protein.
[0031]FIG. 16 shows photographs depicting the effects of continuous subcutaneous administration of IL-10 to APP model mice (Tg2576). Results of anti-Aβ antibody (4G8) immunostaining of sections of the parietal lobe of cerebral neocortex and the hippocampus are shown. The upper panel shows the result for the IL-10 administration group, in which a small number of senile plaques (brown spots) were observed in the cerebral neocortex. The lower panel shows the result for the DPBS(-) administration group, in which many senile plaques were observed in the cerebral neocortex.
[0032]FIG. 17 depicts the result of semi-quantitative measurement of senile plaques in APP model mice (Tg2576) after continuous subcutaneous administration of IL-10. The scores for senile plaques were assigned according to the size as follows: large: nine points; middle: three points; small: one point. The total scores of senile plaques observed in the whole brain (excluding brain stem and cerebellum) were calculated. Statistical analysis between the groups was performed (Student's t test; mean±standard deviation).
[0033]FIG. 18 depicts the result of quantification of the area of senile plaques in the olfactory bulb, cerebral neocortex, and hippocampus of APP model mice (Tg2576) after continuous subcutaneous administration of IL-10 (Student t test). The "IL-10" and "DPBS(-)" bars indicate the results for the IL-10 and DPBS(-) administration groups, respectively.
BEST MODE FOR CARRYING OUT THE INVENTION
[0034]The present invention relates to therapeutic agents and preventive agents for Alzheimer's disease, which comprise anti-inflammatory cytokines or vectors expressing anti-inflammatory cytokines. Such vectors include plasmids, naked DNAs, lyposome compositions, and viral vectors. In particular, the present invention relates to negative-strand RNA viral vectors carrying an anti-inflammatory cytokine gene for treating Alzheimer's disease or developing therapeutic agents for Alzheimer's disease, and pharmaceutical compositions that comprise the vectors for treating or preventing Alzheimer's disease. "Negative-strand RNA virus" (also referred to as "minus-strand RNA virus") refers to a virus comprising a negative-strand (an antisense strand complementary to a sense strand encoding viral proteins) RNA as the genome. "Minus-strand RNA virus" is also referred to as "negative-strand RNA virus". In particular, negative-strand RNA viruses that are preferably used in the present invention are negative single-stranded RNA viruses (also referred to as non-segmented negative-strand RNA viruses). "Negative single-stranded RNA virus" refers to a virus comprising a negative single-stranded RNA, i.e., a minus-strand RNA, as the genome. Such viruses include viruses belonging to Paramyxoviridae (including the genera Paramyxovirus, Morbillivirus, Rubulavirus, and Pneumovirus, etc.), Rhabdoviridae (including the genera Vesiculovirus, Lyssavirus, and Ephemerovirus, etc.), Filoviridae, and such. The negative-strand RNA viral vectors used in the present invention may be transmissible vectors or non-transmissible defective vectors. "Transmissible" means that, when a host cell is infected with a viral vector, the virus is replicated in the cell to produce infectious viral particles.
[0035]Specific examples of particularly preferred negative-strand RNA viruses suitable for use in the context of the present invention include, for example, Sendai virus, Newcastle disease virus, mumps virus, measles virus, respiratory syncytial virus (RS virus), rinderpest virus, distemper virus, simian parainfluenza virus (SV5), and human parainfluenza viruses 1, 2, and 3 belonging to Paramyxoviridae; influenza virus belonging to Orthomyxoviridae; and vesicular stomatitis virus and rabies virus belonging to Rhabdoviridae.
[0036]More preferably, paramyxoviruses are used in the present invention. "Paramyxoviruses" refers to viruses belonging to Paramyxoviridae, or derivatives of the viruses. Preferred paramyxoviruses include viruses belonging to Paramyxovirinae (including Respirovirus, Rubulavirus, and Morbillivirus), more preferably those belonging to the genus Respirovirus (also referred to as the genus Paramyxovirus) or derivatives thereof. The derivatives include viruses that are genetically-modified or chemically-modified in a manner not to impair their gene-transferring ability. Examples of viruses of the genus Respirovirus applicable to this invention are human parainfluenza virus-1 (HPIV-1), human parainfluenza virus-3 (HPIV-3), bovine parainfluenza virus-3 (BPIV-3), Sendai virus (also referred to as murine parainfluenza virus-1), and simian parainfluenza virus-10 (SPIV-10). In the context of the present invention, a more preferred paramyxovirus is the Sendai virus. These viruses may be derived from natural strains, wild strains, mutant strains, laboratory-passaged strains, artificially constructed strains, or the like.
[0037]Herein, "vector" refers to a carrier for introducing nucleic acids into cells. Negative-strand RNA viruses such as Sendai virus are excellent gene transfer vectors. In their life cycle, the vectors are transcribed and replicated only in the host cytoplasm. Since the vectors do not have any DNA phase, chromosomal integration does not occur. Therefore, safety issues such as oncogenic transformation and immortalization due to chromosomal aberration do not occur. This characteristic of negative-strand RNA viruses greatly contributes to safety when they are used as vectors. Results of foreign gene expression show that few nucleotide mutations are observed even after multiple continuous passages of Sendai virus. This indicates that the viral genome is highly stable and inserted foreign genes are stably expressed over a long period of time (Yu, D. et al., Genes Cells 2, 457-466 (1997)). Furthermore, the virus has qualitative advantages such as flexibility in the size and packaging of inserted genes due to the absence of a capsid structural protein.
[0038]The negative-strand RNA viral vector of the present invention may be, for example, a complex comprising the genomic RNA of a negative-strand RNA virus and viral proteins, namely, a ribonucleoprotein (RNP). Specifically, such an RNP is a complex comprising the genomic RNA of a negative-strand RNA virus, the N protein, P protein, and L protein. When RNPs are introduced into cells, cistrons encoding viral proteins are transcribed from the genomic RNA through the action of viral proteins, and the genome itself is replicated to form daughter RNPs. Thus, sustained expression of RNPs is expected. RNPs can be introduced into cells, for example, by combining the RNPs with a desirable transfection reagent. Replication of the genomic RNA can be confirmed by detecting the increase in the copy number of the RNA using RT-PCR, Northern blot hybridization, or such.
[0039]Alternatively, the negative-strand RNA viral vector of the present invention is preferably a negative-strand RNA viral particle. "Viral particle" refers to a microparticle comprising a nucleic acid, which is released from cells through the action of viral proteins. A negative-strand RNA viral particle has a structure in which the above-described RNP comprising the genomic RNA and viral proteins is enclosed in a lipid membrane (referred to as "envelope") derived from the cell membrane. The viral particles may show infectivity. "Infectivity" refers to the ability of a negative-strand RNA viral vector, which has cell-adhesion and membrane-fusion abilities, to introduce a nucleic acid inside the vector into cells to which the vector has adhered. The negative-strand RNA viral vectors of the present invention may be transmissible vectors or defective non-transmissible vectors. "Transmissible" means that, when a host cell is infected with a viral vector, the virus is replicated in the cell to produce infectious viral particles.
[0040]The genomic RNA of a negative-strand RNA virus encodes a carried gene in the antisense direction. In general, the genome of a negative-strand RNA virus is constituted so that the viral genes are arranged in the antisense orientation between the 3' leader region and the 5' trailer region. "Transcription ending sequence (E sequence)-intervening sequence (I sequence)-transcription starting sequence (sequence)" exists between the ORFs of individual genes, which allows the RNAs encoding the ORFs of the genes to be transcribed as separate cistrons. The genomic RNA comprised in the vector of the present invention encodes the N (nucleocapsid (also referred to as nucleoprotein (NP)), P (phospho), and L (large) proteins in the antisense direction, which are viral proteins necessary for expression of the group of genes encoded by the RNA, and for autonomous replication of the RNA itself. The RNA may encode the M (matrix) protein, which is necessary for formation of viral particles. The RNA may also encode envelope proteins, which are necessary for infection of viral particles. The envelope proteins of negative-strand RNA virus include the F (fusion) protein, which causes cell membrane fusion, and the HN (hemagglutinin-neuraminidase) (or H (hemagglutinin)) protein, which is necessary for adhesion to cells. However, for certain cell types, the HN protein is not required for infection (Markwell, M. A. et al., Proc. Natl. Acad. Sci. USA 82(4):978-982 (1985)), and infection is achieved by just the F protein. The RNA may encode viral envelope proteins other than the F protein and/or HN protein.
[0041]For example, respective genes of each virus belonging to Paramyxovirinae are commonly represented as follows. In general, the NP gene is also represented as "N". Furthermore, when "HN" has no neuraminidase activity, it is represented as "H (hemagglutinin)".
The genus Respirovirus: NP P/C/V M F HN-LThe genus Rubulavirus: NP P/V M F HN(SH) LThe genus Morbillivirus: NP P/C/V M F H-L
[0042]The negative-strand RNA viral vectors of the present invention may lack any of the wild-type negative-strand RNA viral genes. The viral genomic RNA can replicate and express carried genes in cells as long as it encodes viral proteins (i.e., N, L, and P) necessary for RNP reconstitution, even when it does not encode any envelope-constituting protein. Such vectors include, for example, vectors that lack at least one of the genes encoding envelope-constituting proteins such as F, H, HN, G, M, and Ml, which vary depending on the type of virus (WO 00/70055 and WO00/70070; Li, H.-O. et al., J. Virol. 74(14) 6564-6569 (2000)). For example, a vector that lacks the M, F, or HN gene, or any combination thereof, can be preferably used as a paramyxovirus vector of the present invention. Such viral vectors can be reconstituted, for example, by externally supplying the missing gene products. The viral vectors prepared as described above adhere to host cells and cause cell fusion, as wild type viruses do. However, the viral vectors do not form daughter viral particles that retain the infectivity of the original vectors, since the vector genome introduced into the cells lacks some viral genes. Therefore, such vectors are useful as safe viral vectors for one-time gene introduction. Examples of genes deleted from the genome include the F gene and HN gene. In particular, vectors lacking at least the F gene are preferred in the present invention. For example, viral vectors can be reconstituted by transfecting host cells with a plasmid expressing a recombinant negative-strand RNA viral vector genome lacking the F gene, along with a vector expressing the F protein and a vector expressing the N, P, and L proteins (International Publication Numbers WO 00/70055 and WO 00/70070; Li, H O. et al., J. Virol. 74(14) 6564-6569 (2000)). Viruses can also be produced, for example, using host cells comprising F gene-integrated chromosomes. When these proteins are externally supplied, their amino acid sequences are not necessarily identical to those of virus-derived sequences. Mutations may be introduced into the proteins, and/or homologous genes from other viruses may be used as substitutes, as long as the activity of nucleic acid introduction is equivalent to or greater than that of naturally-occurring proteins.
[0043]Furthermore, amplification of the genomic RNA after introduction into cells can be prevented, when at least one of the genes encoding viral proteins (i.e., N, L, and P) necessary for RNP reconstitution is deleted or deficient. Such vectors can be produced by expressing the N, P, and L proteins in virus-producing cells.
[0044]The viral vectors of the present invention may be, for example, vectors that comprise, on the envelope surface thereof, proteins such as adhesion factors capable of adhering to specific cells, ligands, receptors and such, or antibodies or fragments thereof. Alternatively, the vectors may comprise chimeric proteins or such that have the above-mentioned proteins in their extracellular domain and polypeptides derived from the virus envelope in their intracellular domain. Vectors that target and infect specific tissues can thereby be produced. These proteins may be encoded by the viral genome, or may be supplied by expressing genes other than those in the viral genome (for example, genes carried by other expression vectors, or genes in the host chromosomes) at the time of viral vector reconstitution.
[0045]In the vectors of the present invention, any viral gene comprised may be altered from the wild type gene, for example, to reduce the immunogenicity of viral proteins, or to enhance the efficiency of RNA transcription or replication. Specifically, the transcriptional or replicational function of negative-strand RNA viral vector can be enhanced, for example, by altering at least one of the replication factor genes, N, P, and L. The HN protein, which is an envelope protein, has both hemagglutinin activity and neuraminidase activity. For example, the viral stability in blood can be enhanced by attenuating the hemagglutinin activity, and infectivity can be controlled by modifying the neuraminidase activity. The membrane fusion ability can be controlled by altering the F protein. Furthermore, for example, the antigen-presenting epitopes of the F protein or HN protein which may act as antigenic molecules on the cell surface can be analyzed, and this information can be used to prepare viral vectors that have a reduced antigenicity of these proteins. Furthermore, a temperature-sensitive mutation may be introduced into a viral gene to suppress release of secondarily released particles (or virus-like particles (VLPs)) (WO 2003/025570). For example, the following mutations can be introduced: G69E, T116A, and A183S for the M gene; A262T, G264, and K461G for the HN gene; L511F for the P gene; and N1197S and K1795E for the L gene. However, temperature-sensitive mutations that can be introduced are not limited thereto (see WO 2003/025570).
[0046]In the present invention, the genomic RNA of the above-described negative-strand RNA viral vector comprises a foreign gene encoding an anti-inflammatory cytokine. Herein, "anti-inflammatory cytokine" (also referred to as "anti-inflammation cytokine") collectively refers to polypeptides that function to suppress inflammation, which include signaling molecules that promote signal transduction that leads to suppression of inflammation, and/or signaling molecules that inhibit signal transduction that leads to enhancement of inflammation (for example, pro-inflammatory cytokine inhibitors). Specifically, in the present invention, the anti-inflammatory cytokines include interleukin (IL)-4, IL-10, IL-11, IL-13, TGF-β, soluble TNF-α receptor, IL-1 receptor antagonist (IL-1ra), and other Th2 cytokines. "Th2 cytokines" refers to cytokines produced predominantly by type-2 helper T cells (Th2 cells) rather than by type-1 helper T cells (Th1 cells). Specifically, such Th2 cytokines include IL-4, IL-5, IL-6, IL-9, IL-10, and IL-13. An anti-inflammatory cytokine encoded by a vector may be a full-length natural polypeptide, or may be a partial peptide thereof (active fragment etc.), as long as it retains the activity. For example, deletion of N- or C-terminal amino acid residue(s) (for example, one to 30 amino acids, more specifically, one, two, three, four, five, ten, 15, 20, or 25 amino acids) probably has no influence on the cytokine activity. Alternatively, the anti-inflammatory cytokines may be polypeptides that inhibit signal transduction of pro-inflammatory cytokines, and include a soluble fragment of pro-inflammatory cytokine receptor (comprising a ligand-binding domain), or an antibody or antibody fragment that binds to the ligand-binding domain of a pro-inflammatory cytokine receptor. For the pro-inflammatory cytokine, a desired fragment comprising a mature polypeptide that lacks signal sequence can be used, and a desired protein signal sequence can be appropriately used as the N-terminal signal sequence for its secretion to the outside of cells. The secretory signal sequences include, for example, the signal sequences of desired secretory proteins such as interleukin (IL)-2 and tissue plasminogen activator (tPA), but are not limited thereto. Alternatively, the cytokine may be expressed as a protein fused to other peptide(s).
[0047]In the present invention, the anti-inflammatory cytokine is preferably selected from the group consisting of IL-4, IL-10, IL-13, and TGF-beta, and is more preferably IL-10. The nucleotide sequence of each cytokine gene and the corresponding amino acid sequence are known (IL-4: NM 000589, NP--000580, AAH66277, AAH67515, NP--758858, NP--067258, and NP--958427; IL-10: NM--000572, NP--000563, CAG46825, NP--034678, and NP--036986; IL-13: NM--002188, NP--002179, AAB01681, NP--032381, and NP--446280; and TGF-beta (transforming growth factor-beta): M--60316).
[0048]Genes encoding anti-inflammatory cytokines can be obtained by hybridization using the above-exemplified anti-inflammatory cytokine genes, or such as probes. High-stringency conditions for hybridization include, for example, overnight prehybridization at 42° C. followed by overnight hybridization at 42° C. in a hybridization solution containing 25% formamide, 4×SSC, 50 mM Hepes (pH 7.0), 10×Denhardt's solution, and 20 μg/ml denatured salmon sperm DNA, or in a hybridization solution containing 50% formamide, 4×SSC, 50 mM Hepes (H 7.0), 10×Denhardt's solution, and 20 μg/ml denatured salmon sperm DNA for more stringent conditions. Post-hybridization wash may be carried out under the washing and temperature conditions of "1×SSC, 0.1% SDS, 37° C." or such, "0.5×SSC, 0.1% SDS, 42° C." or such for more stringent conditions, or "0.2×SSC, 0.1% SDS, 65° C." for yet more stringent conditions. Furthermore, slight mutations causing no functional loss in protein can be introduced into natural cytokine genes by known methods. For example, site-directed mutations can be introduced by the PCR method, cassette mutagenesis method, or such. Alternatively, random mutations can be introduced by using chemical reagents, random nucleotides, or such. The amino acid sequence of an anti-inflammatory cytokine obtained by such method normally has a high homology to the amino acid sequence of the above-exemplified anti-inflammatory cytokine. "High homology" refers to sequence identity of at least 60% or more, preferably 80% or more, more preferably 90% or more, even more preferably at least 95% or more, and still more preferably at least 97% or more (for example, 98 to 99%). Such amino acid sequence identity can be determined, for example, using the BLAST algorithm by Karlin and Altschul (Proc. Natl. Acad. Sci. USA 87:2264-2268, 1990; and Proc. Natl. Acad. Sci. USA 90:5873-5877, 1993). When amino acid sequences are analyzed using BLASTX developed based on this algorithm (Altschul et al. J. Mol. Biol. 215: 403-410, 1990), the parameters are set, for example, as follows: score=50 and wordlength=3. When the BLAST and Gapped BLAST programs are used, the default parameters of each program are used. Specific procedures of these analytical methods are known (see the webpage of NCBI).
[0049]The activity of each anti-inflammatory cytokine can be detected by known methods. For example, methods for detecting activity by growth assay using the mouse mast cell MC/9 (ATCC CRL-8306), the human erythroleukemia cell line TF-1 (ATCC CRL-2003), or such are known (Thompson-Snipes, L. et al., 1991, J. Exp. Med. 173:507-510; Kruse N et al., EMBO J. 1993; 12:5121-5129; Oshima Y et al., J Biol Chem 2001; 276:15185-91; Oshima, Y., et al., J. Biol. Chem. 275, 14375-14380, 2000; Leland, P. et al., Oncol. Res. 7, 227-235, 1995). For example, various anti-inflammatory cytokine deletion mutants prepared using genetic recombination techniques can be assayed by the methods described above to identify active fragments. 50% effective dose (ED50) is calculated. It is preferable to use partial peptides or such that have an activity of 50% or more, preferably 60% or more, 70% or more, 80% or more, 90% or more, or 95% or more when compared to the wild type.
[0050]There is no particular limitation on the origin of an anti-inflammatory cytokine encoded by the vector. The anti-inflammatory cytokine may be derived from any mammals, such as mice, rats, guinea pigs, rabbits, pigs, cattle, horses, donkeys, goats, dogs, chimpanzees, monkeys, and human. However, it is appropriate to use an anti-inflammatory cytokine derived from the same species as the subject of administration. As described above, the nucleotide sequences of the nucleic acids encoding such cytokines are available from databases. More specifically, for example, the sequence of mouse IL-10 is available under Genbank Accession Nos. AY410237 and NM--010548, and the sequence of human IL-10 is available under Genbank Accession Nos. AY029171 and NM--000572. For the site of inserting a foreign gene, a desired site can be selected, for example, within the non-protein-coding region of a virus genome. A foreign gene can be inserted, for example, between the 3' leader region of genomic RNA and the viral protein ORF closest to the 3' end, between the viral protein ORFs, and/or between the viral protein ORF closest to the 5' end and the 5' trailer region. Alternatively, in a genome in which the genes for envelope-constituting proteins, such as the M, F, or HN gene, are deleted, a foreign gene can be inserted into the deleted regions. When a foreign gene is introduced into a paramyxoviridae virus, the chain length of a polynucleotide fragment inserted into the genome is desirably a multiple of six (Kolakofski, D. et al., J. Virol. 1998: 72; 891-899; Calain, P. and Roux, L. J. Virol. 1993: 67; 4822-4830). An E-1-S sequence is arranged to be between the inserted foreign gene and the viral ORF. Two or more foreign genes can be inserted in tandem via E-1-S sequences.
[0051]In the present invention, "gene" refers to a genetic substance, i.e., a nucleic acid encoding a transcriptional unit. Nucleic acids include RNAs and DNAs. In the present invention, a nucleic acid encoding a polypeptide is referred to as a gene for the polypeptide. Furthermore, genes include those do not encode protein. For example, a gene may encode a functional RNA, such as a ribozyme or an antisense RNA. In general, a gene may be a naturally-occurring or artificially-designed sequence. In the present invention, "DNAs" includes both single-stranded and double-stranded DNAs. "Encoding a protein" means that a polynucleotide comprises an ORF that encodes an amino acid sequence of the protein in the sense or antisense direction, so that the protein can be expressed under appropriate conditions. In the present invention, "foreign gene" refers to a gene that is not carried by the wild-type virus from which a vector is derived.
[0052]Expression levels of a foreign gene carried by a vector can be controlled using the type of transcriptional initiation sequence added upstream (to the 3'-side of the minus strand) of the gene (WO01/18223). The expression levels can also be controlled by the position at which the foreign gene is inserted in the genome: the nearer the insertion position is to the 3'-end of the minus strand, the higher the expression level; conversely, the nearer the insertion position is to the 5'-end, the lower the expression level. Since it is generally advantageous to obtain high expression of an anti-inflammatory cytokine, it is preferable to link the anti-inflammatory cytokine-encoding gene to a highly efficient transcriptional initiation sequence, and to insert it near the 3'-end of the minus strand genome. Specifically, a foreign gene may be inserted between the 3'-leader region and the viral protein ORF closest to the 3'-end. Alternatively, a foreign gene may be inserted between the ORFs of the viral protein gene closest to the 3'-end and the second closest viral protein gene, or between the ORFs of the second and third closest viral protein genes. In wild type paramyxoviruses, the viral protein gene closest to the 3'-end of the genome is the N gene, the second closest gene is the P gene, and the third closest gene is the M gene. Alternatively, in those cases wherein a high level of expression of the antigen polypeptide is undesirable, the level of viral vector gene expression can be suppressed to obtain an appropriate effect, for example, by inserting the foreign gene at a site as close as possible to the 5'-side of the minus strand genome, or by selecting an inefficient transcriptional initiation sequence.
[0053]For example, a desired S sequence of a negative-strand RNA virus may be used as the S sequence to be attached when inserting a foreign gene-encoding nucleic acid into the genome.
[0054]The consensus sequence 3'-UCCCWVUUWC-5' (W=A or C; V=A, C, or G) (SEQ ID NO: 1) can be preferably used for Sendai viruses. Particularly preferred sequences are 3'-UCCCAGUUUC-5' (SEQ ID NO: 2), 3'-UCCCACUUAC-5' (SEQ ID NO: 3), and 3'-UCCCACUUUC-5' (SEQ ID NO: 4). When shown as plus strand-encoding DNA sequences, these sequences are 5'-AGGGTCAAAG-3' (SEQ ID NO: 5), 5'-AGGGTGAATG-3' (SEQ ID NO: 6), and 5'-AGGGTGAAAG-3' (SEQ ID NO: 7). A preferred E sequence of a Sendai viral vector is, for example, 3'-AUUCUUUUU-5' (SEQ ID NO: 8) or 5'-TAAGAAAAA-3' (SEQ ID NO: 9) for the plus strand-encoding DNA. An I sequence may be, for example, any three nucleotides, specifically 3'-GAA-5' (5'-CTT-3' in the plus strand DNA).
[0055]As described above, the vector of the present invention may comprise another foreign gene at a position other than the position into which a gene encoding an anti-inflammatory cytokine is inserted. There is no limitation on such foreign genes. The foreign genes may be, for example, marker genes for monitoring vector infection, genes for cytokines, hormones, receptors, or antibodies that regulate the immune system, or fragments thereof, or other genes. The vectors of the present invention enable expression of anti-inflammatory cytokines via direct (in vivo) administration to a living body, or via indirect (ex vivo) administration which introduces a vector of the present invention into patient-derived cells or other cells and administers the cells to patients.
[0056]The negative-strand RNA viral vectors of the present invention do not encode the Aβ antigen. In other words, the negative-strand RNA viral vectors of the present invention do not comprise any nucleic acid encoding the Aβ antigen. The vectors of the present invention do not encode the Aβ antigen, and can therefore exert therapeutic effects on Alzheimer's disease. "Aβ antigen" refers to Aβ or an antigenic partial peptide thereof, and includes Aβ1-38, Aβ1-39, Aβ1-40, Aβ1-42, Aβ1-43, and Aβ1-44, and polypeptides comprising an antigenic partial fragment thereof. The negative-strand RNA viral vectors of the present invention do not encode, for example, polypeptides that comprise ten or more consecutive amino acids (preferably, nine, eight, seven, six, or five or more amino acids) from Aβ1-43 (DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT, SEQ ID NO: 10).
[0057]Recombinant negative-strand RNA viral vectors may be reconstituted using known methods. For example, such vectors can be produced by the steps of (a) transcribing DNA which encodes the genomic RNA of a negative-strand RNA virus encoding an anti-inflammatory cytokine, or the complementary strand thereof (antigenomic RNA, plus-strand), in mammalian cells or avian cells in the presence of viral proteins constituting RNP comprising the genomic RNA of the negative-strand RNA virus, and (b) collecting the produced negative-strand RNA viruses or RNP comprising the genomic RNA. The "viral proteins constituting RNP" mentioned above refers to proteins that form RNP together with the viral genomic RNA and constitute a nucleocapsid. These are a group of proteins necessary for genome replication and gene expression, and are typically N (nucleocapsid (also referred to as nucleoprotein (NP))-, P (phospho)-, and L (large)-proteins. Although these notations vary depending on viral species, corresponding proteins are known to those skilled in the art (Anjeanette Robert et al., Virology 247:1-6 (1998)). For example, "N" may be denoted as "NP".
[0058]When reconstituting viruses, a negative-strand RNA genome (i.e. antisense strand, which is the same as the viral genome) or the plus-strand RNA (antigenome, the complementary strand of the genomic RNA) may be generated as described above. However, in order to increase the efficiency of vector reconstitution, the plus-strand is preferably generated. The viral genomic RNA may be deficient in genes encoding envelope-constituting proteins, as long as it encodes viral proteins required for RNP reconstitution. For example, the genomic RNA does not need to encode viral proteins, such as F, HN, and M, as long as it encodes the N, P, and L proteins. Such defective viruses can amplify the genomic RNA in cells, but do not release infectious virions, and thus are useful as highly safe gene transfer vectors (WO00/70055, WO00/70070, and WO03/025570; Li, H.-O. et al., J. Virol. 74(14) 6564-6569 (2000)). To produce a viral vector, the above envelope-constituting proteins are expressed separately in virus-producing cells to complement particle formation. In order to express viral proteins and RNA genome in cells, a vector linked with DNA that encodes the proteins or genome downstream of an appropriate promoter is introduced into host cells. The promoter used include, for example, CMV promoters (Foecking, M. K. and Hofstetter, H. (1986) Gene 45: 101-105), retrovirus LTRs (Shinnik, T. M., Lerner, R. A. and Sutcliffe (1981) Nature, 293, 543-548), EF1 promoters, and CAG promoters (Niwa, H. et al. (1991) Gene. 108: 193-199, and Japanese Patent Application Kokai Publication No. (JP-A) H3-168087 (unexamined, published Japanese patent application)).
[0059]The terminals of genomic RNA preferably reflect the terminals of the 3'-leader sequence and 5'-trailer sequence as accurately as possible, as in the natural viral genome. For example, a self-cleaving ribozyme is added at the 5'-end of the transcript to allow the ribozyme to accurately cleave off the end of the negative-strand RNA viral genome (Inoue, K. et al. J. Virol. Methods 107, 2003, 229-236). Alternatively, in order to accurately regulate the 5'-end of the transcript, the recognition sequence of bacteriophage RNA polymerase is used as a transcription initiation site, and the RNA polymerase is expressed within a cell to induce transcription. The bacteriophage RNA polymerase used include, for example, those of E. coli T3 phage and T7 phage, and Salmonella SP6 phage (Krieg, P. A. and Melton, D. A. 1987, Methods Enzymol. 155: 397-15; Milligan, J. F. et al., 1987, Nucleic Acids Res. 15: 8783-798; Pokrovskaya, I. D. and Gurevich, V. V., 1994, Anal. Biochem. 220: 420-23). Such bacteriophage RNA polymerases can be supplied using, for example, vaccinia viruses expressing the polymerases (Fuerst, T. R. et al., Proc. Natl. Acad. Sci. USA 83, 8122-8126 (1986), or supplied from expression vectors such as plasmids. To regulate the 3'-end of the transcript, for example, a self-cleaving ribozyme is encoded at the 3'-end of the transcript, allowing accurate cleavage of the 3'-end with this ribozyme (Hasan, M. K. et al., J. Gen. Virol. 1997:78:2813-2820; Kato, A. et al., EMBO J. 1997, 16: 578-587; and Yu, D. et al., Genes Cells 1997, 2: 457-466). An auto-cleaving ribozyme derived from the antigenomic strand of delta hepatitis virus can be used.
[0060]In the reconstitution of viruses in which the envelope-constituting protein genes have been deleted, the infectivity of produced viruses can be complemented by expressing the deleted envelope-constituting proteins and/or other envelope proteins in virus-producing cells. For example, the viruses may also be pseudotyped with envelope proteins of negative-strand RNA viruses of a different origin from the virus from which the viral vector genome is derived. Such an envelope protein used may be, for example, the G protein of vesicular stomatitis virus (VSV) (VSV-G) (J. Virology 39: 519-528 (1981)) (Hirata, T. et al., 2002, J. Virol. Methods, 104:125-133; Inoue, M. et al., 2003, J. Virol. 77:6419-6429; Inoue M. et al., J Gene Med. 2004; 6:1069-1081). Genes to be deleted from the genome include, for example, genes of spike proteins such as F, HN, H, and G, genes of envelope-lining proteins such as M, and any combinations thereof. Deletion of a spike protein gene is effective in rendering negative-strand RNA viral vectors nontransmissible, whereas deletion of the gene of an envelope-lining protein such as M protein is effective in disabling the particle formation from infected cells. For example, F gene-defective negative-strand RNA viral vectors (Li, H.-O. et al., J. Virol. 74, 6564-6569 (2000)), M gene-defective negative-strand RNA viral vectors (Inoue, M. et al., J. Virol. 77, 6419-6429 (2003)), and the like are preferably used. Moreover, greater safety would be assured with vectors defective in any combination of at least two of F, HN (or H) and M genes. For example, vectors lacking both M and F genes are nontransmissible and defective in particle formation while retaining high level infectivity and gene expression ability.
[0061]For instance, in an example of the production of F gene-defective recombinant viruses, a plasmid expressing a negative-strand RNA viral genome defective in F gene or a complementary strand thereof is transfected into host cells along with an expression vector expressing F protein and expression vectors for N, P, and L proteins. Alternatively, viruses can be more efficiently produced by using host cells in which the F gene has been incorporated into their chromosomes (WO00/70070). In this case, a sequence-specific recombinase such as Cre/loxP and FLP/FRT and a target sequence thereof are preferably used so that the F gene can be inducibly expressed (see WO00/70055, WO00/70070; Hasan, M. K. et al., 1997, J. General Virology 78: 2813-2820). Specifically, for example, the envelope protein genes are integrated into a vector having a recombinase target sequence, such as the Cre/loxP inducible expression plasmid pCALNdlw (Arai, T. et al., J. Virology 72, 1998, p 1115-1121). The expression is induced by, for example, infection with the adenovirus AxCANCre at an MOI of 3 to 5 (Saito et al., Nucl. Acids Res. 23: 3816-3821 (1995); and Arai, T. et al., J. Virol 72, 1115-1121 (1998)).
[0062]The negative-strand RNA viruses used in the present invention may be deficient in accessory genes. For example, by knocking out the V gene, one of the accessory genes of Sendai virus (SeV), the pathogenicity of SeV toward hosts such as mice is remarkably reduced without hindering gene expression and replication in cultured cells (Kato, A. et al., 1997, J. Virol. 71:7266-7272; Kato, A. et al., 1997, EMBO J. 16:578-587; Curran, J. et al.; WO01/04272; and EP1067179).
[0063]In addition, negative-strand RNA viruses used may include mutations in the P gene or L gene so as to enhance the persistence of infection. Specific examples of such mutations include mutation of Glu at position 86 (E86) of the SeV P protein, substitution of Leu at position 511 (L511) of the SeV P protein to another amino acid, or substitution of homologous sites in the P protein of a different negative-strand RNA virus. Specific examples include substitution of the amino acid at position 86 to Lys, and substitution of the amino acid at position 511 to Phe. Regarding the L protein, examples include substitution of Asn at position 1197 (N1197) and/or Lys at position 1795 (K1795) in the SeV L protein to other amino acids, or substitution of homologous sites in the L protein of another negative-strand RNA virus, and specific examples include substitution of the amino acid at position 1197 to Ser, and substitution of the amino acid at 1795 to Glu. Mutations of the P gene and L gene can significantly increase the effects of persistent infectivity, suppression of the release of secondary virions, and suppression of cytotoxicity.
[0064]Regarding more specific methods for the reconstitution of recombinant viruses, one can refer to, for example, the following references: WO97/16539; WO97/16538; WO00/70055; WO00/70070; WO01/18223; WO03/025570; Durbin, A. P. et al., 1997, Virology 235: 323-332; Whelan, S. P. et al., 1995, Proc. Natl. Acad. Sci. USA 92: 8388-8392; Schnell. M. J. et al., 1994, EMBO J. 13: 4195-4203; Radecke, F. et al., 1995, EMBO J. 14: 5773-5784; Lawson, N. D. et al., Proc. Natl. Acad. Sci. USA 92: 4477-4481; Garcin, D. et al., 1995, EMBO J. 14: 6087-6094; Kato, A. et al., 1996, Genes Cells 1: 569-579; Baron, M. D. and Barrett, T., 1997, J. Virol. 71: 1265-1271; Bridgen, A. and Elliott, R. M., 1996, Proc. Natl. Acad. Sci. USA 93: 15400-15404; Hasan, M. K. et al., J. Gen. Virol. 78: 2813-2820, 1997; Kato, A. et al., 1997, EMBO J. 16: 578-587; Yu, D. et al., 1997, Genes Cells 2: 457-466; Tokusumi, T. et al. Virus Res. 2002: 86; 33-38; Li, H.-O. et al., J. Virol. 2000: 74; 6564-6569. Following these methods, negative-strand RNA viruses including parainfluenza virus, vesicular stomatitis virus, rabies virus, measles virus, rinderpest virus, Sendai virus, and the like can be reconstituted from DNA.
[0065]The present invention provides methods for producing therapeutic and/or preventive agents for Alzheimer's disease (pharmaceutical compositions for treating and/or preventing Alzheimer's disease), which comprise the steps of:
(a) allowing transcription of a DNA that encodes the genomic RNA of a negative-strand RNA virus encoding an anti-inflammatory cytokine, or the complementary strand thereof (antigenomic RNA), in the presence of viral proteins that constitute an RNP comprising the genomic RNA of a negative-strand RNA virus in mammalian cells; and(b) collecting the generated negative-strand RNA virus or RNP that comprises the genomic RNA.
[0066]The present invention also relates to the use of DNAs that encode the genomic RNA of a negative-strand RNA virus encoding an anti-inflammatory cytokine, or the complementary strand thereof (antigenome RNA), in producing therapeutic and/or preventive agents for Alzheimer's disease (pharmaceutical compositions for treating and/or preventing Alzheimer's disease). Furthermore, the present invention relates to therapeutic and/or preventive agents for Alzheimer's disease (pharmaceutical compositions for treating and/or preventing Alzheimer's disease), which comprise as an active ingredient, a negative-strand RNA virus encoding an anti-inflammatory cytokine. The present invention also relates to the use of anti-inflammatory cytokines, cells producing anti-inflammatory cytokines, nucleic acids encoding an anti-inflammatory cytokine, and cells into which a nucleic acid encoding an anti-inflammatory cytokine has been exogenously introduced, in producing therapeutic and/or preventive agents for Alzheimer's disease (pharmaceutical compositions for treating and/or preventing Alzheimer's disease). In addition, the present invention relates to therapeutic and/or preventive agents for Alzheimer's disease (pharmaceutical compositions for treating and/or preventing Alzheimer's disease), which comprise as an active ingredient, an anti-inflammatory cytokine, cells producing an anti-inflammatory cytokine, a nucleic acid encoding an anti-inflammatory cytokine, or cells into which a nucleic acid encoding an anti-inflammatory cytokine has been exogenously introduced.
[0067]Desired mammalian cells and the like can be used for virus production. Specific examples of such cells include cultured cells, such as LLC-MK2 cells (ATCC CCL-7) and CV-1 cells (for example, ATCC CCL-70) derived from monkey kidney, BHK cells (for example, ATCC CCL-10) derived from hamster kidney, and cells derived from humans. In addition, to obtain a large quantity of a virus vector, a viral vector obtained from an above-described host can be used to infect embryonated hen eggs to amplify the vector. Methods for manufacturing viral vectors using hen eggs have already been developed (Nakanishi, et al., ed. (1993), "State-of-the-Art Technology Protocol in Neuroscience Research III, Molecular Neuron Physiology", Koseisha, Osaka, pp. 153-172). For example, a fertilized egg is placed in an incubator, and cultured for nine to twelve days at 37 to 38° C. to grow an embryo. After the viral vector is inoculated into the allantoic cavity, the egg is then cultured for several days (for example, three days) to proliferate the viral vector. Conditions, such as the period of culture, may vary depending upon the recombinant Sendai virus being used. Then, allantoic fluids, including the vector, are recovered. Separation and purification of a Sendai virus vector from allantoic fluids can be performed according to conventional methods (Tashiro, M., "Virus Experiment Protocol," Nagai, Ishihama, ed., Medical View Co., Ltd., pp. 68-73, (1995)).
[0068]Titers of viruses recovered can be determined, for example, by measuring CIU (Cell Infectious Unit) or hemagglutination activity (HA) (WO 00/70070; Kato, A. et al., 1996, Genes Cells 1: 569-579; Yonemitsu, Y. and Kaneda, Y., Hemaggulutinating virus of Japan-liposome-mediated gene delivery to vascular cells. Ed. by Baker A H. Molecular Biology of Vascular Diseases. Method in Molecular Medicine: Humana Press: pp. 295-306, 1999). Titers of vectors carrying a marker gene such as GFP (green fluorescent protein) can be quantified (for example, as GFP-CIU) by directly counting infected cells, using the marker as an index. Titers thus determined can be treated in the same way as CIU (WO 00/70070).
[0069]The viral vectors can be purified to be substantially pure. Purification can be achieved using known purification/separation methods, including filtration, centrifugation, adsorption, and column purification, or any combinations thereof. The phrase "substantially pure" means that the virus component constitutes a major proportion of a solution of the viral vector. For example, a viral vector composition can be deemed "substantially pure" based on the fact that the proportion of protein contained as the viral vector component as compared to the total protein (excluding proteins added as carriers and stabilizers) in the solution is 10% (w/w) or greater, preferably 20% or greater, more preferably 50% or greater, preferably 70% or greater, more preferably 80% or greater, and even more preferably 90% or greater. Specific purification methods for the viral vectors include, for example, methods using cellulose sulfate ester or cross-linked polysaccharide sulfate ester (Japanese Patent Application Kokoku Publication No. (JP-B) S62-30752 (examined, approved Japanese patent application published for opposition), JP-B S62-33879, and JP-B S62-30753) and methods including adsorption to fucose sulfate-containing polysaccharide and/or degradation products thereof (WO97/32010). However, the invention is not limited thereto.
[0070]The present invention also relates to compositions for treating and preventing Alzheimer's disease, and developing therapeutic and preventive agents for Alzheimer's disease, which comprise an anti-inflammatory cytokine, cells producing an anti-inflammatory cytokine, a nucleic acid encoding an anti-inflammatory cytokine, and cells into which a nucleic acid encoding an anti-inflammatory cytokine has been exogenously introduced. In particular, the present invention relates to compositions for treating and preventing Alzheimer's disease, and developing therapeutic and preventive agents for Alzheimer's disease, which comprise a negative-strand RNA viral vector carrying an anti-inflammatory cytokine gene, cells producing the viral vector, or cells into which the vector has been introduced. When producing compositions comprising a vector, the vector may be combined with a desired pharmaceutically acceptable carrier or vehicle as needed. "Pharmaceutically acceptable carrier or vehicle" includes desired solutions in which the vector or cells can be suspended, for example, phosphate-buffered saline (PBS), sodium chloride solutions, Ringer's solution, and culture media. In the case where the vector is amplified using hen eggs, or such, it may contain allantoic fluid. Furthermore, compositions comprising the vector may comprise a carrier or vehicle such as deionized water and an aqueous solution of 5% dextrose. In addition, the compositions may also contain vegetable oils, suspending agents, surfactants, stabilizers, biocidal agents, or such. Preservatives or other additives may also be added. The compositions of the present invention do not comprise an Aβ antigen or a nucleic acid encoding an Aβ antigen. The vectors of the present invention and composition comprising them are useful in treating and preventing Alzheimer's disease, and developing therapeutic and preventive agents for Alzheimer's disease. The present invention relates to methods for producing therapeutic and preventive agents for Alzheimer's disease, which comprise the step of producing a composition comprising an anti-inflammatory cytokine, cells producing an anti-inflammatory cytokine, a nucleic acid encoding an anti-inflammatory cytokine, or cells into which a nucleic acid encoding an anti-inflammatory cytokine has been exogenously introduced, and a pharmaceutically acceptable carrier or vehicle. The present invention also relates to the use of an anti-inflammatory cytokine, cells producing an anti-inflammatory cytokine, a nucleic acid encoding an anti-inflammatory cytokine, or cells into which a nucleic acid encoding an anti-inflammatory cytokine has been exogenously introduced, in producing therapeutic and preventive agents for Alzheimer's disease. In addition, the present invention relates to methods for producing therapeutic and preventive agents for Alzheimer's disease, which comprise the step of producing a composition comprising a negative-strand RNA viral vector carrying an anti-inflammatory cytokine gene, cells producing the viral vector, or cells into which the vector has been introduced, and a pharmaceutically acceptable carrier or vehicle. The present invention also relates to the use of a negative-strand RNA viral vector carrying an anti-inflammatory cytokine gene, cells producing the viral vector, or cells into which the vector has been introduced, in producing therapeutic and preventive agents for Alzheimer's disease. By using vectors of the present invention, the blood level of an anti-inflammatory cytokine can be increased very efficiently, thereby achieving a high AUC (area under the pharmacokinetic curve). This enables effective suppression of Aβ accumulation and senile plaque formation.
[0071]Compositions comprising a vector of the present invention can be combined with, as a carrier, an organic substance such as a biopolymer, or an inorganic substance such as hydroxyapatite; specifically, a collagen matrix, a polylactate polymer or copolymer, a polyethylene glycol polymer or copolymer, and a chemical derivative thereof, etc.
[0072]Furthermore, compositions of the present invention, for example, compositions comprising a negative-strand RNA viral vector carrying an anti-inflammatory cytokine gene, may further comprise an anti-inflammatory cytokine or a nucleic acid encoding an anti-inflammatory cytokine. Such anti-inflammatory cytokines include those described herein and combinations thereof. Preferably, the anti-inflammatory cytokine is selected from the group consisting of IL-4, IL-10, and IL-13.
[0073]Moreover, the compositions of the present invention may comprise an adjuvant. For example, the use of a composition comprising a Th2 adjuvant can further promote a shift in the Th1/Th2 balance toward Th2. The term "Th2 adjuvant" refers to adjuvants which activate type II helper T cells (Th2 cells) more predominantly than type I helper T cells (Th1 cells). Specifically, aluminum hydroxide (alum), cholera toxin (B subunit), Schistosoma mansoni egg extract proteins (such as Lacto-N-fucopentaose III), and the like may be used (Grun, J. L. and P. H. Maurer, 1989, Cellular Immunology 121: 134-145; Holmgren J et al., 1993, Vaccine 11:1179-1184; Wilson A D et al., 1993, Vaccine 11:113-118; Lindsay D S et al, 1994, Int Arch Allergy Immunol 105:281-288; Xu-Amano J et al., 1993, J Exp Med 178:1309-1320; Okano M et al., 2001, J. Immunol. 167(1):442-50).
[0074]The negative-strand RNA viruses encoding an anti-inflammatory cytokine and the compositions of the present invention, such as compositions comprising the viruses, are used for treating or preventing Alzheimer's disease, or developing therapeutic or preventive agents for Alzheimer's disease. Herein, "used for treating or preventing Alzheimer's disease, or developing therapeutic or preventive agents for Alzheimer's disease" refers to exclusive use for treating or preventing Alzheimer's disease, or for development of therapeutic or preventive agents for Alzheimer's disease. "Development of therapeutic or preventive agents" means that at least one therapeutic or preventive effect on Alzheimer's disease is detected in a negative-strand RNA virus or a composition comprising the virus when its effectiveness either as a therapeutic or preventive agent is assessed. "Treatment of Alzheimer's disease" means amelioration of at least one symptom of Alzheimer's disease, including, for example, reduction of Aβ accumulation in brain tissues or blood, or decrease of senile plaques or their area. The compositions of the present invention are useful as agents for suppressing Aβ accumulation, in particular, agents for suppressing Aβ accumulation in brain tissues, blood, or such, as compared to when the compositions of the present invention are not administered. Alternatively, the compositions of the present invention are useful as agents for suppressing senile plaque, in particular, agents for reducing the number and/or the total area of senile plaques, as compared to when the compositions of the present invention are not administered. In the present invention, the treatment or prevention of Alzheimer's disease, or the development of a therapeutic or preventive agent for Alzheimer's disease does not comprise the step of administering an Aβ antigen or a nucleic acid encoding an Aβ antigen to an individual. The present invention relates to the use of an anti-inflammatory cytokine, cells producing an anti-inflammatory cytokine, a nucleic acid encoding an anti-inflammatory cytokine, or cells into which a nucleic acid encoding an anti-inflammatory cytokine has been exogenously introduced, in particular, a negative-strand RNA viral vector carrying an anti-inflammatory cytokine gene, for treating or preventing Alzheimer's disease, or for developing therapeutic or preventive agents for Alzheimer's disease. The present invention also relates to the use of an anti-inflammatory cytokine, cells producing an anti-inflammatory cytokine, a nucleic acid encoding an anti-inflammatory cytokine, or cells into which a nucleic acid encoding an anti-inflammatory cytokine has been exogenously introduced, in particular, a negative-strand RNA viral vector carrying an anti-inflammatory cytokine gene, in producing pharmaceutical compositions for treating or preventing Alzheimer's disease.
[0075]Furthermore, the present invention relates to packages and kits for preventing and/or treating Alzheimer's disease, which comprise vessels containing an anti-inflammatory cytokine, cells producing an anti-inflammatory cytokine, a nucleic acid encoding an anti-inflammatory cytokine, or cells into which a nucleic acid encoding an anti-inflammatory cytokine has been exogenously introduced. In particular, the present invention relates to packages and kits for preventing and/or treating Alzheimer's disease, which comprise vessels containing a negative-strand RNA viral vector carrying an anti-inflammatory cytokine gene. The vectors used may be those described herein. The vessels preferably have a configuration suitable to store active ingredients such as the negative-strand RNA viral vector carrying an anti-inflammatory cytokine gene in sterile conditions. Specifically, the vessels may be a glass or plastic ampule, vial, tube, bottle, syringe, or such. The packages and kits may further comprise an anti-inflammatory cytokine or another vector encoding an anti-inflammatory cytokine. The anti-inflammatory cytokine described herein and combinations thereof may be used. Preferably, the anti-inflammatory cytokine is selected from the group consisting of IL-4, IL-10, and IL-13. The packages and kits do not contain an Aβ antigen or a nucleic acid encoding an Aβ antigen. The negative-strand RNA viral vectors may be made into, for example, compositions suitable for nasal administration. The vessels, packages, and/or kits may contain descriptions or instructions on the use of active ingredients such as an anti-inflammatory cytokine, or a gene encoding the cytokine, for preventing and/or treating Alzheimer's disease. For example, kits comprising a negative-strand RNA viral vector carrying an anti-inflammatory cytokine gene may contain descriptions or instructions on the use of the vector for preventing and/or treating Alzheimer's disease. Furthermore, the vessels, packages, and/or kits may contain descriptions or instructions that neither an Aβ antigen nor a nucleic acid encoding an Aβ antigen is used in used in combination. The kits of the present invention are useful, for example, for suppression of Aβ accumulation, in particular, for suppressing Aβ accumulation in brain tissues, blood, or such, as compared to when the kits are not used. Furthermore, the kits of the present invention are useful for suppressing senile plaques, in particular, for reducing the number and/or the total area of senile plaques, as compared to when the kits are not used.
[0076]Alzheimer's disease can be treated and prevented by directly or indirectly administering an anti-inflammatory cytokine or a nucleic acid expressing an anti-inflammatory cytokine to an individual. In particular, Alzheimer's disease can be effectively treated and prevented by administering a negative-strand RNA virus carrying an anti-inflammatory cytokine gene or a composition comprising the virus to an individual. The present invention provides methods for treating and/or preventing Alzheimer's disease, which comprise the step of directly or indirectly administering an anti-inflammatory cytokine or a nucleic acid expressing an anti-inflammatory cytokine. In particular, the present invention provides methods for treating and/or preventing Alzheimer's disease, which comprise the step of administering a negative-strand RNA viral vector carrying an anti-inflammatory cytokine gene. The methods of the present invention do not comprise the step of administering an Aβ antigen or a nucleic acid encoding the antigen. The methods of the present invention enable the treatment of Alzheimer's disease without administering an exogenous Aβ antigen. The administration of an anti-inflammatory cytokine or a vector carrying an anti-inflammatory cytokine gene may be in vivo, or ex vivo via cells. When a negative-strand RNA viral vector is administered, the vector may be an infectious viral particle, a non-infectious viral particle, a viral core (an RNP complex containing a genome and genome-binding viral proteins), or such. In the present invention, "negative-strand RNA viral vector" refers to complexes that include a ribonucleoprotein (RNP) complex comprising the genomic RNA derived from the negative-strand RNA virus and viral proteins necessary for replicating the RNA and expressing the carried gene, and that replicate the genomic RNA and express the carried gene in infected cells. The RNP is, for example, a complex comprising the genomic RNA of a negative-strand RNA virus and the N, L, and P proteins. Thus, in the present invention, the negative-strand RNA viral vector includes viral infectious particles, noninfectious particles (virus-like particles; also referred to as VLP), and RNPs containing a genomic RNA and viral proteins binding to the genomic RNA, such as a nucleocapsid of the negative-strand RNA virus. RNP (viral core) that is a virion from which its envelope has been removed is, when introduced into cells, still capable of replicating the viral genomic RNA in the cells (WO97/16538; WO00/70055). RNP or VLP may be administered together with, for example, a transfection reagent (WO00/70055; WO00/70070).
[0077]To administer the negative-strand RNA viral vector via cells, the negative-strand RNA viral vector is introduced into appropriate cultured cells, cells collected from an inoculation subject animal, or the like. For infecting cells with the negative-strand RNA viruses outside the body (for example, in a test tube or dish), the infection is carried out in vitro (or ex vivo), in a desired physiological aqueous solution such as a culture solution or a physiological salt solution. Herein, MOI (multiplicity of infection; number of infectious viruses per cell) is preferably within a range of one to 1000, more preferably two to 500, yet more preferably three to 300, and even more preferably five to 100. The negative-strand RNA viruses and cells can be sufficiently contacted even for a short time. The contact may be carried out, for example, for one minute or more, and preferably three minutes or more, five minutes or more, ten minutes or more, or 20 minutes or more. The duration may be for example about one to 60 minutes, and more specifically about five to 30 minutes. Of course, the contact may be carried out for a longer duration than the above, such as several days or more.
[0078]Specific methods for introducing into cells RNPs or non-infectious viral particles (virus-like particles (VLPs)) that contain viral genomic RNAs, naked DNAs, plasmids, or such include those known to those skilled in the art, such as methods that utilize calcium phosphate (Chen, C. & Okayama, H. (1988) BioTechniques 6:632-638; Chen, C. and Okayama, H., 1987, Mol. Cell. Biol. 7: 2745), DEAE-dextran (Rosenthal, N. (1987) Methods Enzymol. 152:704-709), various liposome-based transfection reagents (Sambrook, J. et al. (1989) Molecular Cloning: A Laboratory Manual (Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.)), or electroporation (Ausubel, F. et al. (1994) In Current Protocols in Molecular Biology (John Wiley and Sons, NY), Vol. 1, Ch. 5 and 9). Chloroquine may be added to the transfection to suppress the degradation in endosomes (Calos, M. P., 1983, Proc. Natl. Acad. Sci. USA 80: 3015). Transfection reagents include, for example, DOTMA (Roche), Superfect Transfection Reagent (QIAGEN, Cat No. 301305), DOTAP, DOPE, DOSPER (Roche #1811169), TransIT-LT1 (Mirus, Product No. MIR 2300), CalPhos® Mammalian Transfection Kit (Clontech #K2051-1), and CLONfectin® (Clontech #8020-1). Enveloped viruses are known to incorporate host cell-derived proteins during virion formation, and such proteins can potentially cause antigenicity and cytotoxicity when introduced into cells (J. Biol. Chem. (1997) 272, 16578-16584). It is thus advantageous to use RNPs without the envelope (WO 00/70055).
[0079]Moreover, virus RNPs can be directly produced in a cell by introducing into the cell an expression vector which expresses viral genomic RNAs and an expression vector which encodes viral proteins (the N, P, and L proteins) necessary for replicating the genomic RNAs. Cells into which a viral vector has been introduced may also be produced in such a manner.
[0080]Once cells into which a negative-strand RNA viral vector has been introduced are prepared, they are preferably cultured for about twelve hours to five days (preferably for one to three days) to express an anti-inflammatory cytokine from the vector. When a signal peptide has been added to the anti-inflammatory cytokine to be expressed from the vector, the cytokine can be secreted to the outside of the cells. The resulting cells may be administered to animals without further treatment or as a cell homogenate (lysate) containing the viral vector. To eliminate the growth potential, the cells may be treated with irradiation, ultraviolet radiation, a chemical agent, or such. A lysate of cells into which the vector has been introduced can be prepared by using methods of lysing the cell membrane with surfactants, methods in which freeze-thaw cycles are repeated, or such. The surfactants include non-ionic surfactants such as Triton X-100 and Nonidet P-40. The lysate may be administered in combination with transfection reagents.
[0081]The dosage of the composition of the present invention varies depending on the disease, patient's weight, age, sex, and symptom, the purpose of administration, the form of composition administered, the administration method, the gene to be introduced, and such. The dosage can be appropriately determined by those skilled in the art. The route of administration can be appropriately selected, which includes, for example, percutaneous, intranasal, transbronchial, intramuscular, intraperitoneal, intravenous, and subcutaneous administration, but is not limited thereto. In particular, a preferred administration includes intramuscular injection (for example, into gastrocnemius muscle), subcutaneous administration, intranasal administration (nasal drop), intracutaneous administration to the palm or sole, direct intrasplenic administration, intraperitoneal administration, and such. More preferred administration methods include intranasal administration, subcutaneous administration, and intramuscular administration. When an anti-inflammatory cytokine is administered, for example, subcutaneous administration is preferred. On the other hand, when a negative-strand RNA viral vector is administered, nasal administration (including administration using nasal drop, spray, catheter, etc.) is preferred. The number of inoculation sites may be one or more (for example, two to 15 sites). The dosage of inoculation may be appropriately adjusted depending on the subject animal to be inoculated, inoculation site, inoculation frequency, and such. The dosage of a cytokine protein may be about 8000 μg per kilogram body weight (8000 μg/kg) or less (Regul Toxicol Pharmacol. 2002 February; 35(1):56-71), preferably 25 μg/kg to 100 μg/kg (Pharmacol Rev. 2003 June; 55(2):241-69). When a negative-strand RNA viral vector is used, the vector is preferably administered at a dosage in the range of about 105 CIU/ml to about 1011 CIU/ml, more preferably about 107 CIU/ml to about 109 CIU/ml, still more preferably about 1×108 CIU/ml to about 5×108 CIU/ml, together with a pharmaceutically acceptable carrier. When converted into a virus titer, the single dose for human is 1×104 CIU to 5×1011 CIU (cell infectious unit), preferably 2×105 CIU to 2×1010 CIU. The frequency of administration is once or more and within the range of clinically acceptable side effects. The same applies to the number of doses per day. Although one single administration can produce significant effects, the effects can be enhanced by performing administration twice or more. Furthermore, the anti-inflammatory cytokine itself may be administered additionally.
[0082]When the vector is inoculated via cells (ex vivo administration), for example, human cells, preferably autologous cells, can be infected with a negative-strand RNA viral vector, and 1×104 to 109 cells, preferably 1×105 to 108 cells, or a lysate of the cells can be administered. For non-human animals, for example, the dosage can be converted from the above-described dosage based on the body weight ratio or the volume ratio (e.g., mean value) of the target site for administration between the animal of interest and human, and administered. The subject to which a composition comprising a vector of the present invention is administered is preferably mammals (including human and non-human mammals). Specifically, the mammals include human, non-human primates such as monkeys, rodents such as mice and rats, rabbits, goats, sheep, pigs, cattle, dogs, and all other mammals. The subject animals for administration include animals and patients having at least one factor of Alzheimer's disease or at least one symptom of Alzheimer's disease. Such animals and patients include, for example, individuals with Alzheimer's disease, individuals with an increased amount of Aβ or enhanced Aβ deposition, individuals having an Alzheimer-type mutant gene, and Alzheimer's disease model animals.
[0083]The methods of the present invention ameliorate at least one symptom of Alzheimer's disease. Symptoms of Alzheimer's disease include, for example, enhancement of microglial activity; infiltration and/or accumulation of microglia in the brain, in particular, in senile plaques; accumulation of substances activated upon inflammation, e.g., complements, in the brain; accumulation and/or deposition of Aβ in the brain tissues; and impairment of learning and/or memory.
[0084]Furthermore, the present invention also relates to methods for assessing therapeutic effect on Alzheimer's disease, which comprise the steps of: administering a composition of the present invention, for example, a vector of the present invention or a composition comprising the vector, to an individual suffering from Alzheimer's disease; and detecting at least one symptom of Alzheimer's disease in the individual. The symptoms of Alzheimer's disease may be compared with a control that the composition of the present invention, for example, vector, is not administered. As described above, the symptoms of Alzheimer's disease to be assessed include enhancement of microglial activity; infiltration and/or accumulation of microglia in the brain, in particular, in senile plaques; accumulation of substances activated upon inflammation, e.g., complements, in the brain; accumulation and/or deposition of Aβ in the brain tissues; and impairment of learning and/or memory. The present invention also relates to methods for assessing therapeutic effect on Alzheimer's disease, which comprise the steps of: administering a composition of the present invention, for example, a vector of the present invention or a composition comprising the vector, to an individual; and detecting a symptom of Alzheimer's disease in the individual. The individual for administration includes those having at least one factor of Alzheimer's disease or at least one symptom of Alzheimer's disease, for example, individuals with Alzheimer's disease, individuals with an increased amount of Aβ or enhanced Aβ deposition, individuals having an Alzheimer-type mutant gene, and Alzheimer's disease model animals. When the composition is administered to individuals before the onset of Alzheimer's disease, control individuals to which the composition is not administered are monitored until they develop at least one symptom of Alzheimer's disease, and then the individuals to which the composition is administered are compared with the control individuals to evaluate the effects. Therapeutic and preventive effects on Alzheimer's disease can be monitored by using these methods.
EXAMPLES
[0085]Hereinbelow, the present invention is specifically described with reference to the Examples; however, it should not be construed as being limited thereto. All the publications cited herein are incorporated as a part of the present specification.
Example 1
Construction of an F Gene-Deficient SeV Genomic cDNA Carrying the IL-10 Gene
(1-1) Construction of a NotI Fragment of Each Gene (Addition of the Transcriptional Signal of Sendai Virus)
[0086]PCR was carried out using the two primers, pmIL10-N (SEQ ID NO: 13) and pmIL10-C (SEQ ID NO: 14), and cDNA of the mouse IL-10 (mIL-10) gene (Accession Number NM--010548; SEQ ID NO: 11; the amino acid sequence is shown in SEQ ID NO: 12) as a template. The resulting product was digested with NotI, and was subcloned into pBluescript® II KS (Stratagene), to construct an mIL-10 gene NotI fragment (SEQ ID NO: 15) to which the transcriptional signal of Sendai virus has been added.
TABLE-US-00001 SEQ ID NO: 11 ATGCCTGGCTCAGCACTGCTATGCTGCCTGCTCTTACTGACTGGCATGAG GATCAGCAGGGGCCAGTACAGCCGGGAAGACAATAACTGCACCCACTTCC CAGTCGGCCAGAGCCACATGCTCCTAGAGCTGCGGACTGCCTTCAGCCAG GTGAAGACTTTCTTTCAAACAAAGGACCAGCTGGACAACATACTGCTAAC CGACTCCTTAATGCAGGACTTTAAGGGTTACTTGGGTTGCCAAGCCTTAT CGGAAATGATCCAGTTTTACCTGGTAGAAGTGATGCCCCAGGCAGAGAAG CATGGCCCAGAAATCAAGGAGCATTTGAATTCCCTGGGTGAGAAGCTGAA GACCCTCAGGATGCGGCTGAGGCGCTGTCATCGATTTCTCCCCTGTGAAA ATAAGAGCAAGGCAGTGGAGCAGGTGAAGAGTGATTTTAATAAGCTCCAA GACCAAGGTGTCTACAAGGCCATGAATGAATTTGACATCTTCATCAACTG CATAGAAGCATACATGATGATCAAAATGAAAAGCTAA SEQ ID NO: 13 ACTTGCGGCCGCCAAAGTTCAATGCCTGGCTCAGCACTGCTATGCTGCCT G SEQ ID NO: 14 ATCCGCGGCCGCGATGAACTTTCACCCTAAGTTTTTCTTACTACGGTTAG CTTTTCATTTTGATCATCATGTATGCTTC SEQ ID NO: 15 gcggccgccaaagttcaATGCCTGGCTCAGCACTGCTATGCTGCCTGCTC TTACTGACTGGCATGAGGATCAGCAGGGGCCAGTACAGCCGGGAAGACAA TAACTGCACCCACTTCCCAGTCGGCCAGAGCCACATGCTCCTAGAGCTGC GGACTGCCTTCAGCCAGGTGAAGACTTTCTTTCAAACAAAGGACCAGCTG GACAACATACTGCTAACCGACTCCTTAATGCAGGACTTTAAGGGTTACTT GGGTTGCCAAGCCTTATCGGAAATGATCCAGTTTTACCTGGTAGAAGTGA TGCCCCAGGCAGAGAAGCATGGCCCAGAAATCAAGGAGCATTTGAATTCC CTGGGTGAGAAGCTGAAGACCCTCAGGATGCGGCTGAGGCGCTGTCATCG ATTTCTCCCCTGTGAAAATAAGAGCAAGGCAGTGGAGCAGGTGAAGAGTG ATTTTAATAAGCTCCAAGACCAAGGTGTCTACAAGGCCATGAATGAATTT GACATCTTCATCAACTGCATAGAAGCATACATGATGATCAAAATGAAAAG CTAAccgtagtaagaaaaacttagggtgaaagttcatcgcggccgc
(1-2) Construction of an F Gene-Deficient SeV cDNA Carrying the mIL-10 Gene
[0087]A cDNA (pSeV18+NotI/ΔF) of F gene-deficient SeV vector (WO 00/70070) was digested with NotI. The mIL-10 gene NotI fragment was inserted into the NotI site to construct an F gene-deficient SeV cDNA carrying the IL-10 gene (pSeV18+mIL10/ΔF).
Example 2
Reconstitution and Amplification of Sendai Virus Vector
[0088]Virus reconstitution and amplification were carried out according to the report of Li et al. (Li, H.-O. et al., J. Virology 74. 6564-6569 (2000), WO 00/70070) and a modified method thereof (WO 2005/071092). Helper cells for the F protein, in which expression of the F protein can be induced by the Cre/loxP expression induction system, were used for producing vectors. This system uses the pCALNdLw plasmid (Arai, T. et al., J. Virol. 72: 1115-1121 (1988)), which has been designed in a way that expression of gene products is induced by the Cre DNA recombinase. To express the inserted gene, a transformant with the plasmid was infected with a recombinant adenovirus expressing the Cre DNA recombinase (AxCANCre) by the method of Saito et al. (Saito, I. et al., Nucl. Acid. Res. 23, 3816-3821 (1995), Arai, T. et al., J. Virol. 72, 1115-1121 (1998)).
[0089]An F gene-deficient SeV vector (abbreviated as SeV18+mIL10/ΔF) carrying the mouse IL-10 gene (hereinafter abbreviated as mIL-10) was prepared by the method described above. The genomic RNA (minus strand) of SeV18+mIL10/ΔF is shown in SEQ ID NO: 16, and the antigenomic RNA (plus strand) is shown in SEQ ID NO: 17. Furthermore, the genomic RNA (minus strand) sequence of an F gene-deficient Sendai virus vector expressing IL-10 (hereinafter abbreviated as SeV18+mIL10/TSΔF), which has the G69E, T116A, and A183S temperature-sensitive mutations in the M protein, the A262T, G264, and K461G temperature-sensitive mutations in the HN protein, the L511F mutation in the P protein, and the N1197S and K1795E mutations in the L protein, is shown in SEQ ID NO: 18. The antigenomic RNA (plus strand) sequence thereof is shown in SEQ ID NO: 19. As controls, an F gene-deficient SeV vector carrying the E. coli LacZ gene (abbreviated as SeV18+lacZ/ΔF) and an F gene-deficient SeV vector of temperature-sensitive mutation type (hereinafter abbreviated as SeV18+LacZ/TSΔF) were produced by the same method as described above.
Example 3
Therapeutic Effects of Nasal Drop (Nasal) Administration of SeV-mIL10/ΔF in Alzheimer's Disease Model Animal
(3-1) Animal and Administration Method
[0090]The therapeutic and preventive effects of SeV18+mIL10/ΔF of the present invention on Alzheimer's disease can be assessed by using Alzheimer's disease model mice (hereinafter referred to as APP mice) such as APP transgenic mice (Tg2576; Hsiao K et al., Science, 1996, 274: 99-102). Mice were divided into two groups, each containing four mice; one was the treatment group and the other was the control group. The body weights of the APP transgenic mice used in this assessment were about 20 g. 5×106 CIU of SeV18+mIL10/ΔF or 5×106 CIU of SeV18+lacZ/ΔF was intranasally (nasally) administered to each animal in the treatment group or the control group, respectively. An example of the experiment using SeV18+mIL10/TSΔF and SeV18+LacZ/TSΔF is as follows. 16-month-old APP mice (Tg2576) (female) were divided into three groups, each containing ten mice. For one animal in each group, 5×106 CIU/201/head of SeV18+mIL10/TSΔF, 5×107 CIU/20 μl/head of SeV18+mIL10/TSΔF, or 5×107 CIU/20 μl/head of SeV18+LacZ/TSΔF was intranasally administered. Before the administration and three days after the administration, blood was collected from the mice, and plasma was prepared. The plasma IL-10 level was determined using the mouse IL10 ELISA Kit Quantikine (R&D Systems) according to the appended protocol. The mouse plasma was diluted 50-fold with the dilution buffer attached to the kit. The plasma IL-10 level before the administration was lower than or comparable to the detection limit (4 pg/ml). The plasma IL-10 level three days after the administration is shown in FIG. 1. Plasma IL-10 was detected in a dosage-dependent manner, although the level varies among animals.
(1) Senile Plaque Elimination Effect
[0091]A Sendai virus vector was intranasally (nasally) administered to mice. The mice were dissected eight weeks after the administration. Brain tissue sections can be prepared from regions such as the cortex of frontal lobe, parietal lobe, and hippocampus. The experiment described below can be conducted using the cryosections. To detect the Aβ protein or senile plaques in the tissues, the sections were treated with 70% formic acid, and endogenous peroxidases were inactivated with 5% H2O2. After reaction with a rabbit anti-pan-Aβ antibody (1000-fold dilution), a peroxidase-labeled secondary antibody was added, and then DAB staining was performed. The area of Aβ accumulation in each region was measured, and then the ratio of the area of Aβ accumulation that occupies in each measured site was calculated.
[0092]Specifically, the effect of SeV18+mIL10/TSΔF was assessed using 12-month-old female APP transgenic mice (Tg2576) (Hsiao K et al., Science, 1996, 274: 99-102). Mice were divided into two groups, each containing 15 mice; one was the treatment group and the other was the control group. 5×106 CIU of SeV18+mIL10/TSΔF or 5×105 CIU of SeV18+LacZ/TSΔF was intranasally (nasally) administered to a animal in the treatment group or the control group, respectively, under light anesthesia with sevoflurane. Four weeks after the treatment, blood was collected from five mice from the SeV18+mIL10/TSΔF group and four mice from the SeV18+LacZ/TSΔF group, and then the mice were dissected. Eight weeks after the treatment, blood was collected from ten mice from the SeV18+mIL10/TSΔF group and nine mice from the SeV18+LacZ/TSΔF group, and then the mice were dissected. The brain with the olfactory bulb was vertically divided into the right and left halves. One was rapidly frozen and stored for biochemical measurement, and the other was immersed and fixed in 4% paraformaldehyde solution for histopathological examination. Paraffin-embedded histopathological sections were prepared as vertical sections containing the olfactory bulb at 1 mm from the midline. The sections were stained with hematoxylin and eosin for standard histopathological examination, and observed under a microscope. Immunostaining with an anti-Aβ antibody (4G8) was performed to detect the Aβ protein and senile plaques in the tissues. Alternatively, Iba-1 immunostaining was performed to stain microglia and macrophages.
[0093]Samples stained with the anti-Aβ antibody were divided into the following four parts: the olfactory bulb, cerebral neocortex, hippocampus, and brain stem/cerebellum. The quantity of senile plaques and blood vessels positive for anti-Aβ antibody staining that were present in each region were evaluated under a light microscope. The area of senile plaques in the cerebral neocortex was quantified by image analysis software (NIH Image, Japanese Edition) using recorded images with the same magnification.
[0094]An example of the result of staining sections is shown in FIG. 2 (the parietal lobe of cerebral neocortex and hippocampus). Meanwhile, the area ratio of Aβ deposition is shown in FIG. 3. Since only a small number of senile plaques were formed in the hippocampus of both groups, there was no significant difference between the groups. In contrast, eight weeks after the treatment, the area of senile plaques in the cerebral neocortex was clearly reduced in the SeV18+mIL10/TSΔF group. The difference was statistically significant (p<0.01).
[0095]On the other hand, in the Iba-1 immunostaining samples, a clear difference in the number of activated microglia in the olfactory bulb was observed, although there was no clear difference observed in the cerebral neocortex, hippocampus, or brain stem/cerebellum. As shown in FIG. 4, the number of activated microglia was increased in the SeV18+mIL10/TSΔF group four and eight weeks after the treatment. According to the result of the analysis of recorded images with the same magnification, as shown in FIG. 5, the area ratio of Iba-1-positive cells was statistically significantly increased in the SeV18+mIL10/TSΔF group eight weeks after the treatment (p<0.0, Student t test). This suggests that, in the SeV18+mIL10/TSΔF group, activated microglia or macrophages actively eliminate foreign materials (the majority of them are dead olfactory cells infected with SeV) from the olfactory bulb. This also suggests that the mIL-10 protein expressed in nasal mucosa cells is transported along axons of olfactory cells in the opposite direction to the olfactory bulb, and the microglial activation is promoted in the olfactory bulb. Since the number of images analyzed for each group was small and different, statistical analysis was not performed. However, the number of microglia in the SeV18+mIL10/TSΔF group was clearly larger than that of the control group (SeV18+LacZ/TSΔF group) even just four weeks after the administration.
(2) Assay of Aβ in Brain Tissues
[0096]Mouse cerebrum and cerebellum were cut along the fissura mediana. A hemisphere was rapidly frozen and stored at -80° C. The brain hemisphere was homogenized in 1 ml of TBS solution. The homogenate was centrifuged at 100,000 g in a bench-top ultracentrifuge for one hour. The soluble fraction (TBS fraction) was stored, while the insoluble fraction was dissolved in 2% SDS, homogenized, and then centrifuged at 100,000 g for one hour. The soluble fraction (2% SDS fraction) was stored, while the insoluble fraction was dissolved in 70% formic acid, homogenized, and then centrifuged at 100,000 g for one hour. The soluble fraction (formic acid fraction) was stored. An ELISA kit from Biosource was used to assay Aβ40 and 42 in brain tissues. The TBS fraction was diluted four-fold; the 2% SDS fraction was diluted 400- to 2000-fold; and the formic acid fraction was diluted 1000-fold in 1 M Tris solution. Then, the diluted fractions were further diluted (2- to 10-fold) with ELISA dilution buffer and assayed.
[0097]Specifically, 10-month-old APP mice (Tg2576) were divided into two groups, each containing ten mice. SeV18+mIL10/TSΔF or SeV18+LacZ/TSΔF was intranasally (nasally) administered to each group at 5×106 CIU/20 μl/head per animal. Eight weeks after the administration, the brains were excised and the right hemispheres were used. Using Teflon® homogenizer, each mouse brain was homogenized in five volumes of TBS (50 mM Tris-HCl (pH 7.6), 150 mM NaCl) containing a protease inhibitor cocktail (CALBIOCHEM). The homogenate was centrifuged at 100,000 g for one hour at 4° C. The supernatant was collected and stored at -80° C. (TBS fraction). The precipitate was homogenized using a hand homogenizer in three volumes of 1% Triton X-100/TBS (containing protease inhibitors) to one volume of the mouse brain. The homogenate was incubated at 37° C. for 15 minutes, and then centrifuged at 100,000 g for one hour at 4° C. The supernatant was collected and stored at -80° C. (1% Triton fraction). Furthermore, the precipitate was homogenized using a hand homogenizer in three volumes of 2% SDS/TBS (containing protease inhibitors) to one volume of the mouse brain. The homogenate was incubated at 37° C. for 15 minutes, and then centrifuged at 100,000 g for one hour at 25° C. The supernatant was collected and stored at -80° C. (2% SDS fraction). Finally, using a hand homogenizer, the precipitate was homogenized in the same volume of 70% formic acid as the mouse brain. The homogenate was centrifuged at 100,000 g for one hour at 4° C. The supernatant was collected, and its pH was adjusted by adding ten volumes of 1 M Tris. The supernatant was then stored at -80° C. (FA fraction).
[0098]Aβ in the brain tissues was assayed using the Human/Rat β Amyloid ELISA Kit WAKO (Wako Pure Chemical Industries). The result of the assay is shown in FIG. 6. Soluble Aβ40 (TBS fraction and 1% Triton fraction) and insoluble Aβ42 (FA fraction) were decreased in the SeV18+mIL10/TSΔF administration group as compared to the SeV18+LacZ/TSΔF administration group.
Example 4
Determination of IL-10 Protein Levels after Administration (Nasal Drop (Nasal) Administration) of SeV18+mIL10/TSΔF
[0099]Blood IL-10 levels in normal mice after nasal administration of SeV18+mIL10/TSΔF were determined as described below. Eight-week-old C57BL/6N mice were divided into two groups, each containing six mice. SeV18+mIL10/TSΔF was intranasally (nasally) administered to each group at 5×1 or 5×108 CIU/20 μl/head per animal. Before the administration and three days after the administration, blood was collected from the mice, and plasma was prepared. The plasma IL-10 level was determined using the mouse IL10 ELISA Kit Quantikine (R&D Systems) according to the appended protocol. The mouse plasma was diluted 50-fold using the dilution buffer attached to the kit.
[0100]The plasma IL-10 level before administration was lower than or comparable to the detection limit (4 pg/ml). The plasma IL-10 level three days after the administration was increased in a dosage-dependent manner (FIG. 7).
Example 5
IL-10 Protein Distribution after Administration (Nasal Drop (Nasal) Administration) of SeV18+mIL10/TSΔF
(1) Kinetic Measurement of Blood IL-10 Level
[0101]20 μl of the SeV18+mIL10/TSΔF vector suspended in DPBS(-) at 5×107 CIU/20 μl or 5×106. CIU/20 μl was nasally administered to six mice in each group of normal mice (C57BL/6N, female). Then, blood was collected from the eye pit using heparin-containing hematocrit tubes at 24-hour intervals up to day 7. After blood collection, plasma was separated using a hematocrit centrifuge and stored at -80° C.
[0102]As a control, 20 μl of SeV18+LacZ/TSΔF was nasally administered at 5×107 CIU/20 μl to six mice. The mouse plasma IL-10 levels were determined by ELISA (R&D Systems, Catalog No. M1000), according to the manual instructions.
[0103]The result shows that AUC (area under the pharmacokinetic curve) was 176,000 pgh/ml after a single intranasal administration of SeV18+mIL10/TSΔF (5×107 CIU/head) (FIG. 8).
(2) Transfer into the Brain (Concentration in Brain Tissues)
[0104]53 μl of SeV18+mIL10/TSΔF suspended in DPBS(-) at 5×108 CIU/53 μl or the same concentration of SeV18+LacZ/TSΔF vector (as a control) was nasally administered to ten animals in each group of normal mice (C57BL/6N, female). As a non-administration control, 53 μl of DPBS(-) was nasally administered to ten mice. The mice were sacrificed three or seven days after administration of the above-described vectors. Hereinafter, samples derived from the tissues of the mice sacrificed on day three and day seven are referred to as "day-3 sample" and "day-7 sample", respectively. Five mice from each group were anesthetized with ether and underwent thoracotomy. After cutting the right auricle of heart, perfusion was performed for about eight minutes by injecting 30 ml of physiological saline into the left atrium using a 24G-needle syringe. After perfusion, the first cervical vertebra was cut, and then craniotomy was performed to collect the brain. After dividing the brain into two hemispheres, they were further divided into the following three parts: the olfactory bulb, cerebrum, and cerebellum/medulla oblongata, which were rapidly frozen in liquid nitrogen and then stored at -80° C. The five non-perfused mice were anesthetized with Sevofrane and underwent laparotomy. After exsanguination by cutting the caudal vena cava and ventral aorta, craniotomy was performed to collect and store the brains, as described above. From the non-perfused mice, the sites of administration: nasal septum, ethmoid bone, and nasal turbinates including nasal mucosa, were also collected and stored. Each sample was homogenized in the extraction buffer (1% Triton X-100, 50 mM Tris-HCl (pH 7.5), and Complete Protease Inhibitor Cocktail (Roche Diagnostics)) using the glass-Teflon® homogenizer (750 rpm, 10 strokes) and then the Dremel homogenizer (30,000 rpm, 30 sec). Then, the homogenate was ultra-centrifuged at 100,000 g for one hour. The centrifuged supernatant was collected and used as extract. The extract was stored at -80° C. The mouse IL-10 level in the extract was determined by ELISA (R&D Systems, Catalog No. M1000), according to the manual instructions.
[0105]After administration of the above-described vectors, mIL-10 was detected in each tissue of the day-3 sample of the non-perfused group. The mIL-10 level detected in the brain extract of the administered mice was about 0.1% of the expression level in the plasma and nasal mucosa (FIG. 9(B)). Furthermore, in the group where blood was removed by perfusion, IL-10 was also detected in the tissues including the brain (FIG. 10(B)). In the olfactory bulb, the detected mIL-10 level of the day-7 sample of the group where blood was removed by perfusion (FIG. 12(B)) was comparable with that of the day-7 sample of the non-perfused group (FIG. 11(B)).
[0106]Furthermore, after administration of the above-described vectors, the detected mIL-10 level in the olfactory bulb of the day-7 sample of the non-perfused group (FIG. 11(B)) was comparable with that of the day-3 sample of the non-perfused group (FIG. 9(B)). In addition, the detected mIL-10 level in the olfactory bulb of the day-7 sample of the group where blood was removed by perfusion (FIG. 12(B)) was comparable with that of the day-3 sample of the group where blood was removed by perfusion (FIG. 10(B)).
[0107]Thus, it was demonstrated that mIL-10 expressed from the nasally-administered SeV vector was transferred into tissues of the central nervous system (FIGS. 10(B) and 12(B)).
[0108]In particular, the expression level of mIL-10 in the olfactory bulb was confirmed to be constant in the presence or absence of perfusion (FIGS. 10(B) and 12(B)). This suggests that mIL-10 expressed from the intranasally administered SeV vector is surely transferred into the olfactory bulb.
(3) Transfer into the Brain (Concentration in CSF)
[0109]106 μl of SeV18+mIL10/TSΔF suspended in DPBS(-) at 1×109 CIU/106 μl or the same concentration of the SeV18+LacZ/TSΔF vector (as a control) was nasally administered to five animals in each group of normal rats (Wistar, female). As a non-administration control, 106 μl of DPBS(-) was nasally administered to five rats. The rats were sacrificed three days after the administration. Under anesthesia, the skin and the muscles of the lateral cervical region were removed to expose the dura mater. A 200-μl pipette tip was inserted into the magna sterna to collect the cerebrospinal fluid (CSF). The CSF was rapidly frozen in liquid nitrogen, and stored at -80° C. The mouse IL-10 level in the CSF was determined by ELISA (R&D Systems, Catalog No. M1000), according to the manual instructions.
[0110]As a result, the mIL-10 concentration detected in the CSF of the administered rats was about one-tenth of that in the plasma (FIG. 13). There was a positive correlation between the mIL-10 concentration in the plasma and that in the rat CSF. This suggests that mIL-10 expressed from the nasally administered SeV vector is centrally transferred.
Example 6
Assessment of the Efficacy of the IL-10 Protein (Subcutaneous Administration)
(1) Kinetic Measurement of Blood IL-10 Level
[0111]100 μl of recombinant mouse IL-10 (Wako Pure Chemical Industries, Catalog No. M1000091-04691) suspended in DPBS(-) at 2.0 μg/100 μl, or 100 μl of DPBS(-) as a control was subcutaneously administered in the back to three animals in each group of normal mice (C57BL/6N). Blood was collected from the eye pit using heparin-containing hematocrit tubes one, two, three, six, nine, twelve, and 24 hours after the administration. After blood collection, plasma was separated using a hematocrit centrifuge and stored at -80° C. The mouse plasma IL-10 levels were determined by ELISA (R&D Systems, Catalog No. M1000), according to the manual instructions (FIG. 14). The result is as follows: Cmax=about 12,000 pg/ml; Tmax=about 1.5 hr; t1/2=about 1 hr (initial value). AUC was 40,800 pgh/ml.
The AUC ratio relative to that of the SeV18+mIL10/TSΔF administration (FIG. 8) was 4.3 (176,000/40,800). This suggests that repeating subcutaneous administration for about four times can result in an AUC equivalent to that achieved by nasal administration of SeV18+mIL10/TSΔF.
(2) Determination of Blood IL-10 Levels in APP Mice
[0112]IL-10 from recombinant mice (Wako Pure Chemical Industries, Code No. 091-04691; http://www.wako-chem.co.jp/siyaku/info/bai/article/cytokine.htm) was suspended in DPBS(-) at 2.0 μg/100 μl. 100 μl of the suspension (hereinafter referred to as "IL-10 suspension") or 100 μl of DPBS(-) as a control was subcutaneously administered in the back to eight animals in each group of APP mice (Tg2576, female, 13-month-old) every twelve hours over seven days (a total of 14 times). The body weights of the APP transgenic mice used in this assessment were about 20 to 30 g. Blood was collected from the eye pit using heparin-containing hematocrit tubes one hour after administering for the first (day 0), seventh (day 3), and thirteenth (day 6) time. After blood collection, plasma was separated using a hematocrit centrifuge and stored at -80° C. The mouse plasma IL-10 levels were determined by ELISA (R&D Systems, Catalog No. M1000), according to the manual instructions.
[0113]Subcutaneous injection of recombinant mouse IL-10 in the back resulted in a plasma IL-10 concentration of 5000 pg/ml to 8,000 pg/ml one hour after the administration (FIG. 15).
(3) Senile Plaque-Eliminating Effect in APP Mice to which the IL-10 Protein was Administered
[0114]The IL-10 protein was subcutaneously administered to mice twice a day for seven consecutive days. The mice were dissected four or eight weeks after the administration. Brain tissue sections can be prepared from regions such as the cortex of frontal lobe, parietal lobe, and hippocampus. The experiment described below can be conducted using the cryosections. To detect the Aβ protein or senile plaques in the tissues, the sections were treated with 70% formic acid, and the endogenous peroxidases were inactivated with 5% H2O2. After reaction with a rabbit anti-pan-Aβ antibody (1000-fold dilution), a peroxidase-labeled secondary antibody was added and then DAB staining was performed. To evaluate the degree of senile plaques (Aβ-accumulated portions) in each region, the area of senile plaques was determined semi-quantitatively or by viewing tissue section images under a light microscope. The area ratio of senile plaques in each site tested was calculated.
[0115]Specifically, the effect of IL-10 suspension was assessed using 13-month-old female APP transgenic mice (Tg2576). The body weights of the APP transgenic mice used in this assessment were about 20 to 30 g. The mice were divided into two groups, each containing 15 mice; one was the treatment group and the other was the control group. 2 μg/100 μl of mouse IL-10 suspension, or 100 μl of DPBS(-) was subcutaneously administered to an animal in the treatment group or the control group, respectively, twice a day at twelve-hour intervals. Four weeks after the treatment was terminated, blood was collected from eight mice from the IL-10 suspension-administered group and seven mice from the DPBS(-)-administered group, and then the mice were dissected. The brain with the olfactory bulb was vertically divided into the right and left halves. One was rapidly frozen and stored for biochemical measurement, and the other was embedded in an OTC compound and frozen in dry ice for histopathological examination. Histopathological samples were prepared as vertical sections containing the olfactory bulb at 1 mm from its midline. The cryosections were prepared, fixed with formalin for a short period, stained with hematoxylin and eosin for standard histopathological examination, and then observed under a microscope. Immunostaining with an anti-Aβ antibody (4G8) was performed to detect the Aβ protein and senile plaques in the tissues. Alternatively, Iba-1 immunostaining was performed to stain microglia and macrophages.
[0116]Samples stained with the anti-Aβ antibody were divided into the following four parts: the olfactory bulb, cerebral neocortex, hippocampus, and brain stem/cerebellum. The quantity of senile plaques and blood vessels positive for anti-Aβ antibody staining present in each region were evaluated under a light microscope. In general, senile plaque deposition is not observed in the brain stem/cerebellum region. Thus, senile plaques in the olfactory bulb, cerebral neocortex, and hippocampus observed under a light microscope were classified into three categories based on the size (large, middle, and small), and a score was assigned to each category (large: nine points; middle: three points; small: one point). The degree of senile plaques was semi-quantitatively assessed from the total score. Furthermore, the effect of IL-10 was statistically analyzed using the total score for each individual. The areas of senile plaques in the olfactory bulb, cerebral neocortex, and hippocampus were quantified by image analysis software (NIH Image, Japanese Edition) using recorded images with the same magnification.
[0117]An example of the stained sections is shown in FIG. 16 (parietal lobe of cerebral neocortex and hippocampus). The result of semi-quantitative determination of senile plaques is shown in FIG. 17, and the result of quantifying the area of senile plaques is shown in FIG. 18. In both groups, senile plaque formation was clearly observed in the olfactory bulb, cerebral neocortex, and hippocampus. The number of senile plaques in the olfactory bulb, cerebral neocortex, and hippocampus four weeks after the treatment is clearly reduced (about 50%) in the IL-10 suspension-administered group, as compared to the DPBS(-)-administered control group (FIG. 16). As a result of semi-quantitative determination, the difference was statistically significant (p<0.05) (FIG. 17). Furthermore, the result of quantifying the area of senile plaques demonstrated that the degree of senile plaques tended to decrease (about 50%) in the mIL-10 administration group as compared to the PBS control group (p=0.06) (FIG. 18). This suggests that the elimination of senile plaques or Aβ deposits in the brain by activated microglia or macrophages was enhanced in the IL-10 suspension-administered group.
[0118]SeV18+mIL10/TSΔF and SeV18+LacZ/TSΔF were used in the above Examples; however, the vectors of the present invention are not limited thereto. For example, effects equivalent to those described in the Examples can be expected when non-F gene-deficient SeV vectors, F gene-deficient but non-temperature-sensitive SeV vectors, or such, that carry an anti-inflammatory cytokine gene such as IL-10, are used.
INDUSTRIAL APPLICABILITY
[0119]The present invention provides therapeutic agents for Alzheimer's disease, which comprise an anti-inflammatory cytokine, or a vector expressing an anti-inflammatory cytokine, such as a negative-strand RNA viral vector encoding an anti-inflammatory cytokine, and gene therapy methods for Alzheimer's disease using the cytokine or vector. The methods of the present invention are novel therapeutic means that can be used to substitute for or in combination with other therapeutic methods for Alzheimer's disease.
Sequence CWU
1
19110RNAArtificialgene start (S) sequence 1cwuuvwcccu
10210RNAArtificialgene start (S)
sequence 2cuuugacccu
10310RNAArtificialgene start (S) sequence 3cauucacccu
10410RNAArtificialgene start
(S) sequence 4cuuucacccu
10510DNAArtificialgene start (S) sequence 5agggtcaaag
10610DNAArtificialgene
start (S) sequence 6agggtgaatg
10710DNAArtificialgene start (S) sequence 7agggtgaaag
1089RNAArtificialgene end (E) sequence 8uuuuucuua
999DNAArtificialgene end (E)
sequence 9taagaaaaa
91043PRTHomo sapiens 10Asp Ala Glu Phe Arg His Asp Ser Gly Tyr Glu
Val His His Gln Lys1 5 10
15Leu Val Phe Phe Ala Glu Asp Val Gly Ser Asn Lys Gly Ala Ile Ile
20 25 30Gly Leu Met Val Gly Gly Val
Val Ile Ala Thr 35 4011537DNAMus
musculusCDS(1)..(534) 11atg cct ggc tca gca ctg cta tgc tgc ctg ctc tta
ctg act ggc atg 48Met Pro Gly Ser Ala Leu Leu Cys Cys Leu Leu Leu
Leu Thr Gly Met1 5 10
15agg atc agc agg ggc cag tac agc cgg gaa gac aat aac tgc acc cac
96Arg Ile Ser Arg Gly Gln Tyr Ser Arg Glu Asp Asn Asn Cys Thr His
20 25 30ttc cca gtc ggc cag agc cac
atg ctc cta gag ctg cgg act gcc ttc 144Phe Pro Val Gly Gln Ser His
Met Leu Leu Glu Leu Arg Thr Ala Phe 35 40
45agc cag gtg aag act ttc ttt caa aca aag gac cag ctg gac aac
ata 192Ser Gln Val Lys Thr Phe Phe Gln Thr Lys Asp Gln Leu Asp Asn
Ile 50 55 60ctg cta acc gac tcc tta
atg cag gac ttt aag ggt tac ttg ggt tgc 240Leu Leu Thr Asp Ser Leu
Met Gln Asp Phe Lys Gly Tyr Leu Gly Cys65 70
75 80caa gcc tta tcg gaa atg atc cag ttt tac ctg
gta gaa gtg atg ccc 288Gln Ala Leu Ser Glu Met Ile Gln Phe Tyr Leu
Val Glu Val Met Pro 85 90
95cag gca gag aag cat ggc cca gaa atc aag gag cat ttg aat tcc ctg
336Gln Ala Glu Lys His Gly Pro Glu Ile Lys Glu His Leu Asn Ser Leu
100 105 110ggt gag aag ctg aag acc
ctc agg atg cgg ctg agg cgc tgt cat cga 384Gly Glu Lys Leu Lys Thr
Leu Arg Met Arg Leu Arg Arg Cys His Arg 115 120
125ttt ctc ccc tgt gaa aat aag agc aag gca gtg gag cag gtg
aag agt 432Phe Leu Pro Cys Glu Asn Lys Ser Lys Ala Val Glu Gln Val
Lys Ser 130 135 140gat ttt aat aag ctc
caa gac caa ggt gtc tac aag gcc atg aat gaa 480Asp Phe Asn Lys Leu
Gln Asp Gln Gly Val Tyr Lys Ala Met Asn Glu145 150
155 160ttt gac atc ttc atc aac tgc ata gaa gca
tac atg atg atc aaa atg 528Phe Asp Ile Phe Ile Asn Cys Ile Glu Ala
Tyr Met Met Ile Lys Met 165 170
175aaa agc taa
537Lys Ser12178PRTMus musculus 12Met Pro Gly Ser Ala Leu Leu Cys Cys
Leu Leu Leu Leu Thr Gly Met1 5 10
15Arg Ile Ser Arg Gly Gln Tyr Ser Arg Glu Asp Asn Asn Cys Thr
His 20 25 30Phe Pro Val Gly
Gln Ser His Met Leu Leu Glu Leu Arg Thr Ala Phe 35
40 45Ser Gln Val Lys Thr Phe Phe Gln Thr Lys Asp Gln
Leu Asp Asn Ile 50 55 60Leu Leu Thr
Asp Ser Leu Met Gln Asp Phe Lys Gly Tyr Leu Gly Cys65 70
75 80Gln Ala Leu Ser Glu Met Ile Gln
Phe Tyr Leu Val Glu Val Met Pro 85 90
95Gln Ala Glu Lys His Gly Pro Glu Ile Lys Glu His Leu Asn
Ser Leu 100 105 110Gly Glu Lys
Leu Lys Thr Leu Arg Met Arg Leu Arg Arg Cys His Arg 115
120 125Phe Leu Pro Cys Glu Asn Lys Ser Lys Ala Val
Glu Gln Val Lys Ser 130 135 140Asp Phe
Asn Lys Leu Gln Asp Gln Gly Val Tyr Lys Ala Met Asn Glu145
150 155 160Phe Asp Ile Phe Ile Asn Cys
Ile Glu Ala Tyr Met Met Ile Lys Met 165
170 175Lys Ser 1351DNAArtificiala PCR primer 13acttgcggcc
gccaaagttc aatgcctggc tcagcactgc tatgctgcct g
511479DNAArtificiala PCR primer 14atccgcggcc gcgatgaact ttcaccctaa
gtttttctta ctacggttag cttttcattt 60tgatcatcat gtatgcttc
7915596DNAArtificiala Not I fragment
encoding mouse IL-10 15gcggccgcca aagttcaatg cctggctcag cactgctatg
ctgcctgctc ttactgactg 60gcatgaggat cagcaggggc cagtacagcc gggaagacaa
taactgcacc cacttcccag 120tcggccagag ccacatgctc ctagagctgc ggactgcctt
cagccaggtg aagactttct 180ttcaaacaaa ggaccagctg gacaacatac tgctaaccga
ctccttaatg caggacttta 240agggttactt gggttgccaa gccttatcgg aaatgatcca
gttttacctg gtagaagtga 300tgccccaggc agagaagcat ggcccagaaa tcaaggagca
tttgaattcc ctgggtgaga 360agctgaagac cctcaggatg cggctgaggc gctgtcatcg
atttctcccc tgtgaaaata 420agagcaaggc agtggagcag gtgaagagtg attttaataa
gctccaagac caaggtgtct 480acaaggccat gaatgaattt gacatcttca tcaactgcat
agaagcatac atgatgatca 540aaatgaaaag ctaaccgtag taagaaaaac ttagggtgaa
agttcatcgc ggccgc 5961614172RNAArtificialSeV18+mIL10/dF (genomic
RNA) 16accagacaag aguuuaagag auauguaucc uuuuaaauuu ucuugucuuc uuguaaguuu
60uucuuacuau ugucauaugg acaaguccaa gacuuccagg uaccgcggag cuucgaucgu
120ucugcacgau agggacuaau uauuacgagc ugucauaugg cucgauauca ccuagugauc
180caucaucaau cacggucgug uauucauuuu gccuggcccc gaacaucuug acugccccua
240aaaucuucau caaaaucuuu auuucuuugg ugaggaaucu auacguuaua cuauguauaa
300uauccucaaa ccugucuaau aaaguuuuug ugauaacccu cagguuccug auuucacggg
360augauaauga aacuauuccc aauugaaguc uugcuucaaa cuucugguca gggaaugacc
420caguuaccaa ucuuguggac auagauaaag auauccaaga uagcacaagu cuucuagaaa
480uugucuucaa cuugccugaa ucucucacag gauacagguc auacuuacca guuaguuuaa
540gccuuuuauc ugacucaguu auucuagccc auucgaagau uguauccuuc aaaacccugu
600ugaaagcuau caugcaguug uguguaucag cuauguucau gguggacaag aaaucucugc
660ucaauuuaua caaguuuggu ucaaagccaa acgucugcag ugcuugaugg uaaggucuaa
720gcaucccuga ugaagagcuu ccuucucuca auucccgagu aacccauucg ugagccuuug
780ccuucucuau uaagauccac uuuucuaucu ugaugcuauc uucuuuugac aaagggagga
840gacuagcuaa cacugucuug cuguccucua uaaugucaga uuuggggugc cucgauagga
900gauacaucuc uguggaagca ggguuagaug uuuuaagcac uauuagguua accucguccc
960aguaucucag auauaggcug agcugccugg uccaauccgu gcccagccug ggagcaaucu
1020ugcuuauaag cacaacgucu cgauccccca ccagauacgc gauccggauu acacuguaau
1080gcucaugcag uacaacuuga ucauccuuau gaucuccucc cuccauguca caguggacua
1140ggccuaucga gcuauucugu aauucauucc aaaucaaagc cucacacuca ucauucccaa
1200uccaugucga gccaggauuc ccguugaaua acacuuuaac ucuuugaccc agacuaguaa
1260cauuguuuaa uuucuuuccc acuagugcca ccucagcagg auauauauuu aacucucucu
1320gcccauugac aucacaagag uauaccccug aguuauaaua guugaugcau gggccaagag
1380uagcgucaua acaggaaagc auggccccag cuccuucccc uaaauauagc cuaucuuuau
1440ccuugucaac uaaggggcuc aauagguagg uaaguucaag ugcuuucaag cagcuaguac
1500uguugaugcc aaagagccuc agcuggugag auagauaucu uccaucgaau gguaacguca
1560gaccaacacc ugaucugccu aucucaccuc uugugaucuc cuuguacccc cggagacgca
1620guaccuguga cuuggauacu cucaaccccc aaaaaggggc ucuagucuga ugucccaaag
1680gaauauucug uuguauuucu gccgcgauac caucuaacag ugcauuaucu gccucgggau
1740cccaaucuuc uaagacuuca gggacuccua uaccucuugu ccuuaacacu uuuauagaug
1800acuuccggau auaggucaaa guagauggga auacuuugau gacuaggcca gucaacugac
1860uguaccucag uaccggguca ucaagaaaug ugaguuccag guaacucuuu agugacucga
1920gccucucuag agaguucauu gauucuaauc uuggcccauc ccuagauauc ucugccaagc
1980ugcauaggua ugcaagaugu cuugccaaga aagaggaccu ccucaugucg gccacaucug
2040ggucauuguc acagauaaag aucucaagcg guacaccccc uugccaaucg ugcaugaaua
2100gauccacaga auauucacag acagagaggg ccaagaguau cuuauccuga uuugagaggu
2160uaggcccaua cacagguucc acgacaccug cauuccagaa ucguuugaag auuuugggau
2220gagauagagc auuagauaag acuuuuaaaa cugcguggga gguaucuuua agaauccgga
2280cuacaugucc ccauauuucu ucccuuccuc ugauguuuaa gccguagagu gaguaugcaa
2340acugauugac uagaauaccc ccgaacguug agcaaaauaa aggaacauca aucaccauaa
2400acucaguaau caagcuguug acaucaucgu cauuuacuag ugcgaucauc ucuuuuaagu
2460ugucucuauc uaauugagac auuguaucag cuaucgucau ugcaguacag auacugguug
2520cucugauaac uucaucaucu gaccaauaag ucaugucaac uguguguaca acaucucuga
2580ccuugcuaaa uagcucaagg uccacauccu ugaguggauc aggaucauag aucaauuuau
2640uguucucuug uguaaucucu aaaucuaaug uggaccuugg ggggauauuc gccuccugug
2700gggacuccau uauacagcac ccguuauuaa gauguaagug caauaucagu ggcuucccua
2760aggaaccuuu cuuauaucuc auauugaacu cgaacaagcu uagcccaguu agcauaaucu
2820gcugauacac gagauuagua uccuucgacu ccccugcuuc uuugagugcc auguuaucau
2880uugauauugu uaugaaccga cuugcacgga cuaguguugc acuagagaac uucaucuggg
2940uugccguauc uuucaaccua ugagauagau uaguggaggu ugaaacagga gucagcagcu
3000uuagauucuc uaagcucaga uuagcucuug uuugggcuau aagagcggcu uccauccacg
3060auaucucauc agucccguag gcccacguau acaccauagc uauccggaug gccgccuuug
3120cggguuugcu uagauuucuu acauacccga guugggcuuc cgaccuuuca ucaguggcug
3180auccaaaaua ggggauucuu auagccggac auccguuugu aagcgugucc aggucuauau
3240ugucaggaag auagaaccau guauagaugg ggucugcucc uucagaccug caaagcuugc
3300acaccucuga accuucgaua aauauucccc ucaagagcuc uaaagggucu gguguuucua
3360gcccauguau gggucucccg uaagucaggu ggauccacau uuucugccuu agaccgacag
3420cuagcucaac ugaacacaua uacucauauu cgauguuguc uuucaccggu uuccugagag
3480uucuagucag ugucucguac ugcaauagau cauaauugac aagccuccuc aauaucccau
3540augauaaucc uccuuuccua acgcuggcuc ucacuagaga cuuggucgua ucaagcaucc
3600cugcaaucgc cucccuaacu ccaguuaagg aauuacccag gaucucauga gccacucucg
3660gcaggaugac uuuccggucc auaaggaacg aggccagguu gagauccucu ucuccacuag
3720ucucggugaa gagaccagac aguagaggau ucggggauuc cugcagcaca gaucuagcag
3780ugauauucuu uauaaucgua guuauacucu gagaaugcgg gagguuacac gaauaagggu
3840cugaagccca aucuagaaaa cuagagucac cggguucuug auucaugacc cuguauaaua
3900ccugcuuguc uaacagaucc gcucugauga aucuuuugag aucagcuagg gcugcuacug
3960cggggucucc aauauuucua acaaagcauc uagauguaga cauguaguug aauccuccaa
4020cauuugcugg aaucaacacu gcacaucuca gccaauucuu acccuuaaag uauugaucuc
4080uuacggucgg gcugauaguu ggauuuauag ucaucccuag ugauaugcac accugcugac
4140aggucuuaua caacgcaaug caguagccua guauaggaga auacccauuu ucgauagcuu
4200uugcuaugga uguugagaug uucgaacaag cagaucuguu uucaucuacc agugucucgg
4260accagaauac acacuugguc aaggcuuuca ggcacugugg uaaaaucuuc ccaucauagu
4320auauccuuuu acuauagaca aacaucuugc uacuaaugau ggucucguuc aauuuuagcu
4380cgugcccuac aucaaacaug acgugucuua gagcaccgaa auauuuggug aucuccucau
4440agacaugauu uuucuucugc uuguaagucu gagcuacagg uacucuugau gucacggcua
4500uagcuugauu gucacccuga accauugcag agacccugac acccacucuc acagcugcua
4560gguggauugc acugauugag auuaaggucc acagcuucug gcaguaaccu ucuaugcccc
4620cccuaggauu auguaugaaa augccagagu cugcaugauc cuggaguugu cgaugcaucc
4680ggucggcgac uggacaguaa ggaucuccaa cauauauugu acaccuuuca aggacuggau
4740gcauccaguu aaagaagguc uugaagccaa auaucucguu gcaucucuga ccaaacaaug
4800caguacucuc aaaucuccag uuuaagcagu auuucuugag gucuguugug aggaagcaac
4860uuaacguuuc auagccgucu guugaugaau cuguugccuu gaauucaugu cuggaccucu
4920ucuuuucguc ccaguacccc ccagaguucu uauuuuccau gccuucguuu cucuucucug
4980augauuuaga guuauuguac acugaaucag uccuggggac gccugagaca gaaagaguag
5040ucaaucuuuu aaguaggucu aucucuccuu uaaccauccc auuuucgcug aauagcucuc
5100cuauuccuuu agccaguagu gucucugcca gcaccuguac ggcucgcauc uuauaaguca
5160uuuuugcgaa uagacgaccc ucuugcuuga ucucuuucuc uuugagacug uacgagaugu
5220ugaacuccuc gucuuucaac caaucuccug acuccacaua auugauaauu ucuucugggu
5280ugaaauucuc aucauuuaug aacacuucaa uaagccgccg ggucucuuca gacucugggg
5340cuuuauagua cagauuacua uccggguaua cagaguccca ugccuccuuc cugggggaua
5400gugcuuuguc uuucauauau auugugagau cuucaucuag uugugguucu auaaacuucc
5460gaaacuugaa gccuaugaaa cuuguauagu ugucuacagc acauucauaa gagauugccg
5520uauuggaccc uugagcguuc cuuaguucua gacacacgug aucagggaag ucacaggggg
5580gccacugucc gccaugccuc ucucuauacc cauuuaugau gauagugcaa aaaacugcau
5640gacacucgua uagggucuua agcuuuauug ccuuuugugc auacauaugg gcccuuaccu
5700ugucggcggc agugacagcc ucuaagcugg gguggccaaa uguccuaaag aaggaaaaga
5760ucucugcuuu cucaucaaua gagguuccau ggaaaauggc gaguaacgac uccacaauag
5820ugucugcuuc agcaucugug uacacgucuc uacuuguuaa aacagucugu agcucuguca
5880acacaugccu cauaaaugcc ccacguagag guauaacagg aucauuuagu uguaugagag
5940caagugauag gggcuccaau agugcgauga cauuguauau uuccucucca agacuugaga
6000agagggaauc cacuaguucc cauaauuccu caccuuugcu uguuauccca auggacuucu
6060uaucuagaug cccugcagca gacauauucc accuuccuuc uacaacauca caauacauca
6120agaccagcuc agggguuagg auauacccug ucaaugucaa cuuguucagu aucaugacaa
6180gaucuccgua uguuacuaga guguaugauu ugcauucuag gagguuaugu gaauuagagg
6240uaucgagggg uccccccggu cuggucuucu gcauccaccg caugucauau uugaugcuga
6300accaaguuag gaauggccua uaccaucuau uccugcugua cuuaucaguu aucuccggga
6360uggugccgau auccugcaac ggaucguacc ccucucuucc uucuauauug ccuaguugcu
6420ugaagauauu caaccaaaga uccuggaacc cacuagauaa cucccugguc agccgauccg
6480agaccgcgaa gacggaucgg auuuugucac auaucucugg uauaucaagc cuaaguaauu
6540ccugagagua gguuggguac gguucaaacg uguaucgguc uaaauccuuu auugugcguu
6600gaagagccuu acccagagac cugaucuuaa uuugacgggg ggacaauccu ccguuccuaa
6660uuuugugcuu uguaauauuu auuaugcugu cguccuucag ucuguagggc ugguucacau
6720cuaacaagac gugcaacugu gcuaucuucc cccugacuau gggagaguuc agguggcauu
6780cuggauagag uaugucagaa ggguuuuggg aggacuccug cccauccaug accuauggca
6840agcuucccau ucacccuggg uuuuucuuaa uacugugaga gacguaagag acugagagau
6900auuguggaug uucggagaug acucuagugu cagcaaggcc gacaagccug cuagucaguu
6960aaauuuaaga cucggccuug cauaauuuag ggaugcuagu cuuaaagagc aucggcugua
7020agguauucag gcucuucuga uugaucucga ugaugugaaa gcaguagccu uuaccaaaau
7080gcgugauaca cgaugucgug guauaugcag ccucuaauug aacauccuuu auccuuaaca
7140uauuuauaau guuaguagug uuagaauaca ugauuguugg guugacacgc gauguauugg
7200cauauagcgu gacgguagcg acguuagcug caucagggga caauggauaa gcaucagugu
7260auacgccuga uaugcauucc uucggacacu uauuguacca auugcacucu uuauuuccug
7320gucuagacaa ggcuucauga gguguccagu ugauagucaa aggguggcug acaucaagua
7380cuccuaucug caguugagag ugccagccug augaucuugu auagauguac acccgaucac
7440ccaauuuuaa uaaucuaccu uccgccccga gauaguuuug agugauugga augguuguga
7500cucuuaucuu uggccucucu gagagauagu cauugaccug gaugaucacg cugaccaccu
7560guuucccucc uagccaugua auuuucagag ccucauugca ugugucuugc gacaccuguu
7620ggcauccuug gguccuacau uuuguaucac ccugcagagg ggugguuagu ccaccauacc
7680caagaaauau caaugagccu ucuguugcaa ugccguugcc uacacugggg uauagugcag
7740agaacgggug aucaagaucu accucgcugu ugcgauaccg gugagacuua guucucccuu
7800ugagauccag gacaucaagg accagauccu caauaccauc acuagaguag ucgguucuuu
7860cgucuacagu cggcauggag caaagcugau aaccccuagu cccgguugcc accacagagc
7920augauuuccg auugucguug augucauaag ugugggacac uacgggguua agaucaggga
7980acauaucuga auugagugau auguacccua gcugcaggac cugauaugau uucccuaugu
8040cagcacaacc uuguguaaug agauuugaug aauaggcaua gauugccucg ccaauugaga
8100gugaagggag ccuaacacau ccagagaucg uuguagaacc agauaacaag cucggaccag
8160gcagcaauga gauuucagga ucugagcuaa gauacgguuc uccgacaggg caucuccaga
8220aacuaugugg cucaaguggg gcaauuccau cggcauggug gacugcgauc guacucucac
8280agugcugagu gagcucuugu cugcugcacg acuuaucaau caucuggaug acaucccugc
8340uguuuuuguu caacaagacu gggauuccgg uuugcacaga gcucugaaug uugacagccc
8400uugcuauaac cucuugccuu auuagacugg uaagugacuc uuucaccucc cugcugcuca
8460uguucaaugc cucuacaguc auugaguacu cuuucauacu auacccuugu cuagcagaaa
8520uuaugauaca gaugaucacu guggcaauug acaaagccca cugggugaau gagagaauca
8580gcaaccaugu gucggcuuua cuugaccucu cccaaccuga ugcugguuuu guggugcuac
8640cacuaggaga aguagaccag uacgagucac guuugccccu aucaccaucc augaucugug
8700cuuguaccag guggagaguu uugcaaccaa gcacucacaa gggacuuuau cccuaaguuu
8760uucuuauuua agacaaggag ugacccggug gcuccgacug ccagguggug ucugcuuggg
8820gcauugucgc aggucucuga ugggugcaca uuuacagcuu ucugauccuu ccgauguucu
8880uagccacaac auuaggguag uagcggaaau cacgagggau ggccgguugg aacaccgcau
8940cgacgccugu gauuucuaca gaugccgccc aaaucaccau guucauaugg ggauucacau
9000ccauuaaugg gaagcagacu gcccucuucc augcgagcug acucaugaau gucuuagaua
9060gugucccauu aaccugaaca uggaagcuua uaccgccgau uaacccaagu gagaaaauca
9120gccgcauucu cucaaucuug cucuugcagu acucaacaga guauaucuuc ccgaccuuuc
9180uccugaucaa cccgaggugc accauaaaau ugagcuuuuu cuccccuuga ucaucaagua
9240cugggaguac ccccuuuugu ucuguggaga ucccggucuu gagugucacc aguaaauuaa
9300cagauauaga guugggcaau gcaaggucug caagggucuu ugggaucuug gcuaugguga
9360uugccccuag agauguccca uugacaaaca ccacucugag ucuuaugucc uuguccacag
9420ggaggcauug gggagcuagu gcgaccuugu uugcauuaaa uaucauuccc ugucucagcc
9480ugccugacca ugguaggagu ggagcaccaa ucgaauccac cauguauacg aucaucucuc
9540cugcucgaac aguccuccuc accguaauuc ugagaucggu gcaggccuuu aagaguuccu
9600gaucaguccc guaguauuug gccacaccua uggguaacga cccggagccg cauauugagu
9660agcuggucgg cucugucaag ucagauacgc ucccuagauu gguuguuugu uucggugucu
9720caaagaaacc caagagcaau aaaucuaggu aucucacucc auguuuagga gggucuccua
9780ccuugacaau ccugaugugg gggauggcuu ucuuauccgg accaguucuc agaggcaggg
9840gcuccacagu accguuaucc ucauaugaga acuuagggaa ucuauagaua ucugccauug
9900cgccguguua ggugaaauuu cuuucacccu aaguuuuucu uaaucuuuac uggcugaugc
9960ugaugguaga uuggaucucu cuaugacuga ggaugguagg augccucacc cgggaucuag
10020uuggucagug acucuauguc cucuucuacg aguuccauga cugccuuaac cucuuggucu
10080gucuugcacu uggauaauga uuucacauau gcuacuuucu cagcucugcu uaggggacug
10140cucucuauga cgagccugag agagugcauu gugggcuucu cuuuggaggg gaggagacgu
10200gaugcguuug aggcccuggg uucugugucc cucucuuggu acaccggguu gcggaucuca
10260ucucuaaauu cauccucucg gauuaggucc gguuuguacu ucauaucuuc uagggucucc
10320auagaugggu caaaccuggu agccuuaguc uuguucucuu uugauuuugc aaaaacggag
10380ggggaccuug uaagggaguc uguguuguca gucuugccac cucuaucugu gaugauauga
10440aguguagaua gguuggacau cagcaaugag uucuguucuu ucugauacuc agagaaucuc
10500uuguaaauau cccggaauga uuccacgcuc ucuuggaucu guuugagcag uuguuuguuc
10560ucaucuaccu uacgagcgga agauuucucg gcagaaagga ucaggccgca uacauugaau
10620gucaucucug cauaguuugc agacuuuagg gcacgucuug caaacacaua acucgcgucu
10680cgggaugauu cgaauucuug agcagacugg auuacaccaa gacucgucaa caauguagcc
10740aucucuuuca uagaugaugu guucucuccu augcccuuuu uuguugaguc ggucucuaga
10800cccgggugga uugggcggcc guuggcugga caaucugaga cagagcgggu cccuauuggu
10860gguuuccggu cuuugacccu gacggcgggg guguccccag aguugaugug cucauccugu
10920guagaugggg guuuuccugg uggugacccu gugcuguugu aacgauucag cgguggggac
10980cgggugccag gcacgguugc uggaguaaga gguuuggacc cacuguuggu aggucuucuu
11040uuguuccucc guagcacagc cucuucaagu ucggggcuag gaaucaccag gaccccaguu
11100acucuugcac uaugugagcu gccaggcucc augcuucuuc cauuauuacu ugcuccaccu
11160ucuccuucau cagguaggga uguacuuccu cguaccucuu cuggaagucc uucagcuugg
11220ucuucucccc ucuuaucagg gugcgcagcc aucucucugu uuucaucuuc aauaccugau
11280cucggauauc cucucucauu uggaggauuu ucaaggauuc cggagucucc uccaucgccc
11340agauccugag auacagaguu uguaccaguu cuucccccaa aggcccggug uauauuuugu
11400uuaucaaggu uuccagcaug ugcuucugcc ucuggcuugc uuguucuccc agagacucua
11460cucuccucac cugaucgauu aucuuggguc gacgguguug agacuucucc uucgcccuca
11520cuuuuggcuc uaugagcaga gccugguccu uggggagugu ugaugguguu guggagccag
11580cuucuguccc cuccgauguc aguugguuca cucgacagga cagcaucgag gaauccgaua
11640acauccgaga gcgacucucg uccuccuggc gccucccucu caacuucaga aucuucuuua
11700agaaugaagg caucuugauc caugcgguaa guguagccga agccguggcu gucucgacug
11760cugggugugg ucgguggggu uggguguggc cuugccugag ccgaucggug gaugaacuuu
11820cacccuaagu uuuucuuacu acggaucaag uaccuugaag ccucguauga uccuagauuc
11880cuccuauccc agcuacugcu gcggcaucgu caucuucguc augaucgaca ccguuauugc
11940ggccuucauc uccauggguu gcagaauccu cuugccgucu cucugcgagu cucauggcua
12000uucuucucuc uaugucugau acauccucau cauugguuuc cuccucuaac cguucagccc
12060cauguagugu gacaaagugg ccaccacuca ccugacgugc ccaucuuuca ccacuaucuc
12120caccccaacc ccuagcgucc ugguccgcau gggcuuuugu uucuaggucg augucggcau
12180ugucuagagc uaccucaauu gcaccaccgc cuguugguuu gugguaagca ccauccccac
12240cggacaaguu ugccagauga ugucugagcc uccccuuggc uguauccguc acuccuaacu
12300caucuuccaa ggcacugcug aucuucgauu cagcauccuu ugccacggcu uguccuagua
12360agaacauuuc cauaucaagg uauguccucc cugugacgua cugcugcauu gccuuguucu
12420guacgacggc gacucccaug gcguaacucc auagugcagg auaauugccu ggagcaaauu
12480caccaugaac aggguccuug aggauacaga uaaagggagc ucuggggccu uuugacaggu
12540aggugucuau gaggcuucua agcuuauuaa uaucgggccu cagguuugac aacguuagag
12600cugccaucuu uguuuccacc ccauauuuaa uaguguucau gaaggaagcc agcccugcau
12660cucggaugua guucccaacg aucuggaugu ucuucucuaa uguggugaga ucagaucuug
12720caguauucau agucacaagg gucucaacca ugagagauac aaggcuuugc ugagaucuca
12780uaaccgagcc uauccccuca acugucuccc cagugaaaac uaaggcaccu uucacggugc
12840cgucuugucu gaacgccucu aaccuguuga agaacccuuu ccuuaagccg gcgcugcuug
12900ugauggccuu caccagcaca auccagacuu ggacaauuau ugcuccuagg caugcaggau
12960acccauagau uugaaggagu gugucagggu cugcagcauc ccguugaccc uggaagagug
13020ggcucuuguu gaccauaggu ccaaacagcc auucuguggu ccucucauau uccauaucuc
13080ucgucuucac aaugaauccg ucugucuucg uccucuuagg gucuuucucu auguuguaga
13140ucacauauuu gacaucggcg uuuacuccgu uuguugucaa guacaauucu ggacuacugu
13200aagccauggc aagcagagag acgaggaacc ccccucucug agagugcugc uuaucugugu
13260ccaaugagug agcuaggaag guaguugcaa ugaauaacuu gucugcauca ucagucacac
13320uugggccuag uacgaacacu gagacugugc uccucuggcc ggggauaaca gcaccuccuc
13380ccgacuuauu aauacuuucg cuccuccuag agcuaaaugu aucgaaggug cucaacaacc
13440cggccaucgu gaagaucugc ggccgcgaug aacuuucacc cuaaguuuuu cuuacuacgg
13500uuagcuuuuc auuuugauca ucauguaugc uucuaugcag uugaugaaga ugucaaauuc
13560auucauggcc uuguagacac cuuggucuug gagcuuauua aaaucacucu ucaccugcuc
13620cacugccuug cucuuauuuu cacaggggag aaaucgauga cagcgccuca gccgcauccu
13680gagggucuuc agcuucucac ccagggaauu caaaugcucc uugauuucug ggccaugcuu
13740cucugccugg ggcaucacuu cuaccaggua aaacuggauc auuuccgaua aggcuuggca
13800acccaaguaa cccuuaaagu ccugcauuaa ggagucgguu agcaguaugu uguccagcug
13860guccuuuguu ugaaagaaag ucuucaccug gcugaaggca guccgcagcu cuaggagcau
13920guggcucugg ccgacuggga agugggugca guuauugucu ucccggcugu acuggccccu
13980gcugauccuc augccaguca guaagagcag gcagcauagc agugcugagc caggcauuga
14040acuuuggcgg ccgcgugaac uuuggcagca aagcaaaggg ucuggaaccu gcuccucagg
14100guggauacuu ugacccuaaa auccuguaua acuucauuac auaucccaua cauguuuuuu
14160cucuuguuug gu
141721714172RNAArtificialSeV18+mIL10/dF (antigenomic RNA) 17accaaacaag
agaaaaaaca uguaugggau auguaaugaa guuauacagg auuuuagggu 60caaaguaucc
acccugagga gcagguucca gacccuuugc uuugcugcca aaguucacgc 120ggccgccaaa
guucaaugcc uggcucagca cugcuaugcu gccugcucuu acugacuggc 180augaggauca
gcaggggcca guacagccgg gaagacaaua acugcaccca cuucccaguc 240ggccagagcc
acaugcuccu agagcugcgg acugccuuca gccaggugaa gacuuucuuu 300caaacaaagg
accagcugga caacauacug cuaaccgacu ccuuaaugca ggacuuuaag 360gguuacuugg
guugccaagc cuuaucggaa augauccagu uuuaccuggu agaagugaug 420ccccaggcag
agaagcaugg cccagaaauc aaggagcauu ugaauucccu gggugagaag 480cugaagaccc
ucaggaugcg gcugaggcgc ugucaucgau uucuccccug ugaaaauaag 540agcaaggcag
uggagcaggu gaagagugau uuuaauaagc uccaagacca aggugucuac 600aaggccauga
augaauuuga caucuucauc aacugcauag aagcauacau gaugaucaaa 660augaaaagcu
aaccguagua agaaaaacuu agggugaaag uucaucgcgg ccgcagaucu 720ucacgauggc
cggguuguug agcaccuucg auacauuuag cucuaggagg agcgaaagua 780uuaauaaguc
gggaggaggu gcuguuaucc ccggccagag gagcacaguc ucaguguucg 840uacuaggccc
aagugugacu gaugaugcag acaaguuauu cauugcaacu accuuccuag 900cucacucauu
ggacacagau aagcagcacu cucagagagg gggguuccuc gucucucugc 960uugccauggc
uuacaguagu ccagaauugu acuugacaac aaacggagua aacgccgaug 1020ucaaauaugu
gaucuacaac auagagaaag acccuaagag gacgaagaca gacggauuca 1080uugugaagac
gagagauaug gaauaugaga ggaccacaga auggcuguuu ggaccuaugg 1140ucaacaagag
cccacucuuc cagggucaac gggaugcugc agacccugac acacuccuuc 1200aaaucuaugg
guauccugca ugccuaggag caauaauugu ccaagucugg auugugcugg 1260ugaaggccau
cacaagcagc gccggcuuaa ggaaaggguu cuucaacagg uuagaggcgu 1320ucagacaaga
cggcaccgug aaaggugccu uaguuuucac uggggagaca guugagggga 1380uaggcucggu
uaugagaucu cagcaaagcc uuguaucucu caugguugag acccuuguga 1440cuaugaauac
ugcaagaucu gaucucacca cauuagagaa gaacauccag aucguuggga 1500acuacauccg
agaugcaggg cuggcuuccu ucaugaacac uauuaaauau gggguggaaa 1560caaagauggc
agcucuaacg uugucaaacc ugaggcccga uauuaauaag cuuagaagcc 1620ucauagacac
cuaccuguca aaaggcccca gagcucccuu uaucuguauc cucaaggacc 1680cuguucaugg
ugaauuugcu ccaggcaauu auccugcacu auggaguuac gccaugggag 1740ucgccgucgu
acagaacaag gcaaugcagc aguacgucac agggaggaca uaccuugaua 1800uggaaauguu
cuuacuagga caagccgugg caaaggaugc ugaaucgaag aucagcagug 1860ccuuggaaga
ugaguuagga gugacggaua cagccaaggg gaggcucaga caucaucugg 1920caaacuuguc
cgguggggau ggugcuuacc acaaaccaac aggcgguggu gcaauugagg 1980uagcucuaga
caaugccgac aucgaccuag aaacaaaagc ccaugcggac caggacgcua 2040gggguugggg
uggagauagu ggugaaagau gggcacguca ggugaguggu ggccacuuug 2100ucacacuaca
uggggcugaa cgguuagagg aggaaaccaa ugaugaggau guaucagaca 2160uagagagaag
aauagccaug agacucgcag agagacggca agaggauucu gcaacccaug 2220gagaugaagg
ccgcaauaac ggugucgauc augacgaaga ugacgaugcc gcagcaguag 2280cugggauagg
aggaaucuag gaucauacga ggcuucaagg uacuugaucc guaguaagaa 2340aaacuuaggg
ugaaaguuca uccaccgauc ggcucaggca aggccacacc caaccccacc 2400gaccacaccc
agcagucgag acagccacgg cuucggcuac acuuaccgca uggaucaaga 2460ugccuucauu
cuuaaagaag auucugaagu ugagagggag gcgccaggag gacgagaguc 2520gcucucggau
guuaucggau uccucgaugc uguccugucg agugaaccaa cugacaucgg 2580aggggacaga
agcuggcucc acaacaccau caacacuccc caaggaccag gcucugcuca 2640uagagccaaa
agugagggcg aaggagaagu cucaacaccg ucgacccaag auaaucgauc 2700aggugaggag
aguagagucu cugggagaac aagcaagcca gaggcagaag cacaugcugg 2760aaaccuugau
aaacaaaaua uacaccgggc cuuuggggga agaacuggua caaacucugu 2820aucucaggau
cugggcgaug gaggagacuc cggaauccuu gaaaauccuc caaaugagag 2880aggauauccg
agaucaggua uugaagauga aaacagagag auggcugcgc acccugauaa 2940gaggggagaa
gaccaagcug aaggacuucc agaagaggua cgaggaagua caucccuacc 3000ugaugaagga
gaagguggag caaguaauaa uggaagaagc auggagccug gcagcucaca 3060uagugcaaga
guaacugggg uccuggugau uccuagcccc gaacuugaag aggcugugcu 3120acggaggaac
aaaagaagac cuaccaacag uggguccaaa ccucuuacuc cagcaaccgu 3180gccuggcacc
cgguccccac cgcugaaucg uuacaacagc acagggucac caccaggaaa 3240acccccaucu
acacaggaug agcacaucaa cucuggggac acccccgccg ucagggucaa 3300agaccggaaa
ccaccaauag ggacccgcuc ugucucagau uguccagcca acggccgccc 3360aauccacccg
ggucuagaga ccgacucaac aaaaaagggc auaggagaga acacaucauc 3420uaugaaagag
auggcuacau uguugacgag ucuuggugua auccagucug cucaagaauu 3480cgaaucaucc
cgagacgcga guuauguguu ugcaagacgu gcccuaaagu cugcaaacua 3540ugcagagaug
acauucaaug uaugcggccu gauccuuucu gccgagaaau cuuccgcucg 3600uaagguagau
gagaacaaac aacugcucaa acagauccaa gagagcgugg aaucauuccg 3660ggauauuuac
aagagauucu cugaguauca gaaagaacag aacucauugc ugauguccaa 3720ccuaucuaca
cuucauauca ucacagauag agguggcaag acugacaaca cagacucccu 3780uacaaggucc
cccuccguuu uugcaaaauc aaaagagaac aagacuaagg cuaccagguu 3840ugacccaucu
auggagaccc uagaagauau gaaguacaaa ccggaccuaa uccgagagga 3900ugaauuuaga
gaugagaucc gcaacccggu guaccaagag agggacacag aacccagggc 3960cucaaacgca
ucacgucucc uccccuccaa agagaagccc acaaugcacu cucucaggcu 4020cgucauagag
agcagucccc uaagcagagc ugagaaagua gcauauguga aaucauuauc 4080caagugcaag
acagaccaag agguuaaggc agucauggaa cucguagaag aggacauaga 4140gucacugacc
aacuagaucc cgggugaggc auccuaccau ccucagucau agagagaucc 4200aaucuaccau
cagcaucagc caguaaagau uaagaaaaac uuagggugaa agaaauuuca 4260ccuaacacgg
cgcaauggca gauaucuaua gauucccuaa guucucauau gaggauaacg 4320guacugugga
gccccugccu cugagaacug guccggauaa gaaagccauc ccccacauca 4380ggauugucaa
gguaggagac ccuccuaaac auggagugag auaccuagau uuauugcucu 4440uggguuucuu
ugagacaccg aaacaaacaa ccaaucuagg gagcguaucu gacuugacag 4500agccgaccag
cuacucaaua ugcggcuccg ggucguuacc cauaggugug gccaaauacu 4560acgggacuga
ucaggaacuc uuaaaggccu gcaccgaucu cagaauuacg gugaggagga 4620cuguucgagc
aggagagaug aucguauaca ugguggauuc gauuggugcu ccacuccuac 4680cauggucagg
caggcugaga cagggaauga uauuuaaugc aaacaagguc gcacuagcuc 4740cccaaugccu
cccuguggac aaggacauaa gacucagagu gguguuuguc aaugggacau 4800cucuaggggc
aaucaccaua gccaagaucc caaagacccu ugcagaccuu gcauugccca 4860acucuauauc
uguuaauuua cuggugacac ucaagaccgg gaucuccaca gaacaaaagg 4920ggguacuccc
aguacuugau gaucaagggg agaaaaagcu caauuuuaug gugcaccucg 4980gguugaucag
gagaaagguc gggaagauau acucuguuga guacugcaag agcaagauug 5040agagaaugcg
gcugauuuuc ucacuugggu uaaucggcgg uauaagcuuc cauguucagg 5100uuaaugggac
acuaucuaag acauucauga gucagcucgc auggaagagg gcagucugcu 5160ucccauuaau
ggaugugaau ccccauauga acauggugau uugggcggca ucuguagaaa 5220ucacaggcgu
cgaugcggug uuccaaccgg ccaucccucg ugauuuccgc uacuacccua 5280auguuguggc
uaagaacauc ggaaggauca gaaagcugua aaugugcacc caucagagac 5340cugcgacaau
gccccaagca gacaccaccu ggcagucgga gccaccgggu cacuccuugu 5400cuuaaauaag
aaaaacuuag ggauaaaguc ccuugugagu gcuugguugc aaaacucucc 5460accugguaca
agcacagauc auggauggug auaggggcaa acgugacucg uacuggucua 5520cuucuccuag
ugguagcacc acaaaaccag caucagguug ggagagguca aguaaagccg 5580acacaugguu
gcugauucuc ucauucaccc agugggcuuu gucaauugcc acagugauca 5640ucuguaucau
aauuucugcu agacaagggu auaguaugaa agaguacuca augacuguag 5700aggcauugaa
caugagcagc agggagguga aagagucacu uaccagucua auaaggcaag 5760agguuauagc
aagggcuguc aacauucaga gcucugugca aaccggaauc ccagucuugu 5820ugaacaaaaa
cagcagggau gucauccaga ugauugauaa gucgugcagc agacaagagc 5880ucacucagca
cugugagagu acgaucgcag uccaccaugc cgauggaauu gccccacuug 5940agccacauag
uuucuggaga ugcccugucg gagaaccgua ucuuagcuca gauccugaaa 6000ucucauugcu
gccugguccg agcuuguuau cugguucuac aacgaucucu ggauguguua 6060ggcucccuuc
acucucaauu ggcgaggcaa ucuaugccua uucaucaaau cucauuacac 6120aagguugugc
ugacauaggg aaaucauauc agguccugca gcuaggguac auaucacuca 6180auucagauau
guucccugau cuuaaccccg uaguguccca cacuuaugac aucaacgaca 6240aucggaaauc
augcucugug guggcaaccg ggacuagggg uuaucagcuu ugcuccaugc 6300cgacuguaga
cgaaagaacc gacuacucua gugaugguau ugaggaucug guccuugaug 6360uccuggaucu
caaagggaga acuaagucuc accgguaucg caacagcgag guagaucuug 6420aucacccguu
cucugcacua uaccccagug uaggcaacgg cauugcaaca gaaggcucau 6480ugauauuucu
uggguauggu ggacuaacca ccccucugca gggugauaca aaauguagga 6540cccaaggaug
ccaacaggug ucgcaagaca caugcaauga ggcucugaaa auuacauggc 6600uaggagggaa
acaggugguc agcgugauca uccaggucaa ugacuaucuc ucagagaggc 6660caaagauaag
agucacaacc auuccaauca cucaaaacua ucucggggcg gaagguagau 6720uauuaaaauu
gggugaucgg guguacaucu auacaagauc aucaggcugg cacucucaac 6780ugcagauagg
aguacuugau gucagccacc cuuugacuau caacuggaca ccucaugaag 6840ccuugucuag
accaggaaau aaagagugca auugguacaa uaaguguccg aaggaaugca 6900uaucaggcgu
auacacugau gcuuauccau uguccccuga ugcagcuaac gucgcuaccg 6960ucacgcuaua
ugccaauaca ucgcguguca acccaacaau cauguauucu aacacuacua 7020acauuauaaa
uauguuaagg auaaaggaug uucaauuaga ggcugcauau accacgacau 7080cguguaucac
gcauuuuggu aaaggcuacu gcuuucacau caucgagauc aaucagaaga 7140gccugaauac
cuuacagccg augcucuuua agacuagcau cccuaaauua ugcaaggccg 7200agucuuaaau
uuaacugacu agcaggcuug ucggccuugc ugacacuaga gucaucuccg 7260aacauccaca
auaucucuca gucucuuacg ucucucacag uauuaagaaa aacccagggu 7320gaaugggaag
cuugccauag gucauggaug ggcaggaguc cucccaaaac ccuucugaca 7380uacucuaucc
agaaugccac cugaacucuc ccauagucag ggggaagaua gcacaguugc 7440acgucuuguu
agaugugaac cagcccuaca gacugaagga cgacagcaua auaaauauua 7500caaagcacaa
aauuaggaac ggaggauugu ccccccguca aauuaagauc aggucucugg 7560guaaggcucu
ucaacgcaca auaaaggauu uagaccgaua cacguuugaa ccguacccaa 7620ccuacucuca
ggaauuacuu aggcuugaua uaccagagau augugacaaa auccgauccg 7680ucuucgcggu
cucggaucgg cugaccaggg aguuaucuag uggguuccag gaucuuuggu 7740ugaauaucuu
caagcaacua ggcaauauag aaggaagaga gggguacgau ccguugcagg 7800auaucggcac
caucccggag auaacugaua aguacagcag gaauagaugg uauaggccau 7860uccuaacuug
guucagcauc aaauaugaca ugcgguggau gcagaagacc agaccggggg 7920gaccccucga
uaccucuaau ucacauaacc uccuagaaug caaaucauac acucuaguaa 7980cauacggaga
ucuugucaug auacugaaca aguugacauu gacaggguau auccuaaccc 8040cugagcuggu
cuugauguau ugugauguug uagaaggaag guggaauaug ucugcugcag 8100ggcaucuaga
uaagaagucc auugggauaa caagcaaagg ugaggaauua ugggaacuag 8160uggauucccu
cuucucaagu cuuggagagg aaauauacaa ugucaucgca cuauuggagc 8220cccuaucacu
ugcucucaua caacuaaaug auccuguuau accucuacgu ggggcauuua 8280ugaggcaugu
guugacagag cuacagacug uuuuaacaag uagagacgug uacacagaug 8340cugaagcaga
cacuauugug gagucguuac ucgccauuuu ccauggaacc ucuauugaug 8400agaaagcaga
gaucuuuucc uucuuuagga cauuuggcca ccccagcuua gaggcuguca 8460cugccgccga
caagguaagg gcccauaugu augcacaaaa ggcaauaaag cuuaagaccc 8520uauacgagug
ucaugcaguu uuuugcacua ucaucauaaa uggguauaga gagaggcaug 8580gcggacagug
gccccccugu gacuucccug aucacgugug ucuagaacua aggaacgcuc 8640aaggguccaa
uacggcaauc ucuuaugaau gugcuguaga caacuauaca aguuucauag 8700gcuucaaguu
ucggaaguuu auagaaccac aacuagauga agaucucaca auauauauga 8760aagacaaagc
acuauccccc aggaaggagg caugggacuc uguauacccg gauaguaauc 8820uguacuauaa
agccccagag ucugaagaga cccggcggcu uauugaagug uucauaaaug 8880augagaauuu
caacccagaa gaaauuauca auuaugugga gucaggagau ugguugaaag 8940acgaggaguu
caacaucucg uacagucuca aagagaaaga gaucaagcaa gagggucguc 9000uauucgcaaa
aaugacuuau aagaugcgag ccguacaggu gcuggcagag acacuacugg 9060cuaaaggaau
aggagagcua uucagcgaaa augggauggu uaaaggagag auagaccuac 9120uuaaaagauu
gacuacucuu ucugucucag gcguccccag gacugauuca guguacaaua 9180acucuaaauc
aucagagaag agaaacgaag gcauggaaaa uaagaacucu gggggguacu 9240gggacgaaaa
gaagaggucc agacaugaau ucaaggcaac agauucauca acagacggcu 9300augaaacguu
aaguugcuuc cucacaacag accucaagaa auacugcuua aacuggagau 9360uugagaguac
ugcauuguuu ggucagagau gcaacgagau auuuggcuuc aagaccuucu 9420uuaacuggau
gcauccaguc cuugaaaggu guacaauaua uguuggagau ccuuacuguc 9480cagucgccga
ccggaugcau cgacaacucc aggaucaugc agacucuggc auuuucauac 9540auaauccuag
ggggggcaua gaagguuacu gccagaagcu guggaccuua aucucaauca 9600gugcaaucca
ccuagcagcu gugagagugg gugucagggu cucugcaaug guucagggug 9660acaaucaagc
uauagccgug acaucaagag uaccuguagc ucagacuuac aagcagaaga 9720aaaaucaugu
cuaugaggag aucaccaaau auuucggugc ucuaagacac gucauguuug 9780auguagggca
cgagcuaaaa uugaacgaga ccaucauuag uagcaagaug uuugucuaua 9840guaaaaggau
auacuaugau gggaagauuu uaccacagug ccugaaagcc uugaccaagu 9900guguauucug
guccgagaca cugguagaug aaaacagauc ugcuuguucg aacaucucaa 9960cauccauagc
aaaagcuauc gaaaaugggu auucuccuau acuaggcuac ugcauugcgu 10020uguauaagac
cugucagcag gugugcauau cacuagggau gacuauaaau ccaacuauca 10080gcccgaccgu
aagagaucaa uacuuuaagg guaagaauug gcugagaugu gcaguguuga 10140uuccagcaaa
uguuggagga uucaacuaca ugucuacauc uagaugcuuu guuagaaaua 10200uuggagaccc
cgcaguagca gcccuagcug aucucaaaag auucaucaga gcggaucugu 10260uagacaagca
gguauuauac agggucauga aucaagaacc cggugacucu aguuuucuag 10320auugggcuuc
agacccuuau ucguguaacc ucccgcauuc ucagaguaua acuacgauua 10380uaaagaauau
cacugcuaga ucugugcugc aggaaucccc gaauccucua cugucugguc 10440ucuucaccga
gacuagugga gaagaggauc ucaaccuggc cucguuccuu auggaccgga 10500aagucauccu
gccgagagug gcucaugaga uccuggguaa uuccuuaacu ggaguuaggg 10560aggcgauugc
agggaugcuu gauacgacca agucucuagu gagagccagc guuaggaaag 10620gaggauuauc
auaugggaua uugaggaggc uugucaauua ugaucuauug caguacgaga 10680cacugacuag
aacucucagg aaaccgguga aagacaacau cgaauaugag uauauguguu 10740caguugagcu
agcugucggu cuaaggcaga aaauguggau ccaccugacu uacgggagac 10800ccauacaugg
gcuagaaaca ccagacccuu uagagcucuu gaggggaaua uuuaucgaag 10860guucagaggu
gugcaagcuu ugcaggucug aaggagcaga ccccaucuau acaugguucu 10920aucuuccuga
caauauagac cuggacacgc uuacaaacgg auguccggcu auaagaaucc 10980ccuauuuugg
aucagccacu gaugaaaggu cggaagccca acucggguau guaagaaauc 11040uaagcaaacc
cgcaaaggcg gccauccgga uagcuauggu guauacgugg gccuacggga 11100cugaugagau
aucguggaug gaagccgcuc uuauagccca aacaagagcu aaucugagcu 11160uagagaaucu
aaagcugcug acuccuguuu caaccuccac uaaucuaucu cauagguuga 11220aagauacggc
aacccagaug aaguucucua gugcaacacu aguccgugca agucgguuca 11280uaacaauauc
aaaugauaac auggcacuca aagaagcagg ggagucgaag gauacuaauc 11340ucguguauca
gcagauuaug cuaacugggc uaagcuuguu cgaguucaau augagauaua 11400agaaagguuc
cuuagggaag ccacugauau ugcacuuaca ucuuaauaac gggugcugua 11460uaauggaguc
cccacaggag gcgaauaucc ccccaagguc cacauuagau uuagagauua 11520cacaagagaa
caauaaauug aucuaugauc cugauccacu caaggaugug gaccuugagc 11580uauuuagcaa
ggucagagau guuguacaca caguugacau gacuuauugg ucagaugaug 11640aaguuaucag
agcaaccagu aucuguacug caaugacgau agcugauaca augucucaau 11700uagauagaga
caacuuaaaa gagaugaucg cacuaguaaa ugacgaugau gucaacagcu 11760ugauuacuga
guuuauggug auugauguuc cuuuauuuug cucaacguuc ggggguauuc 11820uagucaauca
guuugcauac ucacucuacg gcuuaaacau cagaggaagg gaagaaauau 11880ggggacaugu
aguccggauu cuuaaagaua ccucccacgc aguuuuaaaa gucuuaucua 11940augcucuauc
ucaucccaaa aucuucaaac gauucuggaa ugcagguguc guggaaccug 12000uguaugggcc
uaaccucuca aaucaggaua agauacucuu ggcccucucu gucugugaau 12060auucugugga
ucuauucaug cacgauuggc aagggggugu accgcuugag aucuuuaucu 12120gugacaauga
cccagaugug gccgacauga ggagguccuc uuucuuggca agacaucuug 12180cauaccuaug
cagcuuggca gagauaucua gggaugggcc aagauuagaa ucaaugaacu 12240cucuagagag
gcucgaguca cuaaagaguu accuggaacu cacauuucuu gaugacccgg 12300uacugaggua
cagucaguug acuggccuag ucaucaaagu auucccaucu acuuugaccu 12360auauccggaa
gucaucuaua aaaguguuaa ggacaagagg uauaggaguc ccugaagucu 12420uagaagauug
ggaucccgag gcagauaaug cacuguuaga ugguaucgcg gcagaaauac 12480aacagaauau
uccuuuggga caucagacua gagccccuuu uuggggguug agaguaucca 12540agucacaggu
acugcgucuc cggggguaca aggagaucac aagaggugag auaggcagau 12600cagguguugg
ucugacguua ccauucgaug gaagauaucu aucucaccag cugaggcucu 12660uuggcaucaa
caguacuagc ugcuugaaag cacuugaacu uaccuaccua uugagccccu 12720uaguugacaa
ggauaaagau aggcuauauu uaggggaagg agcuggggcc augcuuuccu 12780guuaugacgc
uacucuuggc ccaugcauca acuauuauaa cucaggggua uacucuugug 12840augucaaugg
gcagagagag uuaaauauau auccugcuga gguggcacua gugggaaaga 12900aauuaaacaa
uguuacuagu cugggucaaa gaguuaaagu guuauucaac gggaauccug 12960gcucgacaug
gauugggaau gaugagugug aggcuuugau uuggaaugaa uuacagaaua 13020gcucgauagg
ccuaguccac ugugacaugg agggaggaga ucauaaggau gaucaaguug 13080uacugcauga
gcauuacagu guaauccgga ucgcguaucu ggugggggau cgagacguug 13140ugcuuauaag
caagauugcu cccaggcugg gcacggauug gaccaggcag cucagccuau 13200aucugagaua
cugggacgag guuaaccuaa uagugcuuaa aacaucuaac ccugcuucca 13260cagagaugua
ucuccuaucg aggcacccca aaucugacau uauagaggac agcaagacag 13320uguuagcuag
ucuccucccu uugucaaaag aagauagcau caagauagaa aaguggaucu 13380uaauagagaa
ggcaaaggcu cacgaauggg uuacucggga auugagagaa ggaagcucuu 13440caucagggau
gcuuagaccu uaccaucaag cacugcagac guuuggcuuu gaaccaaacu 13500uguauaaauu
gagcagagau uucuugucca ccaugaacau agcugauaca cacaacugca 13560ugauagcuuu
caacaggguu uugaaggaua caaucuucga augggcuaga auaacugagu 13620cagauaaaag
gcuuaaacua acugguaagu augaccugua uccugugaga gauucaggca 13680aguugaagac
aauuucuaga agacuugugc uaucuuggau aucuuuaucu auguccacaa 13740gauugguaac
ugggucauuc ccugaccaga aguuugaagc aagacuucaa uugggaauag 13800uuucauuauc
aucccgugaa aucaggaacc ugaggguuau cacaaaaacu uuauuagaca 13860gguuugagga
uauuauacau aguauaacgu auagauuccu caccaaagaa auaaagauuu 13920ugaugaagau
uuuaggggca gucaagaugu ucggggccag gcaaaaugaa uacacgaccg 13980ugauugauga
uggaucacua ggugauaucg agccauauga cagcucguaa uaauuagucc 14040cuaucgugca
gaacgaucga agcuccgcgg uaccuggaag ucuuggacuu guccauauga 14100caauaguaag
aaaaacuuac aagaagacaa gaaaauuuaa aaggauacau aucucuuaaa 14160cucuugucug
gu
141721814172RNAArtificialSeV18+mIL-10/TS-dF (genomic RNA) 18accagacaag
aguuuaagag auauguaucc uuuuaaauuu ucuugucuuc uuguaaguuu 60uucuuacuau
ugucauaugg acaaguccaa gacuuccagg uaccgcggag cuucgaucgu 120ucugcacgau
agggacuaau uauuacgagc ugucauaugg cucgauauca ccuagugauc 180caucaucaau
cacggucgug uauucauuuu gccuggcccc gaacaucuug acugccccua 240aaaucuucau
caaaaucuuu auuucuuugg ugaggaaucu auacguuaua cuauguauaa 300uauccucaaa
ccugucuaau aaaguuuuug ugauaacccu cagguuccug auuucacggg 360augauaauga
aacuauuccc aauugaaguc uugcuucaaa cuucugguca gggaaugacc 420caguuaccaa
ucuuguggac auagauaaag auauccaaga uagcacaagu cuucuagaaa 480uugucuucaa
cuugccugaa ucucucacag gauacagguc auacuuacca guuaguuuaa 540gccuuuuauc
ugacucaguu auucuagccc auucgaagau uguauccuuc aaaacccugu 600ugaaagcuau
caugcaguug uguguaucag cuauguucau gguggacaag aaaucucugc 660ucaauuuaua
caaguuuggu ucaaagccaa acgucugcag ugcuugaugg uaaggucuaa 720gcaucccuga
ugaagagcuu ccuucucuca auucccgagu aacccauucg ugagccuuug 780ccuucucuau
uaagauccac uuuucuaucu ugaugcuauc uucuuuugac aaagggagga 840gacuagcuaa
cacugucuug cuguccucua uaaugucaga uuuggggugc cucgauagga 900gauacaucuc
uguggaagca ggguuagaug uuuuaagcac uauuagguua accucguccc 960aguaucucag
auauaggcug agcugccugg uccaauccgu gcccagccug ggagcaaucu 1020ugcuuauaag
cacaacgucu cgauccccca ccagauacgc gauccggauu acacuguaau 1080gcucaugcag
uacaacuuga ucauccuuau gaucuccucc cuccauguca caguggacua 1140ggccuaucga
gcuauucugu aauucauucc aaaucaaagc cucacacuca ucauucccaa 1200uccaugucga
gccaggauuc ccguugaaua acacuuuaac ucuuugaccc agacuaguaa 1260cauuguuuaa
uuucuuuccc acuagugcca ccucagcagg auauauauuu aacucucucu 1320gcccauugac
aucacaagag uauaccccug aguuauaaua guugaugcau gggccaagag 1380uagcgucaua
acaggaaagc auggccccag cuccuucccc uaaauauagc cuaucuuuau 1440cuucgucaac
uaaggggcuc aauagguagg uaaguucaag ugcuuucaag cagcuaguac 1500uguugaugcc
aaagagccuc agcuggugag auagauaucu uccaucgaau gguaacguca 1560gaccaacacc
ugaucugccu aucucaccuc uugugaucuc cuuguacccc cggagacgca 1620guaccuguga
cuuggauacu cucaaccccc aaaaaggggc ucuagucuga ugucccaaag 1680gaauauucug
uuguauuucu gccgcgauac caucuaacag ugcauuaucu gccucgggau 1740cccaaucuuc
uaagacuuca gggacuccua uaccucuugu ccuuaacacu uuuauagaug 1800acuuccggau
auaggucaaa guagauggga auacuuugau gacuaggcca gucaacugac 1860uguaccucag
uaccggguca ucaagaaaug ugaguuccag guaacucuuu agugacucga 1920gccucucuag
agaguucauu gauucuaauc uuggcccauc ccuagauauc ucugccaagc 1980ugcauaggua
ugcaagaugu cuugccaaga aagaggaccu ccucaugucg gccacaucug 2040ggucauuguc
acagauaaag aucucaagcg guacaccccc uugccaaucg ugcaugaaua 2100gauccacaga
auauucacag acagagaggg ccaagaguau cuuauccuga uuugagaggu 2160uaggcccaua
cacagguucc acgacaccug cauuccagaa ucguuugaag auuuugggau 2220gagauagagc
auuagauaag acuuuuaaaa cugcguggga gguaucuuua agaauccgga 2280cuacaugucc
ccauauuucu ucccuuccuc ugauguuuaa gccguagagu gaguaugcaa 2340acugauugac
uagaauaccc ccgaacguug agcaaaauaa aggaacauca aucaccauaa 2400acucaguaau
caagcuguug acaucaucgu cauuuacuag ugcgaucauc ucuuuuaagu 2460ugucucuauc
uaauugagac auuguaucag cuaucgucau ugcaguacag auacugguug 2520cucugauaac
uucaucaucu gaccaauaag ucaugucaac uguguguaca acaucucuga 2580ccuugcuaaa
uagcucaagg uccacauccu ugaguggauc aggaucauag aucaauuuau 2640uguucucuug
uguaaucucu aaaucuaaug uggaccuugg ggggauauuc gccuccugug 2700gggacuccau
uauacagcac ccguuauuaa gauguaagug caauaucagu ggcuucccua 2760aggaaccuuu
cuuauaucuc auauugaacu cgaacaagcu uagcccaguu agcauaaucu 2820gcugauacac
gagauuagua uccuucgacu ccccugcuuc uuugagugcc auguuaucau 2880uugauauugu
uaugaaccga cuugcacgga cuaguguugc acuagagaac uucaucuggg 2940uugccguauc
uuucaaccua ugagauagau uaguggaggu ugaaacagga gucagcagcu 3000uuagauucuc
uaagcucaga uuagcucuug uuugggcuau aagagcggcu uccauccacg 3060auaucucauc
agucccguag gcccacguau acaccauagc uauccggaug gccgccuuug 3120cggguuugcu
uagauuucuu acauacccga guugggcuuc cgaccuuuca ucaguggcug 3180auccaaaaua
ggggauucuu auagccggac auccguuugu aagcgugucc aggucuauag 3240agucaggaag
auagaaccau guauagaugg ggucugcucc uucagaccug caaagcuugc 3300acaccucuga
accuucgaua aauauucccc ucaagagcuc uaaagggucu gguguuucua 3360gcccauguau
gggucucccg uaagucaggu ggauccacau uuucugccuu agaccgacag 3420cuagcucaac
ugaacacaua uacucauauu cgauguuguc uuucaccggu uuccugagag 3480uucuagucag
ugucucguac ugcaauagau cauaauugac aagccuccuc aauaucccau 3540augauaaucc
uccuuuccua acgcuggcuc ucacuagaga cuuggucgua ucaagcaucc 3600cugcaaucgc
cucccuaacu ccaguuaagg aauuacccag gaucucauga gccacucucg 3660gcaggaugac
uuuccggucc auaaggaacg aggccagguu gagauccucu ucuccacuag 3720ucucggugaa
gagaccagac aguagaggau ucggggauuc cugcagcaca gaucuagcag 3780ugauauucuu
uauaaucgua guuauacucu gagaaugcgg gagguuacac gaauaagggu 3840cugaagccca
aucuagaaaa cuagagucac cggguucuug auucaugacc cuguauaaua 3900ccugcuuguc
uaacagaucc gcucugauga aucuuuugag aucagcuagg gcugcuacug 3960cggggucucc
aauauuucua acaaagcauc uagauguaga cauguaguug aauccuccaa 4020cauuugcugg
aaucaacacu gcacaucuca gccaauucuu acccuuaaag uauugaucuc 4080uuacggucgg
gcugauaguu ggauuuauag ucaucccuag ugauaugcac accugcugac 4140aggucuuaua
caacgcaaug caguagccua guauaggaga auacccauuu ucgauagcuu 4200uugcuaugga
uguugagaug uucgaacaag cagaucuguu uucaucuacc agugucucgg 4260accagaauac
acacuugguc aaggcuuuca ggcacugugg uaaaaucuuc ccaucauagu 4320auauccuuuu
acuauagaca aacaucuugc uacuaaugau ggucucguuc aauuuuagcu 4380cgugcccuac
aucaaacaug acgugucuua gagcaccgaa auauuuggug aucuccucau 4440agacaugauu
uuucuucugc uuguaagucu gagcuacagg uacucuugau gucacggcua 4500uagcuugauu
gucacccuga accauugcag agacccugac acccacucuc acagcugcua 4560gguggauugc
acugauugag auuaaggucc acagcuucug gcaguaaccu ucuaugcccc 4620cccuaggauu
auguaugaaa augccagagu cugcaugauc cuggaguugu cgaugcaucc 4680ggucggcgac
uggacaguaa ggaucuccaa cauauauugu acaccuuuca aggacuggau 4740gcauccaguu
aaagaagguc uugaagccaa auaucucguu gcaucucuga ccaaacaaug 4800caguacucuc
aaaucuccag uuuaagcagu auuucuugag gucuguugug aggaagcaac 4860uuaacguuuc
auagccgucu guugaugaau cuguugccuu gaauucaugu cuggaccucu 4920ucuuuucguc
ccaguacccc ccagaguucu uauuuuccau gccuucguuu cucuucucug 4980augauuuaga
guuauuguac acugaaucag uccuggggac gccugagaca gaaagaguag 5040ucaaucuuuu
aaguaggucu aucucuccuu uaaccauccc auuuucgcug aauagcucuc 5100cuauuccuuu
agccaguagu gucucugcca gcaccuguac ggcucgcauc uuauaaguca 5160uuuuugcgaa
uagacgaccc ucuugcuuga ucucuuucuc uuugagacug uacgagaugu 5220ugaacuccuc
gucuuucaac caaucuccug acuccacaua auugauaauu ucuucugggu 5280ugaaauucuc
aucauuuaug aacacuucaa uaagccgccg ggucucuuca gacucugggg 5340cuuuauagua
cagauuacua uccggguaua cagaguccca ugccuccuuc cugggggaua 5400gugcuuuguc
uuucauauau auugugagau cuucaucuag uugugguucu auaaacuucc 5460gaaacuugaa
gccuaugaaa cuuguauagu ugucuacagc acauucauaa gagauugccg 5520uauuggaccc
uugagcguuc cuuaguucua gacacacgug aucagggaag ucacaggggg 5580gccacugucc
gccaugccuc ucucuauacc cauuuaugau gauagugcaa aaaacugcau 5640gacacucgua
uagggucuua agcuuuauug ccuuuugugc auacauaugg gcccuuaccu 5700ugucggcggc
agugacagcc ucuaagcugg gguggccaaa uguccuaaag aaggaaaaga 5760ucucugcuuu
cucaucaaua gagguuccau ggaaaauggc gaguaacgac uccacaauag 5820ugucugcuuc
agcaucugug uacacgucuc uacuuguuaa aacagucugu agcucuguca 5880acacaugccu
cauaaaugcc ccacguagag guauaacagg aucauuuagu uguaugagag 5940caagugauag
gggcuccaau agugcgauga cauuguauau uuccucucca agacuugaga 6000agagggaauc
cacuaguucc cauaauuccu caccuuugcu uguuauccca auggacuucu 6060uaucuagaug
cccugcagca gacauauucc accuuccuuc uacaacauca caauacauca 6120agaccagcuc
agggguuagg auauacccug ucaaugucaa cuuguucagu aucaugacaa 6180gaucuccgua
uguuacuaga guguaugauu ugcauucuag gagguuaugu gaauuagagg 6240uaucgagggg
uccccccggu cuggucuucu gcauccaccg caugucauau uugaugcuga 6300accaaguuag
gaauggccua uaccaucuau uccugcugua cuuaucaguu aucuccggga 6360uggugccgau
auccugcaac ggaucguacc ccucucuucc uucuauauug ccuaguugcu 6420ugaagauauu
caaccaaaga uccuggaacc cacuagauaa cucccugguc agccgauccg 6480agaccgcgaa
gacggaucgg auuuugucac auaucucugg uauaucaagc cuaaguaauu 6540ccugagagua
gguuggguac gguucaaacg uguaucgguc uaaauccuuu auugugcguu 6600gaagagccuu
acccagagac cugaucuuaa uuugacgggg ggacaauccu ccguuccuaa 6660uuuugugcuu
uguaauauuu auuaugcugu cguccuucag ucuguagggc ugguucacau 6720cuaacaagac
gugcaacugu gcuaucuucc cccugacuau gggagaguuc agguggcauu 6780cuggauagag
uaugucagaa ggguuuuggg aggacuccug cccauccaug accuauggca 6840agcuucccau
ucacccuggg uuuuucuuaa uacugugaga gacguaagag acugagagau 6900auuguggaug
uucggagaug acucuagugu cagcaaggcc gacaagccug cuagucaguu 6960aaauuuaaga
cucggccuug cauaauuuag ggaugcuagu cuuaaagagc aucggcugua 7020agguauucag
gcucuucuga uugaucucga ugaugugaaa gcaguagccu uuaccaaaau 7080gcgugauaca
cgaugucgug guauaugcag ccucuaauug aacauccuuu auccuuaaca 7140uauuuauaau
guuaguagug uuagaauaca ugauuguugg guugacacgc gauguauugg 7200cauauagcgu
gacgguagcg acguuagcug caucagggga caauggauaa gcaucagugu 7260auacgccuga
uaugcauucc uucggacacu uauuguacca auugcacucu ucauuuccug 7320gucuagacaa
ggcuucauga gguguccagu ugauagucaa aggguggcug acaucaagua 7380cuccuaucug
caguugagag ugccagccug augaucuugu auagauguac acccgaucac 7440ccaauuuuaa
uaaucuaccu uccgccccga gauaguuuug agugauugga augguuguga 7500cucuuaucuu
uggccucucu gagagauagu cauugaccug gaugaucacg cugaccaccu 7560guuucccucc
uagccaugua auuuucagag ccucauugca ugugucuugc gacaccuguu 7620ggcauccuug
gguccuacau uuuguaucac ccugcagagg ggugguuagu ccaccauacc 7680caagaaauau
caaugagccu ucuguugcaa ugccguugcc uacacugggg uauagugcag 7740agaacgggug
aucaagaucu accucgcugu ugcgauaccg gugagacuua guucucccuu 7800ugagauccag
gacaucaagg accagauccu caauaccauc acuagaguag ucgguucuuu 7860cgucuacagu
cggcauggag caaagcugau aaccccuagu ccggguuguc accacagagc 7920augauuuccg
auugucguug augucauaag ugugggacac uacgggguua agaucaggga 7980acauaucuga
auugagugau auguacccua gcugcaggac cugauaugau uucccuaugu 8040cagcacaacc
uuguguaaug agauuugaug aauaggcaua gauugccucg ccaauugaga 8100gugaagggag
ccuaacacau ccagagaucg uuguagaacc agauaacaag cucggaccag 8160gcagcaauga
gauuucagga ucugagcuaa gauacgguuc uccgacaggg caucuccaga 8220aacuaugugg
cucaaguggg gcaauuccau cggcauggug gacugcgauc guacucucac 8280agugcugagu
gagcucuugu cugcugcacg acuuaucaau caucuggaug acaucccugc 8340uguuuuuguu
caacaagacu gggauuccgg uuugcacaga gcucugaaug uugacagccc 8400uugcuauaac
cucuugccuu auuagacugg uaagugacuc uuucaccucc cugcugcuca 8460uguucaaugc
cucuacaguc auugaguacu cuuucauacu auacccuugu cuagcagaaa 8520uuaugauaca
gaugaucacu guggcaauug acaaagccca cugggugaau gagagaauca 8580gcaaccaugu
gucggcuuua cuugaccucu cccaaccuga ugcugguuuu guggugcuac 8640cacuaggaga
aguagaccag uacgagucac guuugccccu aucaccaucc augaucugug 8700cuuguuugag
gugaaagcuu aauuaaccaa gcacucacaa gggacuuuau cccuaaguuu 8760uucuuauuua
agacaaggag ugacccggug gcuccgacug ccagguggug ucugcuuggg 8820gcauugucgc
aggucucuga ugggugcaca uuuacagcuu ucugauccuu ccgauguucu 8880uagccacaac
auuaggguag uagcggaaau cacgagggau ggccgguugg aacaccgcau 8940cgacgccugu
gauuucuaca gaugccgccc aaaucaccau guucauaugg ggauucacau 9000ccauuaaugg
gaagcagacu gcccucuucc augcgagcug acucaugaau gucuuagaua 9060gugucccauu
aaccugaaca uggaagcuua uaccgccgau uaacccaagu gagaaaauca 9120gccgcauucu
cucaaucuug cucuugcagu acucaacaga guauaucuuc ccgaccuuuc 9180uccugaucaa
cccgaggugc accauaaaau ugagcuuuuu cuccccuuga ucaucaagua 9240cugggaguac
ccccuuuugu ucuguggaga ucccggucuu gagugucacc aguaaauuaa 9300cagauauaga
guugggcaau gcaaggucug caagggucuu ugggaucuug gauaugguga 9360uugccccuag
agauguccca uugacaaaca ccacucugag ucuuaugucc uuguccacag 9420ggaggcauug
gggagcuagu gcgaccuugu uugcauuaaa uaucauuccc ugucucagcc 9480ugccugacca
ugguaggagu ggagcaccaa ucgaauccac cauguauacg aucaucucuc 9540cugcucgaac
agcccuccuc accguaauuc ugagaucggu gcaggccuuu aagaguuccu 9600gaucaguccc
guaguauuug gccacaccua uggguaacga cccggagccg cauauugagu 9660agcuggucgg
cucugucaag ucagauacgc ucucuagauu gguuguuugu uucggugucu 9720caaagaaacc
caagagcaau aaaucuaggu aucucacucc auguuuagga gggucuccua 9780ccuugacaau
ccugaugugg gggauggcuu ucuuauccgg accaguucuc agaggcaggg 9840gcuccacagu
accguuaucc ucauaugaga acuuagggaa ucuauagaua ucugccauug 9900cgccguguua
ggugaaauuu cuuucacccu aaguuuuucu uaaucuuuac uggcugaugc 9960ugaugguaga
uuggaucucu cuaugacuga ggaugguagg augccucacc cgggaucuag 10020uuggucagug
acucuauguc cucuucuacg aguuccauga cugccuuaac cucuuggucu 10080gucuugcacu
uggauaauga uuucacauau gcuacuuucu cagcucugcu uaggggacug 10140cucucuauga
cgagccugag agagugcauu gugggcuucu cuuuggaggg aaagagacgu 10200gaugcguuug
aggcccuggg uucugugucc cucucuuggu acaccggguu gcggaucuca 10260ucucuaaauu
cauccucucg gauuaggucc gguuuguacu ucauaucuuc uagggucucc 10320auagaugggu
caaaccuggu agccuuaguc uuguucucuu uugauuuugc aaaaacggag 10380ggggaccuug
uaagggaguc uguguuguca gucuugccac cucuaucugu gaugauauga 10440aguguagaua
gguuggacau cagcaaugag uucuguucuu ucugauacuc agagaaucuc 10500uuguaaauau
cccggaauga uuccacgcuc ucuuggaucu guuugagcag uuguuuguuc 10560ucaucuaccu
uacgagcgga agauuucucg gcagaaagga ucaggccgca uacauugaau 10620gucaucucug
cauaguuugc agacuuuagg gcacgucuug caaacacaua acucgcgucu 10680cgggaugauu
cgaauucuug agcagacugg auuacaccaa gacucgucaa caauguagcc 10740aucucuuuca
uagaugaugu guucucuccu augcccuuuu uuguugaguc ggucucuaga 10800cccgggugga
uugggcggcc guuggcugga caaucugaga cagagcgggu cccuauuggu 10860gguuuccggu
cuuugacccu gacggcgggg guguccccag aguugaugug cucauccugu 10920guagaugggg
guuuuccugg uggugacccu gugcuguugu aacgauucag cgguggggac 10980cgggugccag
gcacgguugc uggaguaaga gguuuggacc cacuguuggu aggucuucuu 11040uuguuccucc
guagcacagc cucuucaagu ucggggcuag gaaucaccag gaccccaguu 11100acucuugcac
uaugugagcu gccaggcucc augcuucuuc cauuauuacu ugcuccaccu 11160ucuccuucau
cagguaggga uguacuuccu cguaccucuu cuggaagucc uucagcuugg 11220ucuucucccc
ucuuaucagg gugcgcagcc aucucucugu uuucaucuuc aauaccugau 11280cucggauauc
cucucucauu uggaggauuu ucaaggauuc cggagucucc uccaucgccc 11340agauccugag
auacagaguu uguaccaguu cuucccccaa aggcccggug uauauuuugu 11400uuaucaaggu
uuccagcaug ugcuucugcc ucuggcuugc uuguucuccc agagacucua 11460cucuccucac
cugaucgauu aucuuggguc gacgguguug agacuucucc uucgcccuca 11520cuuuuggcuc
uaugagcaga gccugguccu uggggagugu ugaugguguu guggagccag 11580cuucuguccc
cuccgauguc aguugguuca cucgacagga cagcaucgag gaauccgaua 11640acauccgaga
gcgacucucg uccuccuggc gccucccucu caacuucaga aucuucuuua 11700agaaugaagg
caucuugauc caugcgguaa guguagccga agccguggcu gucucgacug 11760cugggugugg
ucgguggggu uggguguggc cuugccugag ccgaucggug gaugaacuuu 11820cacccuaagu
uuuucuuacu acggaucaag uaccuugaag ccucguauga uccuagauuc 11880cuccuauccc
agcuacugcu gcggcaucgu caucuucguc augaucgaca ccguuauugc 11940ggccuucauc
uccauggguu gcagaauccu cuugccgucu cucugcgagu cucauggcua 12000uucuucucuc
uaugucugau acauccucau cauugguuuc cuccucuaac cguucagccc 12060cauguagugu
gacaaagugg ccaccacuca ccugacgugc ccaucuuuca ccacuaucuc 12120caccccaacc
ccuagcgucc ugguccgcau gggcuuuugu uucuaggucg augucggcau 12180ugucuagagc
uaccucaauu gcaccaccgc cuguugguuu gugguaagca ccauccccac 12240cggacaaguu
ugccagauga ugucugagcc uccccuuggc uguauccguc acuccuaacu 12300caucuuccaa
ggcacugcug aucuucgauu cagcauccuu ugccacggcu uguccuagua 12360agaacauuuc
cauaucaagg uauguccucc cugugacgua cugcugcauu gccuuguucu 12420guacgacggc
gacucccaug gcguaacucc auagugcagg auaauugccu ggagcaaauu 12480caccaugaac
aggguccuug aggauacaga uaaagggagc ucuggggccu uuugacaggu 12540aggugucuau
gaggcuucua agcuuauuaa uaucgggccu cagguuugac aacguuagag 12600cugccaucuu
uguuuccacc ccauauuuaa uaguguucau gaaggaagcc agcccugcau 12660cucggaugua
guucccaacg aucuggaugu ucuucucuaa uguggugaga ucagaucuug 12720caguauucau
agucacaagg gucucaacca ugagagauac aaggcuuugc ugagaucuca 12780uaaccgagcc
uauccccuca acugucuccc cagugaaaac uaaggcaccu uucacggugc 12840cgucuugucu
gaacgccucu aaccuguuga agaacccuuu ccuuaagccg gcgcugcuug 12900ugauggccuu
caccagcaca auccagacuu ggacaauuau ugcuccuagg caugcaggau 12960acccauagau
uugaaggagu gugucagggu cugcagcauc ccguugaccc uggaagagug 13020ggcucuuguu
gaccauaggu ccaaacagcc auucuguggu ccucucauau uccauaucuc 13080ucgucuucac
aaugaauccg ucugucuucg uccucuuagg gucuuucucu auguuguaga 13140ucacauauuu
gacaucggcg uuuacuccgu uuguugucaa guacaauucu ggacuacugu 13200aagccauggc
aagcagagag acgaggaacc ccccucucug agagugcugc uuaucugugu 13260ccaaugagug
agcuaggaag guaguugcaa ugaauaacuu gucugcauca ucagucacac 13320uugggccuag
uacgaacacu gagacugugc uccucuggcc ggggauaaca gcaccuccuc 13380ccgacuuauu
aauacuuucg cuccuccuag agcuaaaugu aucgaaggug cucaacaacc 13440cggccaucgu
gaagaucugc ggccgcgaug aacuuucacc cuaaguuuuu cuuacuacgg 13500uuagcuuuuc
auuuugauca ucauguaugc uucuaugcag uugaugaaga ugucaaauuc 13560auucauggcc
uuguagacac cuuggucuug gagcuuauua aaaucacucu ucaccugcuc 13620cacugccuug
cucuuauuuu cacaggggag aaaucgauga cagcgccuca gccgcauccu 13680gagggucuuc
agcuucucac ccagggaauu caaaugcucc uugauuucug ggccaugcuu 13740cucugccugg
ggcaucacuu cuaccaggua aaacuggauc auuuccgaua aggcuuggca 13800acccaaguaa
cccuuaaagu ccugcauuaa ggagucgguu agcaguaugu uguccagcug 13860guccuuuguu
ugaaagaaag ucuucaccug gcugaaggca guccgcagcu cuaggagcau 13920guggcucugg
ccgacuggga agugggugca guuauugucu ucccggcugu acuggccccu 13980gcugauccuc
augccaguca guaagagcag gcagcauagc agugcugagc caggcauuga 14040acuuuggcgg
ccgcgugaac uuuggcagca aagcaaaggg ucuggaaccu gcuccucagg 14100guggauacuu
ugacccuaaa auccuguaua acuucauuac auaucccaua cauguuuuuu 14160cucuuguuug
gu
141721914172RNAArtificialSeV18+mIL-10/TS-dF (antigenomic RNA)
19accaaacaag agaaaaaaca uguaugggau auguaaugaa guuauacagg auuuuagggu
60caaaguaucc acccugagga gcagguucca gacccuuugc uuugcugcca aaguucacgc
120ggccgccaaa guucaaugcc uggcucagca cugcuaugcu gccugcucuu acugacuggc
180augaggauca gcaggggcca guacagccgg gaagacaaua acugcaccca cuucccaguc
240ggccagagcc acaugcuccu agagcugcgg acugccuuca gccaggugaa gacuuucuuu
300caaacaaagg accagcugga caacauacug cuaaccgacu ccuuaaugca ggacuuuaag
360gguuacuugg guugccaagc cuuaucggaa augauccagu uuuaccuggu agaagugaug
420ccccaggcag agaagcaugg cccagaaauc aaggagcauu ugaauucccu gggugagaag
480cugaagaccc ucaggaugcg gcugaggcgc ugucaucgau uucuccccug ugaaaauaag
540agcaaggcag uggagcaggu gaagagugau uuuaauaagc uccaagacca aggugucuac
600aaggccauga augaauuuga caucuucauc aacugcauag aagcauacau gaugaucaaa
660augaaaagcu aaccguagua agaaaaacuu agggugaaag uucaucgcgg ccgcagaucu
720ucacgauggc cggguuguug agcaccuucg auacauuuag cucuaggagg agcgaaagua
780uuaauaaguc gggaggaggu gcuguuaucc ccggccagag gagcacaguc ucaguguucg
840uacuaggccc aagugugacu gaugaugcag acaaguuauu cauugcaacu accuuccuag
900cucacucauu ggacacagau aagcagcacu cucagagagg gggguuccuc gucucucugc
960uugccauggc uuacaguagu ccagaauugu acuugacaac aaacggagua aacgccgaug
1020ucaaauaugu gaucuacaac auagagaaag acccuaagag gacgaagaca gacggauuca
1080uugugaagac gagagauaug gaauaugaga ggaccacaga auggcuguuu ggaccuaugg
1140ucaacaagag cccacucuuc cagggucaac gggaugcugc agacccugac acacuccuuc
1200aaaucuaugg guauccugca ugccuaggag caauaauugu ccaagucugg auugugcugg
1260ugaaggccau cacaagcagc gccggcuuaa ggaaaggguu cuucaacagg uuagaggcgu
1320ucagacaaga cggcaccgug aaaggugccu uaguuuucac uggggagaca guugagggga
1380uaggcucggu uaugagaucu cagcaaagcc uuguaucucu caugguugag acccuuguga
1440cuaugaauac ugcaagaucu gaucucacca cauuagagaa gaacauccag aucguuggga
1500acuacauccg agaugcaggg cuggcuuccu ucaugaacac uauuaaauau gggguggaaa
1560caaagauggc agcucuaacg uugucaaacc ugaggcccga uauuaauaag cuuagaagcc
1620ucauagacac cuaccuguca aaaggcccca gagcucccuu uaucuguauc cucaaggacc
1680cuguucaugg ugaauuugcu ccaggcaauu auccugcacu auggaguuac gccaugggag
1740ucgccgucgu acagaacaag gcaaugcagc aguacgucac agggaggaca uaccuugaua
1800uggaaauguu cuuacuagga caagccgugg caaaggaugc ugaaucgaag aucagcagug
1860ccuuggaaga ugaguuagga gugacggaua cagccaaggg gaggcucaga caucaucugg
1920caaacuuguc cgguggggau ggugcuuacc acaaaccaac aggcgguggu gcaauugagg
1980uagcucuaga caaugccgac aucgaccuag aaacaaaagc ccaugcggac caggacgcua
2040gggguugggg uggagauagu ggugaaagau gggcacguca ggugaguggu ggccacuuug
2100ucacacuaca uggggcugaa cgguuagagg aggaaaccaa ugaugaggau guaucagaca
2160uagagagaag aauagccaug agacucgcag agagacggca agaggauucu gcaacccaug
2220gagaugaagg ccgcaauaac ggugucgauc augacgaaga ugacgaugcc gcagcaguag
2280cugggauagg aggaaucuag gaucauacga ggcuucaagg uacuugaucc guaguaagaa
2340aaacuuaggg ugaaaguuca uccaccgauc ggcucaggca aggccacacc caaccccacc
2400gaccacaccc agcagucgag acagccacgg cuucggcuac acuuaccgca uggaucaaga
2460ugccuucauu cuuaaagaag auucugaagu ugagagggag gcgccaggag gacgagaguc
2520gcucucggau guuaucggau uccucgaugc uguccugucg agugaaccaa cugacaucgg
2580aggggacaga agcuggcucc acaacaccau caacacuccc caaggaccag gcucugcuca
2640uagagccaaa agugagggcg aaggagaagu cucaacaccg ucgacccaag auaaucgauc
2700aggugaggag aguagagucu cugggagaac aagcaagcca gaggcagaag cacaugcugg
2760aaaccuugau aaacaaaaua uacaccgggc cuuuggggga agaacuggua caaacucugu
2820aucucaggau cugggcgaug gaggagacuc cggaauccuu gaaaauccuc caaaugagag
2880aggauauccg agaucaggua uugaagauga aaacagagag auggcugcgc acccugauaa
2940gaggggagaa gaccaagcug aaggacuucc agaagaggua cgaggaagua caucccuacc
3000ugaugaagga gaagguggag caaguaauaa uggaagaagc auggagccug gcagcucaca
3060uagugcaaga guaacugggg uccuggugau uccuagcccc gaacuugaag aggcugugcu
3120acggaggaac aaaagaagac cuaccaacag uggguccaaa ccucuuacuc cagcaaccgu
3180gccuggcacc cgguccccac cgcugaaucg uuacaacagc acagggucac caccaggaaa
3240acccccaucu acacaggaug agcacaucaa cucuggggac acccccgccg ucagggucaa
3300agaccggaaa ccaccaauag ggacccgcuc ugucucagau uguccagcca acggccgccc
3360aauccacccg ggucuagaga ccgacucaac aaaaaagggc auaggagaga acacaucauc
3420uaugaaagag auggcuacau uguugacgag ucuuggugua auccagucug cucaagaauu
3480cgaaucaucc cgagacgcga guuauguguu ugcaagacgu gcccuaaagu cugcaaacua
3540ugcagagaug acauucaaug uaugcggccu gauccuuucu gccgagaaau cuuccgcucg
3600uaagguagau gagaacaaac aacugcucaa acagauccaa gagagcgugg aaucauuccg
3660ggauauuuac aagagauucu cugaguauca gaaagaacag aacucauugc ugauguccaa
3720ccuaucuaca cuucauauca ucacagauag agguggcaag acugacaaca cagacucccu
3780uacaaggucc cccuccguuu uugcaaaauc aaaagagaac aagacuaagg cuaccagguu
3840ugacccaucu auggagaccc uagaagauau gaaguacaaa ccggaccuaa uccgagagga
3900ugaauuuaga gaugagaucc gcaacccggu guaccaagag agggacacag aacccagggc
3960cucaaacgca ucacgucucu uucccuccaa agagaagccc acaaugcacu cucucaggcu
4020cgucauagag agcagucccc uaagcagagc ugagaaagua gcauauguga aaucauuauc
4080caagugcaag acagaccaag agguuaaggc agucauggaa cucguagaag aggacauaga
4140gucacugacc aacuagaucc cgggugaggc auccuaccau ccucagucau agagagaucc
4200aaucuaccau cagcaucagc caguaaagau uaagaaaaac uuagggugaa agaaauuuca
4260ccuaacacgg cgcaauggca gauaucuaua gauucccuaa guucucauau gaggauaacg
4320guacugugga gccccugccu cugagaacug guccggauaa gaaagccauc ccccacauca
4380ggauugucaa gguaggagac ccuccuaaac auggagugag auaccuagau uuauugcucu
4440uggguuucuu ugagacaccg aaacaaacaa ccaaucuaga gagcguaucu gacuugacag
4500agccgaccag cuacucaaua ugcggcuccg ggucguuacc cauaggugug gccaaauacu
4560acgggacuga ucaggaacuc uuaaaggccu gcaccgaucu cagaauuacg gugaggaggg
4620cuguucgagc aggagagaug aucguauaca ugguggauuc gauuggugcu ccacuccuac
4680cauggucagg caggcugaga cagggaauga uauuuaaugc aaacaagguc gcacuagcuc
4740cccaaugccu cccuguggac aaggacauaa gacucagagu gguguuuguc aaugggacau
4800cucuaggggc aaucaccaua uccaagaucc caaagacccu ugcagaccuu gcauugccca
4860acucuauauc uguuaauuua cuggugacac ucaagaccgg gaucuccaca gaacaaaagg
4920ggguacuccc aguacuugau gaucaagggg agaaaaagcu caauuuuaug gugcaccucg
4980gguugaucag gagaaagguc gggaagauau acucuguuga guacugcaag agcaagauug
5040agagaaugcg gcugauuuuc ucacuugggu uaaucggcgg uauaagcuuc cauguucagg
5100uuaaugggac acuaucuaag acauucauga gucagcucgc auggaagagg gcagucugcu
5160ucccauuaau ggaugugaau ccccauauga acauggugau uugggcggca ucuguagaaa
5220ucacaggcgu cgaugcggug uuccaaccgg ccaucccucg ugauuuccgc uacuacccua
5280auguuguggc uaagaacauc ggaaggauca gaaagcugua aaugugcacc caucagagac
5340cugcgacaau gccccaagca gacaccaccu ggcagucgga gccaccgggu cacuccuugu
5400cuuaaauaag aaaaacuuag ggauaaaguc ccuugugagu gcuugguuaa uuaagcuuuc
5460accucaaaca agcacagauc auggauggug auaggggcaa acgugacucg uacuggucua
5520cuucuccuag ugguagcacc acaaaaccag caucagguug ggagagguca aguaaagccg
5580acacaugguu gcugauucuc ucauucaccc agugggcuuu gucaauugcc acagugauca
5640ucuguaucau aauuucugcu agacaagggu auaguaugaa agaguacuca augacuguag
5700aggcauugaa caugagcagc agggagguga aagagucacu uaccagucua auaaggcaag
5760agguuauagc aagggcuguc aacauucaga gcucugugca aaccggaauc ccagucuugu
5820ugaacaaaaa cagcagggau gucauccaga ugauugauaa gucgugcagc agacaagagc
5880ucacucagca cugugagagu acgaucgcag uccaccaugc cgauggaauu gccccacuug
5940agccacauag uuucuggaga ugcccugucg gagaaccgua ucuuagcuca gauccugaaa
6000ucucauugcu gccugguccg agcuuguuau cugguucuac aacgaucucu ggauguguua
6060ggcucccuuc acucucaauu ggcgaggcaa ucuaugccua uucaucaaau cucauuacac
6120aagguugugc ugacauaggg aaaucauauc agguccugca gcuaggguac auaucacuca
6180auucagauau guucccugau cuuaaccccg uaguguccca cacuuaugac aucaacgaca
6240aucggaaauc augcucugug gugacaaccc ggacuagggg uuaucagcuu ugcuccaugc
6300cgacuguaga cgaaagaacc gacuacucua gugaugguau ugaggaucug guccuugaug
6360uccuggaucu caaagggaga acuaagucuc accgguaucg caacagcgag guagaucuug
6420aucacccguu cucugcacua uaccccagug uaggcaacgg cauugcaaca gaaggcucau
6480ugauauuucu uggguauggu ggacuaacca ccccucugca gggugauaca aaauguagga
6540cccaaggaug ccaacaggug ucgcaagaca caugcaauga ggcucugaaa auuacauggc
6600uaggagggaa acaggugguc agcgugauca uccaggucaa ugacuaucuc ucagagaggc
6660caaagauaag agucacaacc auuccaauca cucaaaacua ucucggggcg gaagguagau
6720uauuaaaauu gggugaucgg guguacaucu auacaagauc aucaggcugg cacucucaac
6780ugcagauagg aguacuugau gucagccacc cuuugacuau caacuggaca ccucaugaag
6840ccuugucuag accaggaaau gaagagugca auugguacaa uaaguguccg aaggaaugca
6900uaucaggcgu auacacugau gcuuauccau uguccccuga ugcagcuaac gucgcuaccg
6960ucacgcuaua ugccaauaca ucgcguguca acccaacaau cauguauucu aacacuacua
7020acauuauaaa uauguuaagg auaaaggaug uucaauuaga ggcugcauau accacgacau
7080cguguaucac gcauuuuggu aaaggcuacu gcuuucacau caucgagauc aaucagaaga
7140gccugaauac cuuacagccg augcucuuua agacuagcau cccuaaauua ugcaaggccg
7200agucuuaaau uuaacugacu agcaggcuug ucggccuugc ugacacuaga gucaucuccg
7260aacauccaca auaucucuca gucucuuacg ucucucacag uauuaagaaa aacccagggu
7320gaaugggaag cuugccauag gucauggaug ggcaggaguc cucccaaaac ccuucugaca
7380uacucuaucc agaaugccac cugaacucuc ccauagucag ggggaagaua gcacaguugc
7440acgucuuguu agaugugaac cagcccuaca gacugaagga cgacagcaua auaaauauua
7500caaagcacaa aauuaggaac ggaggauugu ccccccguca aauuaagauc aggucucugg
7560guaaggcucu ucaacgcaca auaaaggauu uagaccgaua cacguuugaa ccguacccaa
7620ccuacucuca ggaauuacuu aggcuugaua uaccagagau augugacaaa auccgauccg
7680ucuucgcggu cucggaucgg cugaccaggg aguuaucuag uggguuccag gaucuuuggu
7740ugaauaucuu caagcaacua ggcaauauag aaggaagaga gggguacgau ccguugcagg
7800auaucggcac caucccggag auaacugaua aguacagcag gaauagaugg uauaggccau
7860uccuaacuug guucagcauc aaauaugaca ugcgguggau gcagaagacc agaccggggg
7920gaccccucga uaccucuaau ucacauaacc uccuagaaug caaaucauac acucuaguaa
7980cauacggaga ucuugucaug auacugaaca aguugacauu gacaggguau auccuaaccc
8040cugagcuggu cuugauguau ugugauguug uagaaggaag guggaauaug ucugcugcag
8100ggcaucuaga uaagaagucc auugggauaa caagcaaagg ugaggaauua ugggaacuag
8160uggauucccu cuucucaagu cuuggagagg aaauauacaa ugucaucgca cuauuggagc
8220cccuaucacu ugcucucaua caacuaaaug auccuguuau accucuacgu ggggcauuua
8280ugaggcaugu guugacagag cuacagacug uuuuaacaag uagagacgug uacacagaug
8340cugaagcaga cacuauugug gagucguuac ucgccauuuu ccauggaacc ucuauugaug
8400agaaagcaga gaucuuuucc uucuuuagga cauuuggcca ccccagcuua gaggcuguca
8460cugccgccga caagguaagg gcccauaugu augcacaaaa ggcaauaaag cuuaagaccc
8520uauacgagug ucaugcaguu uuuugcacua ucaucauaaa uggguauaga gagaggcaug
8580gcggacagug gccccccugu gacuucccug aucacgugug ucuagaacua aggaacgcuc
8640aaggguccaa uacggcaauc ucuuaugaau gugcuguaga caacuauaca aguuucauag
8700gcuucaaguu ucggaaguuu auagaaccac aacuagauga agaucucaca auauauauga
8760aagacaaagc acuauccccc aggaaggagg caugggacuc uguauacccg gauaguaauc
8820uguacuauaa agccccagag ucugaagaga cccggcggcu uauugaagug uucauaaaug
8880augagaauuu caacccagaa gaaauuauca auuaugugga gucaggagau ugguugaaag
8940acgaggaguu caacaucucg uacagucuca aagagaaaga gaucaagcaa gagggucguc
9000uauucgcaaa aaugacuuau aagaugcgag ccguacaggu gcuggcagag acacuacugg
9060cuaaaggaau aggagagcua uucagcgaaa augggauggu uaaaggagag auagaccuac
9120uuaaaagauu gacuacucuu ucugucucag gcguccccag gacugauuca guguacaaua
9180acucuaaauc aucagagaag agaaacgaag gcauggaaaa uaagaacucu gggggguacu
9240gggacgaaaa gaagaggucc agacaugaau ucaaggcaac agauucauca acagacggcu
9300augaaacguu aaguugcuuc cucacaacag accucaagaa auacugcuua aacuggagau
9360uugagaguac ugcauuguuu ggucagagau gcaacgagau auuuggcuuc aagaccuucu
9420uuaacuggau gcauccaguc cuugaaaggu guacaauaua uguuggagau ccuuacuguc
9480cagucgccga ccggaugcau cgacaacucc aggaucaugc agacucuggc auuuucauac
9540auaauccuag ggggggcaua gaagguuacu gccagaagcu guggaccuua aucucaauca
9600gugcaaucca ccuagcagcu gugagagugg gugucagggu cucugcaaug guucagggug
9660acaaucaagc uauagccgug acaucaagag uaccuguagc ucagacuuac aagcagaaga
9720aaaaucaugu cuaugaggag aucaccaaau auuucggugc ucuaagacac gucauguuug
9780auguagggca cgagcuaaaa uugaacgaga ccaucauuag uagcaagaug uuugucuaua
9840guaaaaggau auacuaugau gggaagauuu uaccacagug ccugaaagcc uugaccaagu
9900guguauucug guccgagaca cugguagaug aaaacagauc ugcuuguucg aacaucucaa
9960cauccauagc aaaagcuauc gaaaaugggu auucuccuau acuaggcuac ugcauugcgu
10020uguauaagac cugucagcag gugugcauau cacuagggau gacuauaaau ccaacuauca
10080gcccgaccgu aagagaucaa uacuuuaagg guaagaauug gcugagaugu gcaguguuga
10140uuccagcaaa uguuggagga uucaacuaca ugucuacauc uagaugcuuu guuagaaaua
10200uuggagaccc cgcaguagca gcccuagcug aucucaaaag auucaucaga gcggaucugu
10260uagacaagca gguauuauac agggucauga aucaagaacc cggugacucu aguuuucuag
10320auugggcuuc agacccuuau ucguguaacc ucccgcauuc ucagaguaua acuacgauua
10380uaaagaauau cacugcuaga ucugugcugc aggaaucccc gaauccucua cugucugguc
10440ucuucaccga gacuagugga gaagaggauc ucaaccuggc cucguuccuu auggaccgga
10500aagucauccu gccgagagug gcucaugaga uccuggguaa uuccuuaacu ggaguuaggg
10560aggcgauugc agggaugcuu gauacgacca agucucuagu gagagccagc guuaggaaag
10620gaggauuauc auaugggaua uugaggaggc uugucaauua ugaucuauug caguacgaga
10680cacugacuag aacucucagg aaaccgguga aagacaacau cgaauaugag uauauguguu
10740caguugagcu agcugucggu cuaaggcaga aaauguggau ccaccugacu uacgggagac
10800ccauacaugg gcuagaaaca ccagacccuu uagagcucuu gaggggaaua uuuaucgaag
10860guucagaggu gugcaagcuu ugcaggucug aaggagcaga ccccaucuau acaugguucu
10920aucuuccuga cucuauagac cuggacacgc uuacaaacgg auguccggcu auaagaaucc
10980ccuauuuugg aucagccacu gaugaaaggu cggaagccca acucggguau guaagaaauc
11040uaagcaaacc cgcaaaggcg gccauccgga uagcuauggu guauacgugg gccuacggga
11100cugaugagau aucguggaug gaagccgcuc uuauagccca aacaagagcu aaucugagcu
11160uagagaaucu aaagcugcug acuccuguuu caaccuccac uaaucuaucu cauagguuga
11220aagauacggc aacccagaug aaguucucua gugcaacacu aguccgugca agucgguuca
11280uaacaauauc aaaugauaac auggcacuca aagaagcagg ggagucgaag gauacuaauc
11340ucguguauca gcagauuaug cuaacugggc uaagcuuguu cgaguucaau augagauaua
11400agaaagguuc cuuagggaag ccacugauau ugcacuuaca ucuuaauaac gggugcugua
11460uaauggaguc cccacaggag gcgaauaucc ccccaagguc cacauuagau uuagagauua
11520cacaagagaa caauaaauug aucuaugauc cugauccacu caaggaugug gaccuugagc
11580uauuuagcaa ggucagagau guuguacaca caguugacau gacuuauugg ucagaugaug
11640aaguuaucag agcaaccagu aucuguacug caaugacgau agcugauaca augucucaau
11700uagauagaga caacuuaaaa gagaugaucg cacuaguaaa ugacgaugau gucaacagcu
11760ugauuacuga guuuauggug auugauguuc cuuuauuuug cucaacguuc ggggguauuc
11820uagucaauca guuugcauac ucacucuacg gcuuaaacau cagaggaagg gaagaaauau
11880ggggacaugu aguccggauu cuuaaagaua ccucccacgc aguuuuaaaa gucuuaucua
11940augcucuauc ucaucccaaa aucuucaaac gauucuggaa ugcagguguc guggaaccug
12000uguaugggcc uaaccucuca aaucaggaua agauacucuu ggcccucucu gucugugaau
12060auucugugga ucuauucaug cacgauuggc aagggggugu accgcuugag aucuuuaucu
12120gugacaauga cccagaugug gccgacauga ggagguccuc uuucuuggca agacaucuug
12180cauaccuaug cagcuuggca gagauaucua gggaugggcc aagauuagaa ucaaugaacu
12240cucuagagag gcucgaguca cuaaagaguu accuggaacu cacauuucuu gaugacccgg
12300uacugaggua cagucaguug acuggccuag ucaucaaagu auucccaucu acuuugaccu
12360auauccggaa gucaucuaua aaaguguuaa ggacaagagg uauaggaguc ccugaagucu
12420uagaagauug ggaucccgag gcagauaaug cacuguuaga ugguaucgcg gcagaaauac
12480aacagaauau uccuuuggga caucagacua gagccccuuu uuggggguug agaguaucca
12540agucacaggu acugcgucuc cggggguaca aggagaucac aagaggugag auaggcagau
12600cagguguugg ucugacguua ccauucgaug gaagauaucu aucucaccag cugaggcucu
12660uuggcaucaa caguacuagc ugcuugaaag cacuugaacu uaccuaccua uugagccccu
12720uaguugacga agauaaagau aggcuauauu uaggggaagg agcuggggcc augcuuuccu
12780guuaugacgc uacucuuggc ccaugcauca acuauuauaa cucaggggua uacucuugug
12840augucaaugg gcagagagag uuaaauauau auccugcuga gguggcacua gugggaaaga
12900aauuaaacaa uguuacuagu cugggucaaa gaguuaaagu guuauucaac gggaauccug
12960gcucgacaug gauugggaau gaugagugug aggcuuugau uuggaaugaa uuacagaaua
13020gcucgauagg ccuaguccac ugugacaugg agggaggaga ucauaaggau gaucaaguug
13080uacugcauga gcauuacagu guaauccgga ucgcguaucu ggugggggau cgagacguug
13140ugcuuauaag caagauugcu cccaggcugg gcacggauug gaccaggcag cucagccuau
13200aucugagaua cugggacgag guuaaccuaa uagugcuuaa aacaucuaac ccugcuucca
13260cagagaugua ucuccuaucg aggcacccca aaucugacau uauagaggac agcaagacag
13320uguuagcuag ucuccucccu uugucaaaag aagauagcau caagauagaa aaguggaucu
13380uaauagagaa ggcaaaggcu cacgaauggg uuacucggga auugagagaa ggaagcucuu
13440caucagggau gcuuagaccu uaccaucaag cacugcagac guuuggcuuu gaaccaaacu
13500uguauaaauu gagcagagau uucuugucca ccaugaacau agcugauaca cacaacugca
13560ugauagcuuu caacaggguu uugaaggaua caaucuucga augggcuaga auaacugagu
13620cagauaaaag gcuuaaacua acugguaagu augaccugua uccugugaga gauucaggca
13680aguugaagac aauuucuaga agacuugugc uaucuuggau aucuuuaucu auguccacaa
13740gauugguaac ugggucauuc ccugaccaga aguuugaagc aagacuucaa uugggaauag
13800uuucauuauc aucccgugaa aucaggaacc ugaggguuau cacaaaaacu uuauuagaca
13860gguuugagga uauuauacau aguauaacgu auagauuccu caccaaagaa auaaagauuu
13920ugaugaagau uuuaggggca gucaagaugu ucggggccag gcaaaaugaa uacacgaccg
13980ugauugauga uggaucacua ggugauaucg agccauauga cagcucguaa uaauuagucc
14040cuaucgugca gaacgaucga agcuccgcgg uaccuggaag ucuuggacuu guccauauga
14100caauaguaag aaaaacuuac aagaagacaa gaaaauuuaa aaggauacau aucucuuaaa
14160cucuugucug gu
14172
User Contributions:
comments("1"); ?> comment_form("1"); ?>Inventors list |
Agents list |
Assignees list |
List by place |
Classification tree browser |
Top 100 Inventors |
Top 100 Agents |
Top 100 Assignees |
Usenet FAQ Index |
Documents |
Other FAQs |
User Contributions:
Comment about this patent or add new information about this topic: