Patent application title: MODIFIED CLOSTRIDIAL TOXINS WITH ENHANCED TRANSLOCATION CAPABILITY AND ENHANCED TARGETING ACTIVITY
Inventors:
Lance E. Steward (Irvine, CA, US)
Joseph Francis (Aliso Viejo, CA, US)
Ester G. Fernandez-Salas (Fullerton, CA, US)
Marcella A. Gilmore (Santa Ana, CA, US)
Shengwen Li (Irvine, CA, US)
Kei Roger Aoki (Coto De Caza, CA, US)
IPC8 Class: AC12N996FI
USPC Class:
435188
Class name: Chemistry: molecular biology and microbiology enzyme (e.g., ligases (6. ), etc.), proenzyme; compositions thereof; process for preparing, activating, inhibiting, separating, or purifying enzymes stablizing an enzyme by forming a mixture, an adduct or a composition, or formation of an adduct or enzyme conjugate
Publication date: 2013-08-08
Patent application number: 20130203148
Abstract:
The specification discloses modified Clostridial toxins comprising a
Clostridial toxin enzymatic domain, a Clostridial toxin translocation
domain, a translocation facilitating domain and an enhanced targeting
domain; polynucleotide molecules encoding such modified Clostridial
toxins; and method of producing such modified Clostridial toxins.Claims:
1. A modified Clostridial botulinum toxin comprising: a) a Clostridial
botulinum toxin type A enzymatic domain; b) a Clostridial botulinum toxin
type A translocation domain; c) a translocation facilitating domain
comprising an enveloped virus fusogenic peptide domain capable of
facilitating a translocation step of a Clostridial toxin intoxication
process; and, d) an enhanced targeting domain consisting essentially of a
modified Clostridial botulinum HCC targeting domain capable of
executing a cell binding step of a Clostridial botulinum toxin
intoxication process; wherein the modified Clostridial botulinum toxin
comprises a linear amino-to-carboxyl order of the Clostridial botulinum
toxin enzymatic domain, the Clostridial botulinum toxin translocation
domain, the translocation facilitating domain and the enhanced targeting
domain, and wherein the modified Clostridial botulinum HCC targeting
domain comprises a Clostridial botulinum serotype A NTNH β-fold and
exhibits enhanced binding activity for an endogenous Clostridial
botulinum toxin receptor relative to the binding activity of a
naturally-occurring Clostridial botulinum serotype A HCC targeting
domain.
2.-27. (canceled)
Description:
[0001] This Non-Provisional patent application claims priority pursuant to
35 U.S.C. §119(e) to U.S. Provisional Patent Application Ser. No.
60/807,063 filed Jul. 11, 2006, which is hereby incorporated by reference
in its entirety.
[0002] All patents and publications cited in this application are hereby incorporated by reference in their entirety.
[0003] The ability of Clostridial toxins, such as, e.g., Botulinum neurotoxins (BoNTs), BoNT/A, BoNT/B, BoNT/C1, BoNT/D, BoNT/E, BoNT/F and BoNT/G, and Tetanus neurotoxin (TeNT), to inhibit neuronal transmission are being exploited in a wide variety of therapeutic and cosmetic applications, see e.g., William J. Lipham, COSMETIC AND CLINICAL APPLICATIONS OF BOTULINUM TOXIN (Slack, Inc., 2004). Clostridial toxins commercially available as pharmaceutical compositions include, BoNT/A preparations, such as, e.g., BOTOX® (Allergan, Inc., Irvine, Calif.), Dysport®/Reloxin®, (Beaufour Ipsen, Porton Down, England), Linurase® (Prollenium, Inc., Ontario, Canada), Neuronox® (Medy-Tox, Inc., Ochang-myeon, South Korea) BTX-A (Lanzhou Institute Biological Products, China) and Xeomin® (Merz Pharmaceuticals, GmbH., Frankfurt, Germany); and BoNT/B preparations, such as, e.g., MyoBloc®/NeuroBloc® (Elan Pharmaceuticals, San Francisco, Calif.). As an example, BOTOX® is currently approved in one or more countries for the following indications: achalasia, adult spasticity, anal fissure, back pain, blepharospasm, bruxism, cervical dystonia, essential tremor, glabellar lines or hyperkinetic facial lines, headache, hemifacial spasm, hyperactivity of bladder, hyperhidrosis, juvenile cerebral palsy, multiple sclerosis, myoclonic disorders, nasal labial lines, spasmodic dysphonia, strabismus and VII nerve disorder.
[0004] Clostridial toxin therapies are successfully used for many indications. Generally, administration of a Clostridial toxin treatment is well tolerated. However, toxin administration in some applications can be challenging because of the larger doses required to achieve a beneficial effect. First, larger doses can increase the likelihood that the toxin may move through the interstitial fluids and the circulatory systems, such as, e.g., the cardiovascular system and the lymphatic system, of the body, resulting in the undesirable dispersal of the toxin to areas not targeted for toxin treatment. Such dispersal can lead to undesirable side effects, such as, e.g., inhibition of neurotransmitter release in neurons not targeted for treatment or paralysis of a muscle not targeted for treatment. For example, a patient administered a therapeutically effective amount of a BoNT/A treatment into the neck muscles for torticollis may develop dysphagia because of dispersal of the toxin into the oropharynx. Thus, there remains a need for improved Clostridial toxins that are effective at the site of treatment, but have negligible to minimal effects in areas not targeted for a toxin treatment.
[0005] Second, larger doses of a Clostridial toxin treatment may elicit an antibody response against the toxin. While a potent and effective treatment, the inhibition of neurotransmitter release and the resulting neuromuscular paralysis elicited by Clostridial toxin therapies is not permanent. The reversible nature of these paralytic effects requires periodic treatments in order to maintain the therapeutic benefits from this toxin. As a consequence of this repeated exposure, an immune response against a Clostridial toxin can occur in some patients which reduce or completely prevent the individual's responsiveness to further treatments, see, e.g., Joseph Jankovic, Botulinum toxin: Clinical Implications of Antigenicity and Immunoresistance, (SCIENTIFIC AND THERAPEUTIC ASPECTS OF BOTULINUM TOXIN, 409-415, Mitchell F. Brin et al., eds., Lippincott Williams & Wilkins, 2002); Dirk Dressler, Clinical Presentation and Management of Antibody-induced Failure of Botulinum Toxin Therapy, 19(Suppl. 8) Mov. DISORD. S92-S100 (2004); M. Zouhair Atassi, Basic Immunological Aspects of Botulinum Toxin Therapy, 19(Suppl. 8) Mov. DISORD. S68-S84, (2004). Thus, there remains a need for improved Clostridial toxins that maintain effective therapeutic benefits, but have reduced ability to evoke an immunogenic response against itself.
[0006] The growing clinical, therapeutic and cosmetic use of Clostridial toxins in therapies requiring larger doses necessitates the pharmaceutical industry to develop modified Clostridial toxins that are effective at the target site of the application, but reduce or prevent the undesirable side-effects associated with the dispersal of the toxins to unwanted locations and reduce or prevent an unwanted immunogenic response. One approach involves modifying a Clostridial toxin so that the modified toxin has an enhanced cell binding activity for a naturally-occurring Clostridial toxin receptor. This enhanced binding activity is achieved by modifying the endogenous targeting domain of a naturally-occurring Clostridial toxin in order to enhance a cell binding activity of the toxin for its naturally-occurring receptor. Such modifications to a targeting domain result in, e.g., a enhanced cell binding activity that increases binding affinity for an endogenous Clostridial toxin receptor present on a naturally-occurring Clostridial toxin target cell; an enhanced cell binding activity that increases binding specificity for a subgroup of endogenous Clostridial toxin receptors present on a naturally-occurring Clostridial toxin target cell; or an enhanced cell binding activity that increases both binding affinity and binding specificity. An added advantage is achieved when the targeting domain is derived from a human targeting domain polypeptide as these polypeptides as less likely to elicit an immunogenic response in a patient. A modified Clostridial toxin with an enhanced binding activity can bind to a receptor, translocate into the cytoplasm, and exert its proteolytic effect on the SNARE complex of the Clostridial toxin target cell.
[0007] Non-limiting examples of modified Clostridial toxins an enhanced cell binding activity for a naturally-occurring Clostridial toxin receptor are described in, e.g., Lance E. Steward, et al., Modified Clostridial Toxins with Enhanced Targeting Capabilities For Endogenous Clostridial Toxin Receptors, International Patent Application No. 2006/008956 (Mar. 14, 2006). This enhanced binding activity for a naturally occurring Clostridial toxin receptor allows for lower effective doses of a modified Clostridial toxin to be administered to an individual because more toxins will be delivered to the target cell. Thus, modified Clostridial toxins with an enhanced cell binding activity for a Clostridial toxin receptor will reduce the undesirable dispersal of the toxin to areas not targeted for treatment, thereby reducing or preventing the undesirable side-effects associated with diffusion of a Clostridial toxin to an unwanted location.
[0008] The present invention provides novel modified Clostridial toxins that reduce or prevent unwanted side-effects associated with toxin dispersal into non-targeted areas. These modified Clostridial toxins comprise, in part, a translocation facilitator domain that enhances the process by which a light chain from a modified toxin translocates into the cytoplasm of a target cell and enzymatically modify its target SNARE substrate. Thus modified Clostridial toxins with enhanced cell binding activity for its naturally-occurring receptor, such as, e.g., those disclosed in Steward, supra, (2006), comprising a translocation facilitator domain disclosed in the present specification, exhibit increased potency at the Clostridial toxin target cell and a concomitant reduction of unwanted side-effects associated with toxin dispersal into non-targeted areas. These and related advantages are useful for various clinical, therapeutic and cosmetic applications, such as, e.g., the treatment of neuromuscular disorders, neuropathic disorders, eye disorders, pain, muscle injuries, headache, cardiovascular diseases, neuropsychiatric disorders, endocrine disorders, cancers, otic disorders and hyperkinetic facial lines, as well as, other disorders where administration of a modified Clostridial toxin with enhanced cell binding activity for a Clostridial toxin receptor to an individual can produce a beneficial effect.
BRIEF DESCRIPTION OF THE DRAWINGS
[0009] FIG. 1 shows a schematic of the current paradigm of neurotransmitter release and Clostridial toxin intoxication in a central and peripheral neuron. FIG. 1A shows a schematic for the neurotransmitter release mechanism of a central and peripheral neuron. The release process can be described as comprising two steps: 1) vesicle docking, where the vesicle-bound SNARE protein of a vesicle containing neurotransmitter molecules associates with the membrane-bound SNARE proteins located at the plasma membrane; and 2) neurotransmitter release, where the vesicle fuses with the plasma membrane and the neurotransmitter molecules are exocytosed. FIG. 1B shows a schematic of the intoxication mechanism for tetanus and botulinum toxin activity in a central and peripheral neuron. This intoxication process can be described as comprising four steps: 1) receptor binding, where a Clostridial toxin binds to a Clostridial receptor and initiates the intoxication process; 2) complex internalization, where after toxin binding, a vesicle containing the toxin/receptor complex is endocytosed into the cell; 3) light chain translocation, where multiple events result in the release of the active light chain into the cytoplasm; and 4) enzymatic target modification, where the active light chain of Clostridial toxin proteolytically cleaves its target SNARE substrate, such as, e.g., SNAP-25, VAMP or Syntaxin, thereby preventing vesicle docking and neurotransmitter release.
[0010] FIG. 2 shows the domain organization of naturally-occurring Clostridial toxins. The single chain form depicts the amino to carboxyl linear organization comprising an enzymatic domain, a translocation domain, a HCN translocation facilitating domain and a HCC targeting domain. The di-chain loop region located between the translocation and enzymatic domains is depicted by the double SS bracket. This region comprises an endogenous di-chain loop protease cleavage site that upon proteolytic cleavage with a naturally-occurring protease, such as, e.g., an endogenous Clostridial toxin protease or a naturally-occurring protease produced in the environment, converts the single chain form of the toxin into the di-chain form. As depicted above the single-chain form, the HCC targeting domain comprises the β-trefoil domain which comprises in an amino to carboxyl linear organization of an α-fold, a β4/β5 hairpin turn, a β-fold, a β8/β9 hairpin turn and a γ-fold.
[0011] FIG. 3 shows a ribbon diagram of BoNT/A illustrating the modular three-dimensional structure of the light chain (LC) comprising the enzymatic domain, the heavy chain HN domain comprising the translocation domain, the heavy chain HCN domain comprising the translocation facilitating domain and the heavy chain HCC domain comprising the targeting domain.
[0012] FIG. 4 shows modified Clostridial toxins with an enhanced translocation capability and an enhanced targeting activity located at the amino terminus of the modified toxin. FIG. 4A depicts the single polypeptide form of a modified Clostridial toxin with an amino to carboxyl linear organization comprising an enhanced targeting domain, a translocation domain, a translocation facilitating domain and an enzymatic domain, with the di-chain loop region depicted by the double SS bracket. A proteolytic cleavage site (P) within a di-chain loop region is located between the translocation facilitating and enzymatic domains. Upon proteolytic cleavage with a P protease, the single chain form of the toxin is converted to the di-chain form. The P protease site can be a Clostridial toxin endogenous protease cleavage site or a non-Clostridial toxin exogenous protease cleavage site. Spacers can be placed between the targeting and translocation domains, the translocation and translocation facilitating domains, translocation facilitating and enzymatic domains or any combination thereof. FIG. 4B depicts the single polypeptide form of a modified Clostridial toxin with an amino to carboxyl linear organization comprising an enhanced targeting domain, an enzymatic domain, a translocation domain and a translocation facilitating domain, with the di-chain loop region depicted by the double SS bracket. A proteolytic cleavage site (P) within a di-chain loop region is located between the enzymatic and translocation domains. Upon proteolytic cleavage with a P protease, the single chain form of the toxin is converted to the di-chain form. The P protease site can be a Clostridial toxin endogenous protease cleavage site or a non-Clostridial toxin exogenous protease cleavage site. Spacers can be placed between the targeting and enzymatic domains, the enzymatic and translocation domains, translocation and translocation facilitating domains or any combination thereof.
[0013] FIG. 5 shows modified Clostridial toxins with an enhanced translocation capability and an enhanced targeting activity located between the two other domains. FIG. 5A depicts the single polypeptide form of a modified Clostridial toxin with an amino to carboxyl linear organization comprising an enzymatic domain, an enhanced targeting domain, a translocation domain and a translocation facilitating domain, with the di-chain loop region depicted by the double SS bracket. A proteolytic cleavage site (P) within a di-chain loop region is located between the enzymatic and targeting domains. Upon proteolytic cleavage with a P protease, the single chain form of the toxin is converted to the di-chain form. The P protease site can be a Clostridial toxin endogenous protease cleavage site or a non-Clostridial toxin exogenous protease cleavage site. Spacers can be placed between the enzymatic and targeting domains, the targeting and translocation domains, the translocation and translocation facilitating domains or any combination thereof. FIG. 5B depicts the single polypeptide form of a modified Clostridial toxin with an amino to carboxyl linear organization comprising a translocation domain, a translocation facilitating domain, an enhanced targeting domain and an enzymatic domain, with the di-chain loop region depicted by the double SS bracket. A proteolytic cleavage site (P) within a di-chain loop region is located between the translocation facilitating and targeting domains. Upon proteolytic cleavage with a P protease, the single chain form of the toxin is converted to the di-chain form. The P protease site can be a Clostridial toxin endogenous protease cleavage site or a non-Clostridial toxin exogenous protease cleavage site. Spacers can be placed between the translocation and translocation facilitating domains, the translocation facilitating and targeting domains, the targeting and enzymatic domains or any combination thereof.
[0014] FIG. 6 shows modified Clostridial toxins with an enhanced translocation capability and an enhanced targeting activity located at the carboxyl terminus of the modified toxin. FIG. 6A depicts the single polypeptide form of a modified Clostridial toxin with an amino to carboxyl linear organization comprising an enzymatic domain, a translocation domain, a translocation facilitating domain and an enhanced targeting domain, with the di-chain loop region depicted by the double SS bracket. A proteolytic cleavage site (P) within a di-chain loop region is located between the enzymatic and translocation domains. Upon proteolytic cleavage with a P protease, the single chain form of the toxin is converted to the di-chain form. The P protease site can be a Clostridial toxin endogenous protease cleavage site or a non-Clostridial toxin exogenous protease cleavage site. Spacers can be placed between the enzymatic and translocation domains, the translocation and translocation facilitating domains, the translocation facilitating and targeting domains or any combination thereof. FIG. 6B depicts the single polypeptide form of a modified Clostridial toxin with an amino to carboxyl linear organization comprising a translocation domain, a translocation facilitating domain, an enzymatic domain and an enhanced targeting domain, with the di-chain loop region depicted by the double SS bracket. A proteolytic cleavage site (P) within a di-chain loop region is located between the translocation facilitating and enzymatic domains. Upon proteolytic cleavage with a P protease, the single chain form of the toxin is converted to the di-chain form. The P protease site can be a Clostridial toxin endogenous protease cleavage site or a non-Clostridial toxin exogenous protease cleavage site. Spacers can be placed between the translocation and translocation facilitating domains, the translocation facilitating and enzymatic domains, the enzymatic and targeting domains or any combination thereof.
[0015] FIG. 7 shows a ribbon diagram of BoNT/A illustrating the boundary regions of the HCN domain comprising the translocation facilitating domain. FIG. 7A depicts the amino-terminal boundary region. FIG. 7B depicts the carboxyl-terminal boundary region.
DETAILED DESCRIPTION
[0016] Clostridia toxins produced by Clostridium botulinum, Clostridium tetani, Clostridium baratii and Clostridium butyricum are the most widely used in therapeutic and cosmetic treatments of humans and other mammals. Strains of C. botulinum produce seven antigenically-distinct types of Botulinum toxins (BoNTs), which have been identified by investigating botulism outbreaks in man (BoNT/A, /B, /E and /F), animals (BoNT/C1 and /D), or isolated from soil (BoNT/G). While all seven botulinum toxins (BoNT) serotypes have similar structure and pharmacological properties, each also displays heterogeneous bacteriological characteristics. In contrast, tetanus toxin (TeNT) is produced by a uniform group of C. tetani. Two other species of Clostridia, C. baratii and C. butyricum, also produce toxins similar to BoNT/F and BoNT/E, respectively.
[0017] Clostridia toxins possess approximately 35% amino acid identity with each other and share the same functional domain organization and overall structural architecture. Clostridial toxins are each translated as a single chain polypeptide of approximately 150 kDa that is subsequently cleaved by proteolytic scission within a disulfide loop by a naturally-occurring protease, such as, e.g., an endogenous Clostridial toxin protease or a naturally-occurring protease produced in the environment (FIG. 2). This posttranslational processing yields a di-chain molecule comprising an approximately 50 kDa light chain (LC) and an approximately 100 kDa heavy chain (HC) held together by a single disulfide bond and noncovalent interactions. It is widely held that the mature di-chain molecule comprises three functionally distinct domains: 1) an enzymatic domain located in the LC that includes a metalloprotease region containing a zinc-dependent endopeptidase activity which specifically targets core components of the neurotransmitter release apparatus (Table 1); 2) a translocation domain contained within the amino-terminal half of the heavy chain (HN domain) that facilitates release of the LC from intracellular vesicles into the cytoplasm of the target cell (Table 1); and 3) a binding domain found within the carboxyl-terminal half of the heavy chain (HC domain) that determines the binding activity and binding specificity of the toxin to the receptor complex located at the surface of the target cell (Table 1), see, e.g., Kathryn Turton et al., Botulinum and Tetanus Neurotoxins: Structure, Function and Therapeutic Utility, 27(11) Trends Biochem. Sci. 552-558. (2002); John A. Chaddock and P. M. H. Marks, Clostridial Neurotoxins: Structure-Function Led Design of New Therapeutics, 63(5) Cell. Mol. Life. Sci. 540-551 (2006); and Keith Foster et al., Re-engineering the Target Specificity of Clostridial Neurotoxins--A Route To Novel Therapeutics, 9(2-3) Neurotox Res. 101-107 (2006).
TABLE-US-00001 TABLE 1 Clostridial Toxin Reference Sequences and Regions SEQ HC Toxin ID NO: LC HN HCN HCC BoNT/A 1 M1-K448 A449-I873 I874-P1110 Y1111-L1296 BoNT/B 2 M1-K441 A442-I860 L861-E1097 Y1098-E1291 BoNT/C1 3 M1-K449 T450-I868 N869-E1111 Y1112-E1291 BoNT/D 4 M1-R445 D446-I864 N865-E1098 Y1099-E1276 BoNT/E 5 M1-R422 K423-I847 K848-E1085 Y1086-K1252 BoNT/F 6 M1-K439 A440-I866 K867-K1105 Y1106-E1274 BoNT/G 7 M1-K446 S447-I865 S866-Q1105 Y1106-E1297 TeNT 8 M1-A457 S458-L881 K882-E1127 Y1128-D1315
[0018] The binding, translocation and enzymatic activities of a Clostridial toxin are all necessary to execute the overall cellular intoxication mechanism whereby Clostridial toxins enter a neuron and inhibit neurotransmitter release is similar, regardless of serotype or subtype. The current paradigm describes the intoxication mechanism as comprising at least four steps: 1) receptor binding, 2) complex internalization, 3) light chain translocation, and 4) enzymatic target modification (see FIG. 1). The process is initiated when the HC domain of a Clostridial toxin binds to a toxin-specific receptor located on the plasma membrane surface of a target cell. The binding specificity of a receptor complex is thought to be achieved, in part, by specific combinations of gangliosides and protein receptors that appear to distinctly comprise each Clostridial toxin receptor complex. Once bound, the toxin/receptor complexes are internalized by endocytosis and the internalized vesicles are sorted to specific intracellular routes. The translocation step, now thought to be mediated by the HN domain and further facilitated by the HCN domain, appears to be triggered by the acidification of the vesicle compartment. This process seems to initiate two important pH-dependent structural rearrangements that increase hydrophobicity and promote separation of the light chain from the heavy chain of the toxin. Once activated, light chain endopeptidase of the toxin is released from the intracellular vesicle into the cytosol where it appears to specifically target one of three known core components of the neurotransmitter release apparatus. These core proteins, vesicle-associated membrane protein (VAMP)/synaptobrevin, synaptosomal-associated protein of 25 kDa (SNAP-25) and Syntaxin, are necessary for synaptic vesicle docking and fusion at the nerve terminal and constitute members of the soluble N-ethylmaleimide-sensitive factor-attachment protein-receptor (SNARE) family. BoNT/A and BoNT/E cleave SNAP-25 in the carboxyl-terminal region, releasing a nine or twenty-six amino acid segment, respectively, and BoNT/C1 also cleaves SNAP-25 near the carboxyl-terminus. The botulinum serotypes BoNT/B, BoNT/D, BoNT/F and BoNT/G, and tetanus toxin, act on the conserved central portion of VAMP, and release the amino-terminal portion of VAMP into the cytosol. BoNT/C1 cleaves syntaxin at a single site near the cytosolic membrane surface. The selective proteolysis of synaptic SNAREs accounts for the block of neurotransmitter release caused by Clostridial toxins in vivo. The SNARE protein targets of Clostridial toxins are common to exocytosis in a variety of non-neuronal types; in these cells, as in neurons, light chain peptidase activity inhibits exocytosis, see, e.g., Yann Humeau et al., How Botulinum and Tetanus Neurotoxins Block Neurotransmitter Release, 82(5) Biochimie. 427-446 (2000); and Giovanna Lalli et al., The Journey of Tetanus and Botulinum Neurotoxins in Neurons, 11(9) Trends Microbiol. 431-437, (2003).
[0019] The three-dimensional crystal structures of BoNT/A, BoNT/B and the HC domain of TeNT indicate that the three functional domains of Clostridial neurotoxins are structurally distinct. The HEXXH consensus motif of the light chain forms the tetrahedral zinc binding pocket of the catalytic site located in a deep cleft on the protein surface that is accessible by a channel. The structure of the HN and HC domains consists primarily of β-sheet topologies that are linked by a single α-helix. The cylindrical-shaped HN domain comprises two long amphipathic α-helices that resemble the coiled-coil motif found in some viral proteins. The HN domain also forms a long unstructured loop called the `translocation belt,` which wraps around a large negatively charged cleft of the light chain that blocks access of the zinc atom to the catalytic-binding pocket of active site. The HC domain comprises two distinct structural features of roughly equal size that indicate function. The first, designated the HCN domain, is located in the amino half of the HC domain. The HCN domain forms a β-barrel, jelly-roll fold. The HCC domain is the second domain that comprises the HC domain. This carboxyl-terminal domain comprises a modified β-trefoil domain which forms three distinct carbohydrate binding regions that resembles the carbohydrate binding moiety found in many sugar-binding proteins, such as, e.g., serum amyloid P, sialidase, cryia, insecticidal δ-endotoxin and lectins. Biochemical studies indicate that the β-trefoil domain structure of the HCC domain appears to mediate the binding to specific carbohydrate containing components of the Clostridial toxin receptor on the cell surface, see, e.g., Krzysztof Ginalski et al., Structure-based Sequence Alignment for the Beta-Trefoil Subdomain of the Clostridial Neurotoxin Family Provides Residue Level Information About the Putative Ganglioside Binding Site, 482(1-2) FEBS Lett. 119-124 (2000). The HC domain tilts away from the HN domain exposing the surface loops and making them accessible for binding. No contacts occur between the light chain and the HC domain.
[0020] We know that only the HCC domain participates in receptor binding because the β-trefoil domains are restricted to this domain. Proteins containing the structural β-trefoil domain represents a diverse group of proteins organized into at least eight superfamilies including the cytokines, MIR domain proteins, Ricin B-like lectins, agglutinins, Soybean trypsin inhibitor like proteins, Actin-crosslinking proteins, LAG-1 proteins and AbfB domain proteins, see, e.g., C. A. Orengo et al., Protein Superfamilies and Domain Superfolds, 372 Nature 631-634 (1994); and Alexey G. Murzin et al., SCOP: A Structural Classification of Proteins Database for the Investigation of Sequences and Structures, 247(4) J. Mol. Biol. 536-540 (1995). While having diverse cellular roles, members of these superfamilies mechanistically function via protein-protein associations through the β-trefoil domain. Of particular interest is the fact that many of these members are specifically involved in receptor interactions, including, e.g., the cytokine superfamily members Fibroblast Growth Factors (FGFs) and the Interleukin-1s (IL-1s); the Ricin B-like lectins; the agglutinins; and STI-like members the Kunitz inhibitors and Clostridium neurotoxins. That only the HCC domain alone mediates the cell binding step of intoxication is further supported by the finding that mutations that disrupt the receptor binding activity of Clostridial toxins have been confined to the HCC domain, see, e.g., Andreas Rummel et al., The HCC-Domain of Botulinum Neurotoxins A and B Exhibits a Singular Ganglioside Binding Site Displaying Serotype Specific Carbohydrate Interaction, 51β) Mol. Microbiol. 631-643 (2004).
[0021] Because the HCC domain appears not only necessary, but sufficient for selective binding of a Clostridial toxin to its receptor, we have deduced that the primary function of the HCN domain of Clostridial toxins is involved in the translocation step of the intoxication process, and not in the cell binding step, because the lack of HCN domain appears to reduce intoxication efficiency. For example, a modified BoNT/A comprising a Substance P targeting domain was inefficient in intoxicating its corresponding target cells. In this modified toxin, the entire BoNT/A HC domain, comprising both the BoNT/A HCC domain and the BoNT/A HCN domain, was replaced by the Substance P targeting domain. Likewise, we have determined that several other modified Clostridial toxins that have replaced the entire BoNT/A He domain with an exogenous targeting domain have exhibited reduced intoxication capabilities. Thus, the HCN domain possess a translocation facilitating function because 1) HCC domain primarily mediates the receptor binding step of the intoxication process; 2) modified Clostridial toxins lacking the HCN domain exhibit a reduced ability to translocate into the cytoplasm as evident by such modified toxins exhibiting decreased proteolysis of their SNARE substrates; and 3) the LC domain mediates the enzymatic activity of the toxin. While the exact translocation facilitating mechanism of the HCN domain is currently not understood, the HCN domain may 1) participate in the formation of an endosomal pore; 2) mediate the insertion of the pore into a vesicle membrane; 3) assist in the delivery of LC across the endosomal membrane and/or 4) serve as a structural scaffold or spacer that facilitates the appropriate orientation a the targeting domain in relationship to the translocation domain. In this last point, the HCN domain would serve to orient the translocation domain to facilitate the proper presentation of the translocation domain for insertion into the membrane following binding of the ligand by the receptor. This novel role of the HCN domain in the translocation step is contrary to the widely accepted view that the Clostridial toxin HCN domain played an integral role in the cell binding step of the intoxication process.
[0022] Thus, the present invention discloses modified Clostridial toxins that exhibit 1) an enhanced translocation capability; and 2) an enhanced targeting capability for a naturally-occurring Clostridial toxin receptor. The enhanced translocation capability is mediated by a translocation facilitating domain comprising, e.g., a HCN region of Clostridial toxins. The HCN domain enhances the process by which the HN domain mediates the release of the light chain from internalized intracellular vesicles into the cytoplasm of the target cell during the translocation step. Enhanced translocation capability is obtained by including or maintaining a Clostridial toxin HCN domain in a modified Clostridial toxin disclosed in the present specification. The enhanced targeting capability for a naturally-occurring Clostridial toxin receptor is mediated by an enhanced targeting domain comprising a modified HCC targeting domain of Clostridial toxins. The HCC domain primarily determines the binding activity and binding specificity of the toxin to the receptor complex located at the surface of the target cell. Enhanced binding activity is achieved by replacing the endogenous HCC targeting domain of a Clostridial toxin with a targeting domain showing enhanced binding activity for a Clostridial toxin receptor present on a naturally-occurring Clostridial toxin target cell.
[0023] Both the enhanced translocation and enhanced targeting activity should allow lower effective doses of a modified Clostridial toxin to be administered to an individual because more toxin will be delivered to a target cell. Thus modified Clostridial toxins with enhanced translocation and binding capabilities will reduce the undesirable dispersal of the toxin to areas not targeted for treatment, thereby reducing or preventing the undesirable side-effects associated with diffusion of a Clostridial toxin to an unwanted location.
[0024] Thus, aspects of the present invention provide modified Clostridial toxins comprising a Clostridial toxin enzymatic domain, a Clostridial toxin translocation domain, a translocation facilitating domain and an enhanced targeting domain, wherein the modified Clostridial toxin exhibits an enhanced targeting activity for a Clostridial toxin receptor as compared to a naturally-occurring Clostridial toxin. It is envisioned that any translocation facilitating domain capable of further facilitating the translocation step of the intoxication process where the light chain is released from intracellular vesicles into the cytoplasm of the target cell will be useful to practice aspects of the present invention, including, without limitation, a Clostridial toxin translocation facilitating domain and an enveloped virus fusogenic peptide domain. Likewise, a multitude of enhanced targeting domains are envisioned, including, without limitation, a modified Clostridial toxin targeting domain with enhanced binding activity, such as, e.g., a BoNT/A targeting domain with enhanced binding activity, a BoNT/B targeting domain with enhanced binding activity, a BoNT/C1 targeting domain with enhanced binding activity, a BoNT/D targeting domain with enhanced binding activity, a BoNT/E targeting domain with enhanced binding activity, a BoNT/F targeting domain with enhanced binding activity, a BoNT/G targeting domain with enhanced binding activity, a TeNT targeting domain with enhanced binding activity, or active fragment thereof; a Clostridial NAP, such as, e.g., a Clostridial botulinum serotype A HA-33, a Clostridial botulinum serotype B HA-33, a Clostridial botulinum serotype C1 HA-33, a Clostridial botulinum serotype D HA-33, a Clostridial botulinum serotype A HA-17, a Clostridial botulinum serotype B HA-17, a Clostridial botulinum serotype C1 HA-17, a Clostridial botulinum serotype D HA-17, a Clostridial botulinum serotype A NTNH, a Clostridial botulinum serotype B NTNH, a Clostridial botulinum serotype C1 NTNH, a Clostridial botulinum serotype D NTNH, a Clostridial botulinum serotype E NTNH, a Clostridial botulinum serotype F NTNH and a Clostridial botulinum serotype G NTNH; and a FGF, such as, e.g., a FGF-1, a FGF-2, a FGF-4, a FGF-8, a FGF-9, a FGF-17 and a FGF-18. It is also envisioned that the location of the enhanced targeting domain in the modified Clostridial toxins of the present specification can be located at the amino terminus of the toxin, between the enzymatic and translocation domains or at the carboxyl terminus of the toxin. Thus, a modified Clostridial toxins disclosed in the present specification can comprise an amino to carboxyl domain arrangement of, e.g., an enhanced targeting domain, a Clostridial toxin translocation domain, a translocation facilitating domain and a Clostridial toxin enzymatic domain; an enhanced targeting domain, a Clostridial toxin enzymatic domain, a Clostridial toxin translocation domain and a translocation facilitating domain; a Clostridial toxin enzymatic domain, an enhanced targeting domain, a Clostridial toxin translocation domain and a translocation facilitating domain; a Clostridial toxin translocation domain, a translocation facilitating domain, an enhanced targeting domain and a Clostridial toxin enzymatic domain; a Clostridial toxin enzymatic domain, a Clostridial toxin translocation domain, a translocation facilitating domain and an enhanced targeting domain; and a Clostridial toxin translocation domain, a translocation facilitating domain, a Clostridial toxin enzymatic domain and an enhanced targeting domain.
[0025] Other aspects of the present invention provide polynucleotide molecules encoding modified Clostridial toxins comprising a Clostridial toxin enzymatic domain, a Clostridial toxin translocation domain, a translocation facilitating domain and an enhanced targeting domain, wherein the modified Clostridial toxin exhibits an enhanced targeting activity for a Clostridial toxin receptor as compared to a naturally-occurring Clostridial toxin. It is envisioned that the location of the enhanced targeting domain of the modified Clostridial toxins encoded by polynucleotide molecules of the present specification can be located at the amino terminus of the toxin, between the enzymatic and translocation domains or at the carboxyl terminus of the toxin.
[0026] Other aspects of the present invention provide methods of producing a modified Clostridial toxin disclosed in the present specification, the method comprising the step of expressing in a cell a polynucleotide molecule encoding a modified Clostridial toxin comprising a Clostridial toxin enzymatic domain, a Clostridial toxin translocation domain, a translocation facilitating domain and an enhanced targeting domain, wherein the modified Clostridial toxin exhibits an enhanced targeting activity for a Clostridial toxin receptor as compared to a naturally-occurring Clostridial toxin. Other aspects of the present invention provide methods of producing a modified Clostridial toxin disclosed in the present specification, the method comprising the steps of introducing in a cell an expression construct comprising a polynucleotide molecule encoding a modified Clostridial toxin comprising a Clostridial toxin enzymatic domain, a Clostridial toxin translocation domain, a translocation facilitating domain and an enhanced targeting domain, wherein the modified Clostridial toxin exhibits an enhanced targeting activity for a Clostridial toxin receptor as compared to a naturally-occurring Clostridial toxin and expressing the expression construct in the cell.
[0027] Aspects of the present invention provide, in part, a modified Clostridial toxin. As used herein, the term "modified Clostridial toxin" means any polypeptide that can execute the overall cellular mechanism whereby a Clostridial toxin enters a neuron and inhibits neurotransmitter release and encompasses the binding of a Clostridial toxin to a low or high affinity receptor complex, the internalization of the toxin, the translocation of the Clostridial toxin light chain into the cytoplasm and the enzymatic modification of a Clostridial toxin substrate. A modified Clostridial toxin disclosed in the present specification is distinguished from a naturally-occurring Clostridial toxin by the fact that a modified Clostridial toxin comprises a translocation facilitating domain that enhances the process by which a light chain from a modified toxin translocates into the cytoplasm of a target cell and a modified Clostridial toxin lacks the cell binding activity of a naturally-occurring binding domain found in a Clostridial toxin. Instead, a modified Clostridial toxin disclosed in the present specification comprises an enhanced targeting domain that determines the binding activity of the modified Clostridial toxin to an endogenous Clostridial toxin receptor located at the surface of the target cell. By definition, a naturally-occurring Clostridial toxin lacks an enhanced targeting domain. Examples of modified Clostridial toxin are described in, e.g., Lance E. Steward, et al., Modified Clostridial Toxins with Enhanced Targeting Capabilities For Endogenous Clostridial Toxin Receptor Systems, International Patent Application No. 2006/008956 (Mar. 14, 2006). Any of the modified Clostridial toxins described in, e.g., Steward, supra, (Mar. 14, 2006), can be further modified to include a translocation facilitating domain as disclosed in the present specification.
[0028] Aspects of the present invention provide, in part, a Clostridial toxin enzymatic domain. As used herein, the term "Clostridial toxin enzymatic domain" means any Clostridial toxin polypeptide that can execute the enzymatic target modification step of the intoxication process. Thus, a Clostridial toxin enzymatic domain specifically targets a Clostridial toxin substrate and encompasses the proteolytic cleavage of a Clostridial toxin substrate, such as, e.g., SNARE proteins like a SNAP-25 substrate, a VAMP substrate and a Syntaxin substrate. Non-limiting examples of a Clostridial toxin enzymatic domain include, e.g., a Clostridial toxin light chain region such as, e.g., a BoNT/A light chain region, a BoNT/B light chain region, a BoNT/C1 light chain region, a BoNT/D light chain region, a BoNT/E light chain region, a BoNT/F light chain region, a BoNT/G light chain region, and a TeNT light chain region.
[0029] A Clostridial toxin enzymatic domain includes, without limitation, naturally occurring Clostridial toxin light chain variants, such as, e.g., Clostridial toxin light chain isoforms and Clostridial toxin light chain subtypes; non-naturally occurring Clostridial toxin light chain variants, such as, e.g., conservative Clostridial toxin light chain variants, non-conservative Clostridial toxin light chain variants, Clostridial toxin light chain chimerics, active Clostridial toxin light chain fragments thereof, or any combination thereof.
[0030] As used herein, the term "Clostridial toxin light chain variant," whether naturally-occurring or non-naturally-occurring, means a Clostridial toxin light chain that has at least one amino acid change from the corresponding region of the disclosed reference sequences (see Table 1) and can be described in percent identity to the corresponding region of that reference sequence. Unless expressly indicated, all Clostridial toxin light chain variants disclosed in the present specification are capable of executing the enzymatic target modification step of the intoxication process. As non-limiting examples, a BoNT/A light chain variant comprising amino acids 1-448 of SEQ ID NO: 1 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1-448 of SEQ ID NO: 1; a BoNT/B light chain variant comprising amino acids 1-441 of SEQ ID NO: 2 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1-441 of SEQ ID NO: 2; a BoNT/C1 light chain variant comprising amino acids 1-449 of SEQ ID NO: 3 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1-449 of SEQ ID NO: 3; a BoNT/D light chain variant comprising amino acids 1-445 of SEQ ID NO: 4 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1-445 of SEQ ID NO: 4; a BoNT/E light chain variant comprising amino acids 1-422 of SEQ ID NO: 5 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1-422 of SEQ ID NO: 5; a BoNT/F light chain variant comprising amino acids 1-439 of SEQ ID NO: 6 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1-439 of SEQ ID NO: 6; a BoNT/G light chain variant comprising amino acids 1-446 of SEQ ID NO: 7 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1-446 of SEQ ID NO: 7; and a TeNT light chain variant comprising amino acids 1-457 of SEQ ID NO: 8 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1-457 of SEQ ID NO: 8.
[0031] It is recognized by those of skill in the art that within each serotype of Clostridial toxin there can be naturally occurring Clostridial toxin light chain variants that differ somewhat in their amino acid sequence, and also in the nucleic acids encoding these proteins. For example, there are presently four BoNT/A subtypes, BoNT/A1, BoNT/A2, BoNT/A3 and BoNT/A4, with specific light chain subtypes showing approximately 95% amino acid identity when compared to another BoNT/A light chain subtype. As used herein, the term "naturally occurring Clostridial toxin light chain variant" means any Clostridial toxin light chain produced by a naturally-occurring process, including, without limitation, Clostridial toxin light chain isoforms produced from alternatively-spliced transcripts, Clostridial toxin light chain isoforms produced by spontaneous mutation and Clostridial toxin light chain subtypes. A naturally occurring Clostridial toxin light chain variant can function in substantially the same manner as the reference Clostridial toxin light chain on which the naturally occurring Clostridial toxin light chain variant is based, and can be substituted for the reference Clostridial toxin light chain in any aspect of the present invention. A naturally occurring Clostridial toxin light chain variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, ten or more amino acids, 20 or more amino acids, 30 or more amino acids, 40 or more amino acids, 50 or more amino acids or 100 or more amino acids from the reference Clostridial toxin light chain on which the naturally occurring Clostridial toxin light chain variant is based. A naturally occurring Clostridial toxin light chain variant can also substitute at least 10 contiguous amino acids, at least 15 contiguous amino acids, at least 20 contiguous amino acids, or at least 25 contiguous amino acids from the reference Clostridial toxin light chain on which the naturally occurring Clostridial toxin light chain variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference Clostridial toxin light chain on which the naturally occurring Clostridial toxin light chain variant is based.
[0032] A non-limiting examples of a naturally occurring Clostridial toxin light chain variant is a Clostridial toxin light chain isoform such as, e.g., a BoNT/A light chain isoform, a BoNT/B light chain isoform, a BoNT/C1 light chain isoform, a BoNT/D light chain isoform, a BoNT/E light chain isoform, a BoNT/F light chain isoform, a BoNT/G light chain isoform, and a TeNT light chain isoform. A Clostridial toxin light chain isoform can function in substantially the same manner as the reference Clostridial toxin light chain on which the Clostridial toxin light chain isoform is based, and can be substituted for the reference Clostridial toxin light chain in any aspect of the present invention.
[0033] Another non-limiting examples of a naturally occurring Clostridial toxin light chain variant is a Clostridial toxin light chain subtype such as, e.g., a light chain from subtype BoNT/A1, BoNT/A2, BoNT/A3 and BoNT/A4; a light chain from subtype BoNT/B1, BoNT/B2, BoNT/B bivalent and BoNT/B nonproteolytic; a light chain from subtype BoNT/C1-1 and BoNT/C1-2; a light chain from subtype BoNT/E1, BoNT/E2 and BoNT/E3; and a light chain from subtype BoNT/F1, BoNT/F2, BoNT/F3 and BoNT/F4. A Clostridial toxin light chain subtype can function in substantially the same manner as the reference Clostridial toxin light chain on which the Clostridial toxin light chain subtype is based, and can be substituted for the reference Clostridial toxin light chain in any aspect of the present invention.
[0034] As used herein, the term "non-naturally occurring Clostridial toxin light chain variant" means any Clostridial toxin light chain produced with the aid of human manipulation, including, without limitation, Clostridial toxin light chains produced by genetic engineering using random mutagenesis or rational design and Clostridial toxin light chains produced by chemical synthesis. Non-limiting examples of non-naturally occurring Clostridial toxin light chain variants include, e.g., conservative Clostridial toxin light chain variants, non-conservative Clostridial toxin light chain variants, Clostridial toxin light chain chimeric variants and active Clostridial toxin light chain fragments.
[0035] As used herein, the term "conservative Clostridial toxin light chain variant" means a Clostridial toxin light chain that has at least one amino acid substituted by another amino acid or an amino acid analog that has at least one property similar to that of the original amino acid from the reference Clostridial toxin light chain sequence (Table 1). Examples of properties include, without limitation, similar size, topography, charge, hydrophobicity, hydrophilicity, lipophilicity, covalent-bonding capacity, hydrogen-bonding capacity, a physicochemical property, of the like, or any combination thereof. A conservative Clostridial toxin light chain variant can function in substantially the same manner as the reference Clostridial toxin light chain on which the conservative Clostridial toxin light chain variant is based, and can be substituted for the reference Clostridial toxin light chain in any aspect of the present invention. A conservative Clostridial toxin light chain variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, ten or more amino acids, 20 or more amino acids, 30 or more amino acids, 40 or more amino acids, 50 or more amino acids, 100 or more amino acids or 200 or more amino acids from the reference Clostridial toxin light chain on which the conservative Clostridial toxin light chain variant is based. A conservative Clostridial toxin light chain variant can also substitute at least 10 contiguous amino acids, at least 15 contiguous amino acids, at least 20 contiguous amino acids, or at least 25 contiguous amino acids from the reference Clostridial toxin light chain on which the conservative Clostridial toxin light chain variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference Clostridial toxin light chain on which the conservative Clostridial toxin light chain variant is based. Non-limiting examples of a conservative Clostridial toxin light chain variant include, e.g., conservative BoNT/A light chain variants, conservative BoNT/B light chain variants, conservative BoNT/C1 light chain variants, conservative BoNT/D light chain variants, conservative BoNT/E light chain variants, conservative BoNT/F light chain variants, conservative BoNT/G light chain variants, and conservative TeNT light chain variants.
[0036] As used herein, the term "non-conservative Clostridial toxin light chain variant" means a Clostridial toxin light chain in which 1) at least one amino acid is deleted from the reference Clostridial toxin light chain on which the non-conservative Clostridial toxin light chain variant is based; 2) at least one amino acid added to the reference Clostridial toxin light chain on which the non-conservative Clostridial toxin light chain is based; or 3) at least one amino acid is substituted by another amino acid or an amino acid analog that does not share any property similar to that of the original amino acid from the reference Clostridial toxin light chain sequence (Table 1). A non-conservative Clostridial toxin light chain variant can function in substantially the same manner as the reference Clostridial toxin light chain on which the non-conservative Clostridial toxin light chain variant is based, and can be substituted for the reference Clostridial toxin light chain in any aspect of the present invention. A non-conservative Clostridial toxin light chain variant can delete one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, and ten or more amino acids from the reference Clostridial toxin light chain on which the non-conservative Clostridial toxin light chain variant is based. A non-conservative Clostridial toxin light chain variant can add one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, and ten or more amino acids to the reference Clostridial toxin light chain on which the non-conservative Clostridial toxin light chain variant is based. A non-conservative Clostridial toxin light chain variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, ten or more amino acids, 20 or more amino acids, 30 or more amino acids, 40 or more amino acids, 50 or more amino acids, 100 or more amino acids or 200 or more amino acids from the reference Clostridial toxin light chain on which the non-conservative Clostridial toxin light chain variant is based. A non-conservative Clostridial toxin light chain variant can also substitute at least 10 contiguous amino acids, at least 15 contiguous amino acids, at least 20 contiguous amino acids, or at least 25 contiguous amino acids from the reference Clostridial toxin light chain on which the non-conservative Clostridial toxin light chain variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference Clostridial toxin light chain on which the non-conservative Clostridial toxin light chain variant is based. Non-limiting examples of a non-conservative Clostridial toxin light chain variant include, e.g., non-conservative BoNT/A light chain variants, non-conservative BoNT/B light chain variants, non-conservative BoNT/C1 light chain variants, non-conservative BoNT/D light chain variants, non-conservative BoNT/E light chain variants, non-conservative BoNT/F light chain variants, non-conservative BoNT/G light chain variants, and non-conservative TeNT light chain variants.
[0037] As used herein, the term "Clostridial toxin light chain chimeric" means a polypeptide comprising at least a portion of a Clostridial toxin light chain and at least a portion of at least one other polypeptide to form a toxin light chain with at least one property different from the reference Clostridial toxin light chains of Table 1, with the proviso that this Clostridial toxin light chain chimeric is still capable of specifically targeting the core components of the neurotransmitter release apparatus and thus participate in executing the overall cellular mechanism whereby a Clostridial toxin proteolytically cleaves a substrate. Such Clostridial toxin light chain chimerics are described in, e.g., Lance E. Steward et al., Leucine-based Motif and Clostridial Toxins, U.S. Patent Publication 2003/0027752 (Feb. 6, 2003); Lance E. Steward et al., Clostridial Neurotoxin Compositions and Modified Clostridial Neurotoxins, U.S. Patent Publication 2003/0219462 (Nov. 27, 2003); and Lance E. Steward et al., Clostridial Neurotoxin Compositions and Modified Clostridial Neurotoxins, U.S. Patent Publication 2004/0220386 (Nov. 4, 2004).
[0038] As used herein, the term "active Clostridial toxin light chain fragment" means any of a variety of Clostridial toxin fragments comprising the light chain can be useful in aspects of the present invention with the proviso that these light chain fragments can specifically target the core components of the neurotransmitter release apparatus and thus participate in executing the overall cellular mechanism whereby a Clostridial toxin proteolytically cleaves a substrate. The light chains of Clostridial toxins are approximately 420-460 amino acids in length and comprise an enzymatic domain (Table 1). Research has shown that the entire length of a Clostridial toxin light chain is not necessary for the enzymatic activity of the enzymatic domain. As a non-limiting example, the first eight amino acids of the BoNT/A light chain (residues 1-8 of SEQ ID NO: 1) are not required for enzymatic activity. As another non-limiting example, the first eight amino acids of the TeNT light chain (residues 1-8 of SEQ ID NO: 8) are not required for enzymatic activity. Likewise, the carboxyl-terminus of the light chain is not necessary for activity. As a non-limiting example, the last 32 amino acids of the BoNT/A light chain (residues 417-448 of SEQ ID NO: 1) are not required for enzymatic activity. As another non-limiting example, the last 31 amino acids of the TeNT light chain (residues 427-457 of SEQ ID NO: 8) are not required for enzymatic activity. Thus, aspects of this embodiment can include Clostridial toxin light chains comprising an enzymatic domain having a length of, e.g., at least 350 amino acids, at least 375 amino acids, at least 400 amino acids, at least 425 amino acids and at least 450 amino acids. Other aspects of this embodiment can include Clostridial toxin light chains comprising an enzymatic domain having a length of, e.g., at most 350 amino acids, at most 375 amino acids, at most 400 amino acids, at most 425 amino acids and at most 450 amino acids.
[0039] Any of a variety of sequence alignment methods can be used to determine percent identity of naturally-occurring Clostridial toxin light chain variants and non-naturally-occurring Clostridial toxin light chain variants, including, without limitation, global methods, local methods and hybrid methods, such as, e.g., segment approach methods. Protocols to determine percent identity are routine procedures within the scope of one skilled in the art and from the teaching herein.
[0040] Global methods align sequences from the beginning to the end of the molecule and determine the best alignment by adding up scores of individual residue pairs and by imposing gap penalties. Non-limiting methods include, e.g., CLUSTAL W, see, e.g., Julie D. Thompson et al., CLUSTAL W: Improving the Sensitivity of Progressive Multiple Sequence Alignment Through Sequence Weighting, Position-Specific Gap Penalties and Weight Matrix Choice, 22(22) Nucleic Acids Research 4673-4680 (1994); and iterative refinement, see, e.g., Osamu Gotoh, Significant Improvement in Accuracy of Multiple Protein Sequence Alignments by Iterative Refinement as Assessed by Reference to Structural Alignments, 264(4) J. Mol. Biol. 823-838 (1996).
[0041] Local methods align sequences by identifying one or more conserved motifs shared by all of the input sequences. Non-limiting methods include, e.g., Match-box, see, e.g., Eric Depiereux and Ernest Feytmans, Match-Box: A Fundamentally New Algorithm for the Simultaneous Alignment of Several Protein Sequences, 8(5) CABIOS 501-509 (1992); Gibbs sampling, see, e.g., C. E. Lawrence et al., Detecting Subtle Sequence Signals: A Gibbs Sampling Strategy for Multiple Alignment, 262(5131) Science 208-214 (1993); Align-M, see, e.g., Ivo Van Walle et al., Align-M--A New Algorithm for Multiple Alignment of Highly Divergent Sequences, 20(9) Bioinformatics:1428-1435 (2004).
[0042] Hybrid methods combine functional aspects of both global and local alignment methods. Non-limiting methods include, e.g., segment-to-segment comparison, see, e.g., Burkhard Morgenstern et al., Multiple DNA and Protein Sequence Alignment Based On Segment-To-Segment Comparison, 93(22) Proc. Natl. Acad. Sci. U.S.A. 12098-12103 (1996); T-Coffee, see, e.g., Cedric Notredame et al., T-Coffee: A Novel Algorithm for Multiple Sequence Alignment, 302(1) J. Mol. Biol. 205-217 (2000); MUSCLE, see, e.g., Robert C. Edgar, MUSCLE: Multiple Sequence Alignment With High Score Accuracy and High Throughput, 32(5) Nucleic Acids Res. 1792-1797 (2004); and DIALIGN-T, see, e.g., Amarendran R Subramanian et al., DIALIGN-T: An Improved Algorithm for Segment-Based Multiple Sequence Alignment, 6(1) BMC Bioinformatics 66 (2005).
[0043] Thus, in an embodiment, a modified Clostridial toxin disclosed in the present specification comprises a Clostridial toxin enzymatic domain. In an aspect of this embodiment, a Clostridial toxin enzymatic domain comprises a naturally occurring Clostridial toxin light chain variant, such as, e.g., a Clostridial toxin light chain isoform or a Clostridial toxin light chain subtype. In another aspect of this embodiment, a Clostridial toxin enzymatic domain comprises a non-naturally occurring Clostridial toxin light chain variant, such as, e.g., a conservative Clostridial toxin light chain variant, a non-conservative Clostridial toxin light chain variant, a Clostridial toxin chimeric light chain, an active Clostridial toxin light chain fragment, or any combination thereof.
[0044] In another embodiment, a Clostridial toxin enzymatic domain comprises a BoNT/A light chain. In an aspect of this embodiment, a BoNT/A light chain comprises amino acids 1-448 of SEQ ID NO: 1. In another aspect of this embodiment, a BoNT/A light chain comprises a naturally occurring BoNT/A light chain variant, such as, e.g., a light chain from a BoNT/A isoform or a light chain from a BoNT/A subtype. In another aspect of this embodiment, a BoNT/A light chain comprises amino acids 1-448 of a naturally occurring BoNT/A light chain variant of SEQ ID NO: 1, such as, e.g., amino acids 1-448 of a BoNT/A isoform of SEQ ID NO: 1 or amino acids 1-448 of a BoNT/A subtype of SEQ ID NO: 1. In still another aspect of this embodiment, a BoNT/A light chain comprises a non-naturally occurring BoNT/A light chain variant, such as, e.g., a conservative BoNT/A light chain variant, a non-conservative BoNT/A light chain variant, a BoNT/A chimeric light chain, an active BoNT/A light chain fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/A light chain comprises amino acids 1-448 of a non-naturally occurring BoNT/A light chain variant of SEQ ID NO: 1, such as, e.g., amino acids 1-448 of a conservative BoNT/A light chain variant of SEQ ID NO: 1, amino acids 1-448 of a non-conservative BoNT/A light chain variant of SEQ ID NO: 1, amino acids 1-448 of an active BoNT/A light chain fragment of SEQ ID NO: 1, or any combination thereof.
[0045] In other aspects of this embodiment, a BoNT/A light chain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1-448 of SEQ ID NO: 1, at least 75% amino acid identity with amino acids 1-448 of SEQ ID NO: 1, at least 80% amino acid identity with amino acids 1-448 of SEQ ID NO: 1, at least 85% amino acid identity with amino acids 1-448 of SEQ ID NO: 1, at least 90% amino acid identity with amino acids 1-448 of SEQ ID NO: 1 or at least 95% amino acid identity with amino acids 1-448 of SEQ ID NO: 1. In yet other aspects of this embodiment, a BoNT/A light chain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1-448 of SEQ ID NO: 1, at most 75% amino acid identity with amino acids 1-448 of SEQ ID NO: 1, at most 80% amino acid identity with amino acids 1-448 of SEQ ID NO: 1, at most 85% amino acid identity with amino acids 1-448 of SEQ ID NO: 1, at most 90% amino acid identity with amino acids 1-448 of SEQ ID NO: 1 or at most 95% amino acid identity with amino acids 1-448 of SEQ ID NO: 1.
[0046] In other aspects of this embodiment, a BoNT/A light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 1-448 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 1-448 of SEQ ID NO: 1. In yet other aspects of this embodiment, a BoNT/A light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-448 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-448 of SEQ ID NO: 1. In still other aspects of this embodiment, a BoNT/A light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-448 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-448 of SEQ ID NO: 1.
[0047] In other aspects of this embodiment, a BoNT/A light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-448 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-448 of SEQ ID NO: 1. In yet other aspects of this embodiment, a BoNT/A light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-448 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-448 of SEQ ID NO: 1. In still other aspects of this embodiment, a BoNT/A light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-448 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-448 of SEQ ID NO: 1.
[0048] In another embodiment, a Clostridial toxin enzymatic domain comprises a BoNT/B light chain. In an aspect of this embodiment, a BoNT/B light chain comprises amino acids 1-441 of SEQ ID NO: 2. In another aspect of this embodiment, a BoNT/B light chain comprises a naturally occurring BoNT/B light chain variant, such as, e.g., a light chain from a BoNT/B isoform or a light chain from a BoNT/B subtype. In another aspect of this embodiment, a BoNT/B light chain comprises amino acids 1-441 of a naturally occurring BoNT/B light chain variant of SEQ ID NO: 2, such as, e.g., amino acids 1-441 of a BoNT/B isoform of SEQ ID NO: 2 or amino acids 1-441 of a BoNT/B subtype of SEQ ID NO: 2. In still another aspect of this embodiment, a BoNT/B light chain comprises a non-naturally occurring BoNT/B light chain variant, such as, e.g., a conservative BoNT/B light chain variant, a non-conservative BoNT/B light chain variant, a BoNT/B chimeric light chain, an active BoNT/B light chain fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/B light chain comprises amino acids 1-441 of a non-naturally occurring BoNT/B light chain variant of SEQ ID NO: 2, such as, e.g., amino acids 1-441 of a conservative BoNT/B light chain variant of SEQ ID NO: 2, amino acids 1-441 of a non-conservative BoNT/B light chain variant of SEQ ID NO: 2, amino acids 1-441 of an active BoNT/B light chain fragment of SEQ ID NO: 2, or any combination thereof.
[0049] In other aspects of this embodiment, a BoNT/B light chain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1-441 of SEQ ID NO: 2, at least 75% amino acid identity with amino acids 1-441 of SEQ ID NO: 2, at least 80% amino acid identity with amino acids 1-441 of SEQ ID NO: 2, at least 85% amino acid identity with amino acids 1-441 of SEQ ID NO: 2, at least 90% amino acid identity with amino acids 1-441 of SEQ ID NO: 2 or at least 95% amino acid identity with amino acids 1-441 of SEQ ID NO: 2. In yet other aspects of this embodiment, a BoNT/B light chain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1-441 of SEQ ID NO: 2, at most 75% amino acid identity with amino acids 1-441 of SEQ ID NO: 2, at most 80% amino acid identity with amino acids 1-441 of SEQ ID NO: 2, at most 85% amino acid identity with amino acids 1-441 of SEQ ID NO: 2, at most 90% amino acid identity with amino acids 1-441 of SEQ ID NO: 2 or at most 95% amino acid identity with amino acids 1-441 of SEQ ID NO: 2.
[0050] In other aspects of this embodiment, a BoNT/B light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 1-441 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 1-441 of SEQ ID NO: 2. In yet other aspects of this embodiment, a BoNT/B light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-441 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-441 of SEQ ID NO: 2. In still other aspects of this embodiment, a BoNT/B light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-441 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-441 of SEQ ID NO: 2.
[0051] In other aspects of this embodiment, a BoNT/B light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-441 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-441 of SEQ ID NO: 2. In yet other aspects of this embodiment, a BoNT/B light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-441 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-441 of SEQ ID NO: 2. In still other aspects of this embodiment, a BoNT/B light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-441 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-441 of SEQ ID NO: 2.
[0052] In another embodiment, a Clostridial toxin enzymatic domain comprises a BoNT/C1 light chain. In an aspect of this embodiment, a BoNT/C1 light chain comprises amino acids 1-449 of SEQ ID NO: 3. In another aspect of this embodiment, a BoNT/C1 light chain comprises a naturally occurring BoNT/C1 light chain variant, such as, e.g., a light chain from a BoNT/C1 isoform or a light chain from a BoNT/C1 subtype. In another aspect of this embodiment, a BoNT/C1 light chain comprises amino acids 1-449 of a naturally occurring BoNT/C1 light chain variant of SEQ ID NO: 3, such as, e.g., amino acids 1-449 of a BoNT/C1 isoform of SEQ ID NO: 3 or amino acids 1-449 of a BoNT/C1 subtype of SEQ ID NO: 3. In still another aspect of this embodiment, a BoNT/C1 light chain comprises a non-naturally occurring BoNT/C1 light chain variant, such as, e.g., a conservative BoNT/C1 light chain variant, a non-conservative BoNT/C1 light chain variant, a BoNT/C1 chimeric light chain, an active BoNT/C1 light chain fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/C1 light chain comprises amino acids 1-449 of a non-naturally occurring BoNT/C1 light chain variant of SEQ ID NO: 3, such as, e.g., amino acids 1-449 of a conservative BoNT/C1 light chain variant of SEQ ID NO: 3, amino acids 1-449 of a non-conservative BoNT/C1 light chain variant of SEQ ID NO: 3, amino acids 1-449 of an active BoNT/C1 light chain fragment of SEQ ID NO: 3, or any combination thereof.
[0053] In other aspects of this embodiment, a BoNT/C1 light chain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1-449 of SEQ ID NO: 3, at least 75% amino acid identity with amino acids 1-449 of SEQ ID NO: 3, at least 80% amino acid identity with amino acids 1-449 of SEQ ID NO: 3, at least 85% amino acid identity with amino acids 1-449 of SEQ ID NO: 3, at least 90% amino acid identity with amino acids 1-449 of SEQ ID NO: 3 or at least 95% amino acid identity with amino acids 1-449 of SEQ ID NO: 3. In yet other aspects of this embodiment, a BoNT/C1 light chain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1-449 of SEQ ID NO: 3, at most 75% amino acid identity with amino acids 1-449 of SEQ ID NO: 3, at most 80% amino acid identity with amino acids 1-449 of SEQ ID NO: 3, at most 85% amino acid identity with amino acids 1-449 of SEQ ID NO: 3, at most 90% amino acid identity with amino acids 1-449 of SEQ ID NO: 3 or at most 95% amino acid identity with amino acids 1-449 of SEQ ID NO: 3.
[0054] In other aspects of this embodiment, a BoNT/C1 light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 1-449 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 1-449 of SEQ ID NO: 3. In yet other aspects of this embodiment, a BoNT/C1 light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-449 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-449 of SEQ ID NO: 3. In still other aspects of this embodiment, a BoNT/C1 light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-449 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-449 of SEQ ID NO: 3.
[0055] In other aspects of this embodiment, a BoNT/C1 light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-449 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-449 of SEQ ID NO: 3. In yet other aspects of this embodiment, a BoNT/C1 light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-449 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-449 of SEQ ID NO: 3. In still other aspects of this embodiment, a BoNT/C1 light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-449 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-449 of SEQ ID NO: 3.
[0056] In another embodiment, a Clostridial toxin enzymatic domain comprises a BoNT/D light chain. In an aspect of this embodiment, a BoNT/D light chain comprises amino acids 1-445 of SEQ ID NO: 4. In another aspect of this embodiment, a BoNT/D light chain comprises a naturally occurring BoNT/D light chain variant, such as, e.g., a light chain from a BoNT/D isoform or a light chain from a BoNT/D subtype. In another aspect of this embodiment, a BoNT/D light chain comprises amino acids 1-445 of a naturally occurring BoNT/D light chain variant of SEQ ID NO: 4, such as, e.g., amino acids 1-445 of a BoNT/D isoform of SEQ ID NO: 4 or amino acids 1-445 of a BoNT/D subtype of SEQ ID NO: 4. In still another aspect of this embodiment, a BoNT/D light chain comprises a non-naturally occurring BoNT/D light chain variant, such as, e.g., a conservative BoNT/D light chain variant, a non-conservative BoNT/D light chain variant, a BoNT/D chimeric light chain, an active BoNT/D light chain fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/D light chain comprises amino acids 1-445 of a non-naturally occurring BoNT/D light chain variant of SEQ ID NO: 4, such as, e.g., amino acids 1-445 of a conservative BoNT/D light chain variant of SEQ ID NO: 4, amino acids 1-445 of a non-conservative BoNT/D light chain variant of SEQ ID NO: 4, amino acids 1-445 of an active BoNT/D light chain fragment of SEQ ID NO: 4, or any combination thereof.
[0057] In other aspects of this embodiment, a BoNT/D light chain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1-445 of SEQ ID NO: 4, at least 75% amino acid identity with amino acids 1-445 of SEQ ID NO: 4, at least 80% amino acid identity with amino acids 1-445 of SEQ ID NO: 4, at least 85% amino acid identity with amino acids 1-445 of SEQ ID NO: 4, at least 90% amino acid identity with amino acids 1-445 of SEQ ID NO: 4 or at least 95% amino acid identity with amino acids 1-445 of SEQ ID NO: 4. In yet other aspects of this embodiment, a BoNT/D light chain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1-445 of SEQ ID NO: 4, at most 75% amino acid identity with amino acids 1-445 of SEQ ID NO: 4, at most 80% amino acid identity with amino acids 1-445 of SEQ ID NO: 4, at most 85% amino acid identity with amino acids 1-445 of SEQ ID NO: 4, at most 90% amino acid identity with amino acids 1-445 of SEQ ID NO: 4 or at most 95% amino acid identity with amino acids 1-445 of SEQ ID NO: 4.
[0058] In other aspects of this embodiment, a BoNT/D light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 1-445 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 1-445 of SEQ ID NO: 4. In yet other aspects of this embodiment, a BoNT/D light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-445 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-445 of SEQ ID NO: 4. In still other aspects of this embodiment, a BoNT/D light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-445 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-445 of SEQ ID NO: 4.
[0059] In other aspects of this embodiment, a BoNT/D light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-445 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-445 of SEQ ID NO: 4. In yet other aspects of this embodiment, a BoNT/D light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-445 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-445 of SEQ ID NO: 4. In still other aspects of this embodiment, a BoNT/D light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-445 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-445 of SEQ ID NO: 4.
[0060] In another embodiment, a Clostridial toxin enzymatic domain comprises a BoNT/E light chain. In an aspect of this embodiment, a BoNT/E light chain comprises amino acids 1-422 of SEQ ID NO: 5. In another aspect of this embodiment, a BoNT/E light chain comprises a naturally occurring BoNT/E light chain variant, such as, e.g., a light chain from a BoNT/E isoform or a light chain from a BoNT/E subtype. In another aspect of this embodiment, a BoNT/E light chain comprises amino acids 1-422 of a naturally occurring BoNT/E light chain variant of SEQ ID NO: 5, such as, e.g., amino acids 1-422 of a BoNT/E isoform of SEQ ID NO: 5 or amino acids 1-422 of a BoNT/E subtype of SEQ ID NO: 5. In still another aspect of this embodiment, a BoNT/E light chain comprises a non-naturally occurring BoNT/E light chain variant, such as, e.g., a conservative BoNT/E light chain variant, a non-conservative BoNT/E light chain variant, a BoNT/E chimeric light chain, an active BoNT/E light chain fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/E light chain comprises amino acids 1-422 of a non-naturally occurring BoNT/E light chain variant of SEQ ID NO: 5, such as, e.g., amino acids 1-422 of a conservative BoNT/E light chain variant of SEQ ID NO: 5, amino acids 1-422 of a non-conservative BoNT/E light chain variant of SEQ ID NO: 5, amino acids 1-422 of an active BoNT/E light chain fragment of SEQ ID NO: 5, or any combination thereof.
[0061] In other aspects of this embodiment, a BoNT/E light chain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1-422 of SEQ ID NO: 5, at least 75% amino acid identity with amino acids 1-422 of SEQ ID NO: 5, at least 80% amino acid identity with amino acids 1-422 of SEQ ID NO: 5, at least 85% amino acid identity with amino acids 1-422 of SEQ ID NO: 5, at least 90% amino acid identity with amino acids 1-422 of SEQ ID NO: 5 or at least 95% amino acid identity with amino acids 1-422 of SEQ ID NO: 5. In yet other aspects of this embodiment, a BoNT/E light chain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1-422 of SEQ ID NO: 5, at most 75% amino acid identity with amino acids 1-422 of SEQ ID NO: 5, at most 80% amino acid identity with amino acids 1-422 of SEQ ID NO: 5, at most 85% amino acid identity with amino acids 1-422 of SEQ ID NO: 5, at most 90% amino acid identity with amino acids 1-422 of SEQ ID NO: 5 or at most 95% amino acid identity with amino acids 1-422 of SEQ ID NO: 5.
[0062] In other aspects of this embodiment, a BoNT/E light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 1-422 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 1-422 of SEQ ID NO: 5. In yet other aspects of this embodiment, a BoNT/E light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-422 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-422 of SEQ ID NO: 5. In still other aspects of this embodiment, a BoNT/E light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-422 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-422 of SEQ ID NO: 5.
[0063] In other aspects of this embodiment, a BoNT/E light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-422 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-422 of SEQ ID NO: 5. In yet other aspects of this embodiment, a BoNT/E light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-422 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-422 of SEQ ID NO: 5. In still other aspects of this embodiment, a BoNT/E light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-422 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-422 of SEQ ID NO: 5.
[0064] In another embodiment, a Clostridial toxin enzymatic domain comprises a BoNT/F light chain. In an aspect of this embodiment, a BoNT/F light chain comprises amino acids 1-439 of SEQ ID NO: 6. In another aspect of this embodiment, a BoNT/F light chain comprises a naturally occurring BoNT/F light chain variant, such as, e.g., a light chain from a BoNT/F isoform or a light chain from a BoNT/F subtype. In another aspect of this embodiment, a BoNT/F light chain comprises amino acids 1-439 of a naturally occurring BoNT/F light chain variant of SEQ ID NO: 6, such as, e.g., amino acids 1-439 of a BoNT/F isoform of SEQ ID NO: 6 or amino acids 1-439 of a BoNT/F subtype of SEQ ID NO: 6. In still another aspect of this embodiment, a BoNT/F light chain comprises a non-naturally occurring BoNT/F light chain variant, such as, e.g., a conservative BoNT/F light chain variant, a non-conservative BoNT/F light chain variant, a BoNT/F chimeric light chain, an active BoNT/F light chain fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/F light chain comprises amino acids 1-439 of a non-naturally occurring BoNT/F light chain variant of SEQ ID NO: 6, such as, e.g., amino acids 1-439 of a conservative BoNT/F light chain variant of SEQ ID NO: 6, amino acids 1-439 of a non-conservative BoNT/F light chain variant of SEQ ID NO: 6, amino acids 1-439 of an active BoNT/F light chain fragment of SEQ ID NO: 6, or any combination thereof.
[0065] In other aspects of this embodiment, a BoNT/F light chain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1-439 of SEQ ID NO: 6, at least 75% amino acid identity with amino acids 1-439 of SEQ ID NO: 6, at least 80% amino acid identity with amino acids 1-439 of SEQ ID NO: 6, at least 85% amino acid identity with amino acids 1-439 of SEQ ID NO: 6, at least 90% amino acid identity with amino acids 1-439 of SEQ ID NO: 6 or at least 95% amino acid identity with amino acids 1-439 of SEQ ID NO: 6. In yet other aspects of this embodiment, a BoNT/F light chain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1-439 of SEQ ID NO: 6, at most 75% amino acid identity with amino acids 1-439 of SEQ ID NO: 6, at most 80% amino acid identity with amino acids 1-439 of SEQ ID NO: 6, at most 85% amino acid identity with amino acids 1-439 of SEQ ID NO: 6, at most 90% amino acid identity with amino acids 1-439 of SEQ ID NO: 6 or at most 95% amino acid identity with amino acids 1-439 of SEQ ID NO: 6.
[0066] In other aspects of this embodiment, a BoNT/F light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 1-439 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 1-439 of SEQ ID NO: 6. In yet other aspects of this embodiment, a BoNT/F light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-439 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-439 of SEQ ID NO: 6. In still other aspects of this embodiment, a BoNT/F light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-439 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-439 of SEQ ID NO: 6.
[0067] In other aspects of this embodiment, a BoNT/F light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-439 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-439 of SEQ ID NO: 6. In yet other aspects of this embodiment, a BoNT/F light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-439 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-439 of SEQ ID NO: 6. In still other aspects of this embodiment, a BoNT/F light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-439 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-439 of SEQ ID NO: 6.
[0068] In another embodiment, a Clostridial toxin enzymatic domain comprises a BoNT/G light chain. In an aspect of this embodiment, a BoNT/G light chain comprises amino acids 1-446 of SEQ ID NO: 7. In another aspect of this embodiment, a BoNT/G light chain comprises a naturally occurring BoNT/G light chain variant, such as, e.g., a light chain from a BoNT/G isoform or a light chain from a BoNT/G subtype. In another aspect of this embodiment, a BoNT/G light chain comprises amino acids 1-446 of a naturally occurring BoNT/G light chain variant of SEQ ID NO: 7, such as, e.g., amino acids 1-446 of a BoNT/G isoform of SEQ ID NO: 7 or amino acids 1-446 of a BoNT/G subtype of SEQ ID NO: 7. In still another aspect of this embodiment, a BoNT/G light chain comprises a non-naturally occurring BoNT/G light chain variant, such as, e.g., a conservative BoNT/G light chain variant, a non-conservative BoNT/G light chain variant, a BoNT/G chimeric light chain, an active BoNT/G light chain fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/G light chain comprises amino acids 1-446 of a non-naturally occurring BoNT/G light chain variant of SEQ ID NO: 7, such as, e.g., amino acids 1-446 of a conservative BoNT/G light chain variant of SEQ ID NO: 7, amino acids 1-446 of a non-conservative BoNT/G light chain variant of SEQ ID NO: 7, amino acids 1-446 of an active BoNT/G light chain fragment of SEQ ID NO: 7, or any combination thereof.
[0069] In other aspects of this embodiment, a BoNT/G light chain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1-446 of SEQ ID NO: 7, at least 75% amino acid identity with amino acids 1-446 of SEQ ID NO: 7, at least 80% amino acid identity with amino acids 1-446 of SEQ ID NO: 7, at least 85% amino acid identity with amino acids 1-446 of SEQ ID NO: 7, at least 90% amino acid identity with amino acids 1-446 of SEQ ID NO: 7 or at least 95% amino acid identity with amino acids 1-446 of SEQ ID NO: 7. In yet other aspects of this embodiment, a BoNT/G light chain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1-446 of SEQ ID NO: 7, at most 75% amino acid identity with amino acids 1-446 of SEQ ID NO: 7, at most 80% amino acid identity with amino acids 1-446 of SEQ ID NO: 7, at most 85% amino acid identity with amino acids 1-446 of SEQ ID NO: 7, at most 90% amino acid identity with amino acids 1-446 of SEQ ID NO: 7 or at most 95% amino acid identity with amino acids 1-446 of SEQ ID NO: 7.
[0070] In other aspects of this embodiment, a BoNT/G light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 1-446 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 1-446 of SEQ ID NO: 7. In yet other aspects of this embodiment, a BoNT/G light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-446 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-446 of SEQ ID NO: 7. In still other aspects of this embodiment, a BoNT/G light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-446 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-446 of SEQ ID NO: 7.
[0071] In other aspects of this embodiment, a BoNT/G light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-446 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-446 of SEQ ID NO: 7. In yet other aspects of this embodiment, a BoNT/G light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-446 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-446 of SEQ ID NO: 7. In still other aspects of this embodiment, a BoNT/G light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-446 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-446 of SEQ ID NO: 7.
[0072] In another embodiment, a Clostridial toxin enzymatic domain comprises a TeNT light chain. In an aspect of this embodiment, a TeNT light chain comprises amino acids 1-457 of SEQ ID NO: 8. In another aspect of this embodiment, a TeNT light chain comprises a naturally occurring TeNT light chain variant, such as, e.g., a light chain from a TeNT isoform or a light chain from a TeNT subtype. In another aspect of this embodiment, a TeNT light chain comprises amino acids 1-457 of a naturally occurring TeNT light chain variant of SEQ ID NO: 8, such as, e.g., amino acids 1-457 of a TeNT isoform of SEQ ID NO: 8 or amino acids 1-457 of a TeNT subtype of SEQ ID NO: 8. In still another aspect of this embodiment, a TeNT light chain comprises a non-naturally occurring TeNT light chain variant, such as, e.g., a conservative TeNT light chain variant, a non-conservative TeNT light chain variant, a TeNT chimeric light chain, an active TeNT light chain fragment, or any combination thereof. In still another aspect of this embodiment, a TeNT light chain comprises amino acids 1-457 of a non-naturally occurring TeNT light chain variant of SEQ ID NO: 8, such as, e.g., amino acids 1-457 of a conservative TeNT light chain variant of SEQ ID NO: 8, amino acids 1-457 of a non-conservative TeNT light chain variant of SEQ ID NO: 8, amino acids 1-457 of an active TeNT light chain fragment of SEQ ID NO: 8, or any combination thereof.
[0073] In other aspects of this embodiment, a TeNT light chain comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1-457 of SEQ ID NO: 8, at least 75% amino acid identity with amino acids 1-457 of SEQ ID NO: 8, at least 80% amino acid identity with amino acids 1-457 of SEQ ID NO: 8, at least 85% amino acid identity with amino acids 1-457 of SEQ ID NO: 8, at least 90% amino acid identity with amino acids 1-457 of SEQ ID NO: 8 or at least 95% amino acid identity with amino acids 1-457 of SEQ ID NO: 8. In yet other aspects of this embodiment, a TeNT light chain comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1-457 of SEQ ID NO: 8, at most 75% amino acid identity with amino acids 1-457 of SEQ ID NO: 8, at most 80% amino acid identity with amino acids 1-457 of SEQ ID NO: 8, at most 85% amino acid identity with amino acids 1-457 of SEQ ID NO: 8, at most 90% amino acid identity with amino acids 1-457 of SEQ ID NO: 8 or at most 95% amino acid identity with amino acids 1-457 of SEQ ID NO: 8.
[0074] In other aspects of this embodiment, a TeNT light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 1-457 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 1-457 of SEQ ID NO: 8. In yet other aspects of this embodiment, a TeNT light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-457 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 1-457 of SEQ ID NO: 8. In still other aspects of this embodiment, a TeNT light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-457 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 1-457 of SEQ ID NO: 8.
[0075] In other aspects of this embodiment, a TeNT light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-457 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 1-457 of SEQ ID NO: 8. In yet other aspects of this embodiment, a TeNT light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-457 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 1-457 of SEQ ID NO: 8. In still other aspects of this embodiment, a TeNT light chain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-457 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT light chain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 1-457 of SEQ ID NO: 8.
[0076] Aspects of the present invention provide, in part, a Clostridial toxin translocation domain. As used herein, the term "Clostridial toxin translocation domain" means any Clostridial toxin polypeptide that can execute the translocation step of the intoxication process that mediates Clostridial toxin light chain translocation. Thus, a Clostridial toxin translocation domain facilitates the movement of a Clostridial toxin light chain across a membrane and encompasses the movement of a Clostridial toxin light chain through the membrane an intracellular vesicle into the cytoplasm of a cell. Non-limiting examples of a Clostridial toxin translocation domain include, e.g., a Clostridial toxin HN region such as, e.g., a BoNT/A HN region, a BoNT/B HN region, a BoNT/C1 HN region, a BoNT/D HN region, a BoNT/E HN region, a BoNT/F HN region, a BoNT/G HN region, and a TeNT HN region.
[0077] A Clostridial toxin translocation domain includes, without limitation, naturally occurring Clostridial toxin HN region variants, such as, e.g., Clostridial toxin HN region isoforms and Clostridial toxin HN region subtypes; non-naturally occurring Clostridial toxin HN region variants, such as, e.g., conservative Clostridial toxin HN region variants, non-conservative Clostridial toxin HN region variants, Clostridial toxin HN region chimerics, active Clostridial toxin HN region fragments thereof, or any combination thereof.
[0078] As used herein, the term "Clostridial toxin HN region variant," whether naturally-occurring or non-naturally-occurring, means a Clostridial toxin HN region that has at least one amino acid change from the corresponding region of the disclosed reference sequences (see Table 1) and can be described in percent identity to the corresponding region of that reference sequence. Unless expressly indicated, all Clostridial toxin HN region variants disclosed in the present specification are capable of executing the translocation step of the intoxication process that mediates Clostridial toxin light chain translocation. As non-limiting examples, a BoNT/A HN region variant comprising amino acids 449-873 of SEQ ID NO: 1 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 449-873 of SEQ ID NO: 1; a BoNT/B HN region variant comprising amino acids 442-860 of SEQ ID NO: 2 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 442-860 of SEQ ID NO: 2; a BoNT/C1HN region variant comprising amino acids 450-868 of SEQ ID NO: 3 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 450-868 of SEQ ID NO: 3; a BoNT/D HN region variant comprising amino acids 446-864 of SEQ ID NO: 4 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 446-864 of SEQ ID NO: 4; a BoNT/E HN region variant comprising amino acids 423-847 of SEQ ID NO: 5 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 423-847 of SEQ ID NO: 5; a BoNT/F HN region variant comprising amino acids 440-866 of SEQ ID NO: 6 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 440-866 of SEQ ID NO: 6; a BoNT/G HN region variant comprising amino acids 447-865 of SEQ ID NO: 7 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 447-865 of SEQ ID NO: 7; and a TeNT HN region variant comprising amino acids 458-881 of SEQ ID NO: 8 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 458-881 of SEQ ID NO: 8.
[0079] It is recognized by those of skill in the art that within each serotype of Clostridial toxin there can be naturally occurring Clostridial toxin HN region variants that differ somewhat in their amino acid sequence, and also in the nucleic acids encoding these proteins. For example, there are presently four BoNT/A subtypes, BoNT/A1, BoNT/A2, BoNT/A3 and BoNT/A4, with specific HN region subtypes showing approximately 87% amino acid identity when compared to another BoNT/A HN region subtype. As used herein, the term "naturally occurring Clostridial toxin HN region variant" means any Clostridial toxin HN region produced by a naturally-occurring process, including, without limitation, Clostridial toxin HN region isoforms produced from alternatively-spliced transcripts, Clostridial toxin HN region isoforms produced by spontaneous mutation and Clostridial toxin HN region subtypes. A naturally occurring Clostridial toxin HN region variant can function in substantially the same manner as the reference Clostridial toxin HN region on which the naturally occurring Clostridial toxin HN region variant is based, and can be substituted for the reference Clostridial toxin HN region in any aspect of the present invention. A naturally occurring Clostridial toxin HN region variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, ten or more amino acids, 20 or more amino acids, 30 or more amino acids, 40 or more amino acids, 50 or more amino acids or 100 or more amino acids from the reference Clostridial toxin HN region on which the naturally occurring Clostridial toxin HN region variant is based. A naturally occurring Clostridial toxin HN region variant can also substitute at least 10 contiguous amino acids, at least 15 contiguous amino acids, at least 20 contiguous amino acids, or at least 25 contiguous amino acids from the reference Clostridial toxin HN region on which the naturally occurring Clostridial toxin HN region variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference Clostridial toxin HN region on which the naturally occurring Clostridial toxin HN region variant is based.
[0080] A non-limiting examples of a naturally occurring Clostridial toxin HN region variant is a Clostridial toxin HN region isoform such as, e.g., a BoNT/A HN region isoform, a BoNT/B HN region isoform, a BoNT/C1HN region isoform, a BoNT/D HN region isoform, a BoNT/E HN region isoform, a BoNT/F HN region isoform, a BoNT/G HN region isoform, and a TeNT HN region isoform. A Clostridial toxin HN region isoform can function in substantially the same manner as the reference Clostridial toxin HN region on which the Clostridial toxin HN region isoform is based, and can be substituted for the reference Clostridial toxin HN region in any aspect of the present invention.
[0081] Another non-limiting examples of a naturally occurring Clostridial toxin HN region variant is a Clostridial toxin HN region subtype such as, e.g., a HN region from subtype BoNT/A1, BoNT/A2, BoNT/A3 and BoNT/A4; a HN region from subtype BoNT/B1, BoNT/B2, BoNT/B bivalent and BoNT/B nonproteolytic; a HN region from subtype BoNT/C1-1 and BoNT/C1-2; a HN region from subtype BoNT/E1, BoNT/E2 and BoNT/E3; and a HN region from subtype BoNT/F1, BoNT/F2, BoNT/F3 and BoNT/F4. A Clostridial toxin HN region subtype can function in substantially the same manner as the reference Clostridial toxin HN region on which the Clostridial toxin HN region subtype is based, and can be substituted for the reference Clostridial toxin HN region in any aspect of the present invention.
[0082] As used herein, the term "non-naturally occurring Clostridial toxin HN region variant" means any Clostridial toxin HN region produced with the aid of human manipulation, including, without limitation, Clostridial toxin HN regions produced by genetic engineering using random mutagenesis or rational design and Clostridial toxin HN regions produced by chemical synthesis. Non-limiting examples of non-naturally occurring Clostridial toxin HN region variants include, e.g., conservative Clostridial toxin HN region variants, non-conservative Clostridial toxin HN region variants, Clostridial toxin HN region chimeric variants and active Clostridial toxin HN region fragments.
[0083] As used herein, the term "conservative Clostridial toxin HN region variant" means a Clostridial toxin HN region that has at least one amino acid substituted by another amino acid or an amino acid analog that has at least one property similar to that of the original amino acid from the reference Clostridial toxin HN region sequence (Table 1). Examples of properties include, without limitation, similar size, topography, charge, hydrophobicity, hydrophilicity, lipophilicity, covalent-bonding capacity, hydrogen-bonding capacity, a physicochemical property, of the like, or any combination thereof. A conservative Clostridial toxin HN region variant can function in substantially the same manner as the reference Clostridial toxin HN region on which the conservative Clostridial toxin HN region variant is based, and can be substituted for the reference Clostridial toxin HN region in any aspect of the present invention. A conservative Clostridial toxin HN region variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, ten or more amino acids, 20 or more amino acids, 30 or more amino acids, 40 or more amino acids, 50 or more amino acids, 100 or more amino acids or 200 or more amino acids from the reference Clostridial toxin HN region on which the conservative Clostridial toxin HN region variant is based. A conservative Clostridial toxin HN region variant can also substitute at least 10 contiguous amino acids, at least 15 contiguous amino acids, at least 20 contiguous amino acids, or at least 25 contiguous amino acids from the reference Clostridial toxin HN region on which the conservative Clostridial toxin HN region variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference Clostridial toxin HN region on which the conservative Clostridial toxin HN region variant is based. Non-limiting examples of a conservative Clostridial toxin HN region variant include, e.g., conservative BoNT/A HN region variants, conservative BoNT/B HN region variants, conservative BoNT/C1 HN region variants, conservative BoNT/D HN region variants, conservative BoNT/E HN region variants, conservative BoNT/F HN region variants, conservative BoNT/G HN region variants, and conservative TeNT HN region variants.
[0084] As used herein, the term "non-conservative Clostridial toxin HN region variant" means a Clostridial toxin HN region in which 1) at least one amino acid is deleted from the reference Clostridial toxin HN region on which the non-conservative Clostridial toxin HN region variant is based; 2) at least one amino acid added to the reference Clostridial toxin HN region on which the non-conservative Clostridial toxin HN region is based; or 3) at least one amino acid is substituted by another amino acid or an amino acid analog that does not share any property similar to that of the original amino acid from the reference Clostridial toxin HN region sequence (Table 1). A non-conservative Clostridial toxin HN region variant can function in substantially the same manner as the reference Clostridial toxin HN region on which the non-conservative Clostridial toxin HN region variant is based, and can be substituted for the reference Clostridial toxin HN region in any aspect of the present invention. A non-conservative Clostridial toxin HN region variant can delete one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, and ten or more amino acids from the reference Clostridial toxin HN region on which the non-conservative Clostridial toxin HN region variant is based. A non-conservative Clostridial toxin HN region variant can add one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, and ten or more amino acids to the reference Clostridial toxin HN region on which the non-conservative Clostridial toxin HN region variant is based. A non-conservative Clostridial toxin HN region variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, ten or more amino acids, 20 or more amino acids, 30 or more amino acids, 40 or more amino acids, 50 or more amino acids, 100 or more amino acids or 200 or more amino acids from the reference Clostridial toxin HN region on which the non-conservative Clostridial toxin HN region variant is based. A non-conservative Clostridial toxin HN region variant can also substitute at least 10 contiguous amino acids, at least 15 contiguous amino acids, at least 20 contiguous amino acids, or at least 25 contiguous amino acids from the reference Clostridial toxin HN region on which the non-conservative Clostridial toxin HN region variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference Clostridial toxin HN region on which the non-conservative Clostridial toxin HN region variant is based. Non-limiting examples of a non-conservative Clostridial toxin HN region variant include, e.g., non-conservative BoNT/A HN region variants, non-conservative BoNT/B HN region variants, non-conservative BoNT/C1 HN region variants, non-conservative BoNT/D HN region variants, non-conservative BoNT/E HN region variants, non-conservative BoNT/F HN region variants, non-conservative BoNT/G HN region variants, and non-conservative TeNT HN region variants.
[0085] As used herein, the term "Clostridial toxin HN region chimeric" means a polypeptide comprising at least a portion of a Clostridial toxin HN region and at least a portion of at least one other polypeptide to form a toxin HN region with at least one property different from the reference Clostridial toxin HN regions of Table 1, with the proviso that this Clostridial toxin HN region chimeric is still capable of facilitating the release of the LC from intracellular vesicles into the cytoplasm of the target cell and thus participate in executing the overall cellular mechanism whereby a Clostridial toxin proteolytically cleaves a substrate.
[0086] As used herein, the term "active Clostridial toxin HN region fragment" means any of a variety of Clostridial toxin fragments comprising the HN region can be useful in aspects of the present invention with the proviso that these active fragments can facilitate the release of the LC from intracellular vesicles into the cytoplasm of the target cell and thus participate in executing the overall cellular mechanism whereby a Clostridial toxin proteolytically cleaves a substrate. The HN regions from the heavy chains of Clostridial toxins are approximately 410-430 amino acids in length and comprise a translocation domain (Table 1). Research has shown that the entire length of a HN region from a Clostridial toxin heavy chain is not necessary for the translocating activity of the translocation domain. Thus, aspects of this embodiment can include Clostridial toxin HN regions comprising a translocation domain having a length of, e.g., at least 350 amino acids, at least 375 amino acids, at least 400 amino acids and at least 425 amino acids. Other aspects of this embodiment can include Clostridial toxin HN regions comprising translocation domain having a length of, e.g., at most 350 amino acids, at most 375 amino acids, at most 400 amino acids and at most 425 amino acids.
[0087] Any of a variety of sequence alignment methods can be used to determine percent identity of naturally-occurring Clostridial toxin HN region variants and non-naturally-occurring Clostridial toxin HN region variants, including, without limitation, global methods, local methods and hybrid methods, such as, e.g., segment approach methods. Protocols to determine percent identity are routine procedures within the scope of one skilled in the art and from the teaching herein.
[0088] Thus, in an embodiment, a modified Clostridial toxin disclosed in the present specification comprises a Clostridial toxin translocation domain. In an aspect of this embodiment, a Clostridial toxin translocation domain comprises a naturally occurring Clostridial toxin HN region variant, such as, e.g., a Clostridial toxin HN region isoform or a Clostridial toxin HN region subtype. In another aspect of this embodiment, a Clostridial toxin translocation domain comprises a non-naturally occurring Clostridial toxin HN region variant, such as, e.g., a conservative Clostridial toxin HN region variant, a non-conservative Clostridial toxin HN region variant, a Clostridial toxin chimeric HN region, an active Clostridial toxin HN region fragment, or any combination thereof.
[0089] In another embodiment, a Clostridial toxin translocation domain comprises a BoNT/A HN region. In an aspect of this embodiment, a BoNT/A HN region comprises amino acids 449-873 of SEQ ID NO: 1. In another aspect of this embodiment, a BoNT/A HN region comprises a naturally occurring BoNT/A HN region variant, such as, e.g., a HN region from a BoNT/A isoform or a HN region from a BoNT/A subtype. In another aspect of this embodiment, a BoNT/A HN region comprises amino acids 449-873 of a naturally occurring BoNT/A HN region variant of SEQ ID NO: 1, such as, e.g., amino acids 449-873 of a BoNT/A isoform of SEQ ID NO: 1 or amino acids 449-873 of a BoNT/A subtype of SEQ ID NO: 1. In still another aspect of this embodiment, a BoNT/A HN region comprises a non-naturally occurring BoNT/A HN region variant, such as, e.g., a conservative BoNT/A HN region variant, a non-conservative BoNT/A HN region variant, a BoNT/A chimeric HN region, an active BoNT/A HN region fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/A HN region comprises amino acids 449-873 of a non-naturally occurring BoNT/A HN region variant of SEQ ID NO: 1, such as, e.g., amino acids 449-873 of a conservative BoNT/A HN region variant of SEQ ID NO: 1, amino acids 449-873 of a non-conservative BoNT/A HN region variant of SEQ ID NO: 1, amino acids 449-873 of an active BoNT/A HN region fragment of SEQ ID NO: 1, or any combination thereof.
[0090] In other aspects of this embodiment, a BoNT/A HN region comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 449-873 of SEQ ID NO: 1, at least 75% amino acid identity with amino acids 449-873 of SEQ ID NO: 1, at least 80% amino acid identity with amino acids 449-873 of SEQ ID NO: 1, at least 85% amino acid identity with amino acids 449-873 of SEQ ID NO: 1, at least 90% amino acid identity with amino acids 449-873 of SEQ ID NO: 1 or at least 95% amino acid identity with amino acids 449-873 of SEQ ID NO: 1. In yet other aspects of this embodiment, a BoNT/A HN region comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 449-873 of SEQ ID NO: 1, at most 75% amino acid identity with amino acids 449-873 of SEQ ID NO: 1, at most 80% amino acid identity with amino acids 449-873 of SEQ ID NO: 1, at most 85% amino acid identity with amino acids 449-873 of SEQ ID NO: 1, at most 90% amino acid identity with amino acids 449-873 of SEQ ID NO: 1 or at most 95% amino acid identity with amino acids 449-873 of SEQ ID NO: 1.
[0091] In other aspects of this embodiment, a BoNT/A HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 449-873 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 449-873 of SEQ ID NO: 1. In yet other aspects of this embodiment, a BoNT/A HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 449-873 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 449-873 of SEQ ID NO: 1. In still other aspects of this embodiment, a BoNT/A HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 449-873 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 449-873 of SEQ ID NO: 1.
[0092] In other aspects of this embodiment, a BoNT/A HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 449-873 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 449-873 of SEQ ID NO: 1. In yet other aspects of this embodiment, a BoNT/A HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 449-873 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 449-873 of SEQ ID NO: 1. In still other aspects of this embodiment, a BoNT/A HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 449-873 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 449-873 of SEQ ID NO: 1.
[0093] In another embodiment, a Clostridial toxin translocation domain comprises a BoNT/B HN region. In an aspect of this embodiment, a BoNT/B HN region comprises amino acids 442-860 of SEQ ID NO: 2. In another aspect of this embodiment, a BoNT/B HN region comprises a naturally occurring BoNT/B HN region variant, such as, e.g., a HN region from a BoNT/B isoform or a HN region from a BoNT/B subtype. In another aspect of this embodiment, a BoNT/B HN region comprises amino acids 442-860 of a naturally occurring BoNT/B HN region variant of SEQ ID NO: 2, such as, e.g., amino acids 442-860 of a BoNT/B isoform of SEQ ID NO: 2 or amino acids 442-860 of a BoNT/B subtype of SEQ ID NO: 2. In still another aspect of this embodiment, a BoNT/B HN region comprises a non-naturally occurring BoNT/B HN region variant, such as, e.g., a conservative BoNT/B HN region variant, a non-conservative BoNT/B HN region variant, a BoNT/B chimeric HN region, an active BoNT/B HN region fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/B HN region comprises amino acids 442-860 of a non-naturally occurring BoNT/B HN region variant of SEQ ID NO: 2, such as, e.g., amino acids 442-860 of a conservative BoNT/B HN region variant of SEQ ID NO: 2, amino acids 442-860 of a non-conservative BoNT/B HN region variant of SEQ ID NO: 2, amino acids 442-860 of an active BoNT/B HN region fragment of SEQ ID NO: 2, or any combination thereof.
[0094] In other aspects of this embodiment, a BoNT/B HN region comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 442-860 of SEQ ID NO: 2, at least 75% amino acid identity with amino acids 442-860 of SEQ ID NO: 2, at least 80% amino acid identity with amino acids 442-860 of SEQ ID NO: 2, at least 85% amino acid identity with amino acids 442-860 of SEQ ID NO: 2, at least 90% amino acid identity with amino acids 442-860 of SEQ ID NO: 2 or at least 95% amino acid identity with amino acids 442-860 of SEQ ID NO: 2. In yet other aspects of this embodiment, a BoNT/B HN region comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 442-860 of SEQ ID NO: 2, at most 75% amino acid identity with amino acids 442-860 of SEQ ID NO: 2, at most 80% amino acid identity with amino acids 442-860 of SEQ ID NO: 2, at most 85% amino acid identity with amino acids 442-860 of SEQ ID NO: 2, at most 90% amino acid identity with amino acids 442-860 of SEQ ID NO: 2 or at most 95% amino acid identity with amino acids 442-860 of SEQ ID NO: 2.
[0095] In other aspects of this embodiment, a BoNT/B HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 442-860 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 442-860 of SEQ ID NO: 2. In yet other aspects of this embodiment, a BoNT/B HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 442-860 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 442-860 of SEQ ID NO: 2. In still other aspects of this embodiment, a BoNT/B HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 442-860 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 442-860 of SEQ ID NO: 2.
[0096] In other aspects of this embodiment, a BoNT/B HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 442-860 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 442-860 of SEQ ID NO: 2. In yet other aspects of this embodiment, a BoNT/B HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 442-860 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 442-860 of SEQ ID NO: 2. In still other aspects of this embodiment, a BoNT/B HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 442-860 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 442-860 of SEQ ID NO: 2.
[0097] In another embodiment, a Clostridial toxin translocation domain comprises a BoNT/C1 HN region. In an aspect of this embodiment, a BoNT/C1 HN region comprises amino acids 450-868 of SEQ ID NO: 3. In another aspect of this embodiment, a BoNT/C1 HN region comprises a naturally occurring BoNT/C1 HN region variant, such as, e.g., a HN region from a BoNT/C1 isoform or a HN region from a BoNT/C1 subtype. In another aspect of this embodiment, a BoNT/C1 HN region comprises amino acids 450-868 of a naturally occurring BoNT/C1 HN region variant of SEQ ID NO: 3, such as, e.g., amino acids 450-868 of a BoNT/C1 isoform of SEQ ID NO: 3 or amino acids 450-868 of a BoNT/C1 subtype of SEQ ID NO: 3. In still another aspect of this embodiment, a BoNT/C1 HN region comprises a non-naturally occurring BoNT/C1 HN region variant, such as, e.g., a conservative BoNT/C1 HN region variant, a non-conservative BoNT/C1 HN region variant, a BoNT/C1 chimeric HN region, an active BoNT/C1 HN region fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/C1 HN region comprises amino acids 450-868 of a non-naturally occurring BoNT/C1 HN region variant of SEQ ID NO: 3, such as, e.g., amino acids 450-868 of a conservative BoNT/C1 HN region variant of SEQ ID NO: 3, amino acids 450-868 of a non-conservative BoNT/C1 HN region variant of SEQ ID NO: 3, amino acids 450-868 of an active BoNT/C1 HN region fragment of SEQ ID NO: 3, or any combination thereof.
[0098] In other aspects of this embodiment, a BoNT/C1 HN region comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 450-868 of SEQ ID NO: 3, at least 75% amino acid identity with amino acids 450-868 of SEQ ID NO: 3, at least 80% amino acid identity with amino acids 450-868 of SEQ ID NO: 3, at least 85% amino acid identity with amino acids 450-868 of SEQ ID NO: 3, at least 90% amino acid identity with amino acids 450-868 of SEQ ID NO: 3 or at least 95% amino acid identity with amino acids 450-868 of SEQ ID NO: 3. In yet other aspects of this embodiment, a BoNT/C1HN region comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 450-868 of SEQ ID NO: 3, at most 75% amino acid identity with amino acids 450-868 of SEQ ID NO: 3, at most 80% amino acid identity with amino acids 450-868 of SEQ ID NO: 3, at most 85% amino acid identity with amino acids 450-868 of SEQ ID NO: 3, at most 90% amino acid identity with amino acids 450-868 of SEQ ID NO: 3 or at most 95% amino acid identity with amino acids 450-868 of SEQ ID NO: 3.
[0099] In other aspects of this embodiment, a BoNT/C1 HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 450-868 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 450-868 of SEQ ID NO: 3. In yet other aspects of this embodiment, a BoNT/C1HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 450-868 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 450-868 of SEQ ID NO: 3. In still other aspects of this embodiment, a BoNT/C1 HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 450-868 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 450-868 of SEQ ID NO: 3.
[0100] In other aspects of this embodiment, a BoNT/C1 HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 450-868 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 450-868 of SEQ ID NO: 3. In yet other aspects of this embodiment, a BoNT/C1 HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 450-868 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 450-868 of SEQ ID NO: 3. In still other aspects of this embodiment, a BoNT/C1 HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 450-868 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 450-868 of SEQ ID NO: 3.
[0101] In another embodiment, a Clostridial toxin translocation domain comprises a BoNT/D HN region. In an aspect of this embodiment, a BoNT/D HN region comprises amino acids 446-864 of SEQ ID NO: 4. In another aspect of this embodiment, a BoNT/D HN region comprises a naturally occurring BoNT/D HN region variant, such as, e.g., a HN region from a BoNT/D isoform or a HN region from a BoNT/D subtype. In another aspect of this embodiment, a BoNT/D HN region comprises amino acids 446-864 of a naturally occurring BoNT/D HN region variant of SEQ ID NO: 4, such as, e.g., amino acids 446-864 of a BoNT/D isoform of SEQ ID NO: 4 or amino acids 446-864 of a BoNT/D subtype of SEQ ID NO: 4. In still another aspect of this embodiment, a BoNT/D HN region comprises a non-naturally occurring BoNT/D HN region variant, such as, e.g., a conservative BoNT/D HN region variant, a non-conservative BoNT/D HN region variant, a BoNT/D chimeric HN region, an active BoNT/D HN region fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/D HN region comprises amino acids 446-864 of a non-naturally occurring BoNT/D HN region variant of SEQ ID NO: 4, such as, e.g., amino acids 446-864 of a conservative BoNT/D HN region variant of SEQ ID NO: 4, amino acids 446-864 of a non-conservative BoNT/D HN region variant of SEQ ID NO: 4, amino acids 446-864 of an active BoNT/D HN region fragment of SEQ ID NO: 4, or any combination thereof.
[0102] In other aspects of this embodiment, a BoNT/D HN region comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 446-864 of SEQ ID NO: 4, at least 75% amino acid identity with amino acids 446-864 of SEQ ID NO: 4, at least 80% amino acid identity with amino acids 446-864 of SEQ ID NO: 4, at least 85% amino acid identity with amino acids 446-864 of SEQ ID NO: 4, at least 90% amino acid identity with amino acids 446-864 of SEQ ID NO: 4 or at least 95% amino acid identity with amino acids 446-864 of SEQ ID NO: 4. In yet other aspects of this embodiment, a BoNT/D HN region comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 446-864 of SEQ ID NO: 4, at most 75% amino acid identity with amino acids 446-864 of SEQ ID NO: 4, at most 80% amino acid identity with amino acids 446-864 of SEQ ID NO: 4, at most 85% amino acid identity with amino acids 446-864 of SEQ ID NO: 4, at most 90% amino acid identity with amino acids 446-864 of SEQ ID NO: 4 or at most 95% amino acid identity with amino acids 446-864 of SEQ ID NO: 4.
[0103] In other aspects of this embodiment, a BoNT/D HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 446-864 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 446-864 of SEQ ID NO: 4. In yet other aspects of this embodiment, a BoNT/D HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 446-864 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 446-864 of SEQ ID NO: 4. In still other aspects of this embodiment, a BoNT/D HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 446-864 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 446-864 of SEQ ID NO: 4.
[0104] In other aspects of this embodiment, a BoNT/D HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 446-864 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 446-864 of SEQ ID NO: 4. In yet other aspects of this embodiment, a BoNT/D HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 446-864 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 446-864 of SEQ ID NO: 4. In still other aspects of this embodiment, a BoNT/D HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 446-864 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 446-864 of SEQ ID NO: 4.
[0105] In another embodiment, a Clostridial toxin translocation domain comprises a BoNT/E HN region. In an aspect of this embodiment, a BoNT/E HN region comprises amino acids 423-847 of SEQ ID NO: 5. In another aspect of this embodiment, a BoNT/E HN region comprises a naturally occurring BoNT/E HN region variant, such as, e.g., a HN region from a BoNT/E isoform or a HN region from a BoNT/E subtype. In another aspect of this embodiment, a BoNT/E HN region comprises amino acids 423-847 of a naturally occurring BoNT/E HN region variant of SEQ ID NO: 5, such as, e.g., amino acids 423-847 of a BoNT/E isoform of SEQ ID NO: 5 or amino acids 423-847 of a BoNT/E subtype of SEQ ID NO: 5. In still another aspect of this embodiment, a BoNT/E HN region comprises a non-naturally occurring BoNT/E HN region variant, such as, e.g., a conservative BoNT/E HN region variant, a non-conservative BoNT/E HN region variant, a BoNT/E chimeric HN region, an active BoNT/E HN region fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/E HN region comprises amino acids 423-847 of a non-naturally occurring BoNT/E HN region variant of SEQ ID NO: 5, such as, e.g., amino acids 423-847 of a conservative BoNT/E HN region variant of SEQ ID NO: 5, amino acids 423-847 of a non-conservative BoNT/E HN region variant of SEQ ID NO: 5, amino acids 423-847 of an active BoNT/E HN region fragment of SEQ ID NO: 5, or any combination thereof.
[0106] In other aspects of this embodiment, a BoNT/E HN region comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 423-847 of SEQ ID NO: 5, at least 75% amino acid identity with amino acids 423-847 of SEQ ID NO: 5, at least 80% amino acid identity with amino acids 423-847 of SEQ ID NO: 5, at least 85% amino acid identity with amino acids 423-847 of SEQ ID NO: 5, at least 90% amino acid identity with amino acids 423-847 of SEQ ID NO: 5 or at least 95% amino acid identity with amino acids 423-847 of SEQ ID NO: 5. In yet other aspects of this embodiment, a BoNT/E HN region comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 423-847 of SEQ ID NO: 5, at most 75% amino acid identity with amino acids 423-847 of SEQ ID NO: 5, at most 80% amino acid identity with amino acids 423-847 of SEQ ID NO: 5, at most 85% amino acid identity with amino acids 423-847 of SEQ ID NO: 5, at most 90% amino acid identity with amino acids 423-847 of SEQ ID NO: 5 or at most 95% amino acid identity with amino acids 423-847 of SEQ ID NO: 5.
[0107] In other aspects of this embodiment, a BoNT/E HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 423-847 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 423-847 of SEQ ID NO: 5. In yet other aspects of this embodiment, a BoNT/E HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 423-847 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 423-847 of SEQ ID NO: 5. In still other aspects of this embodiment, a BoNT/E HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 423-847 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 423-847 of SEQ ID NO: 5.
[0108] In other aspects of this embodiment, a BoNT/E HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 423-847 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 423-847 of SEQ ID NO: 5. In yet other aspects of this embodiment, a BoNT/E HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 423-847 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 423-847 of SEQ ID NO: 5. In still other aspects of this embodiment, a BoNT/E HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 423-847 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 423-847 of SEQ ID NO: 5.
[0109] In another embodiment, a Clostridial toxin translocation domain comprises a BoNT/F HN region. In an aspect of this embodiment, a BoNT/F HN region comprises amino acids 440-866 of SEQ ID NO: 6. In another aspect of this embodiment, a BoNT/F HN region comprises a naturally occurring BoNT/F HN region variant, such as, e.g., a HN region from a BoNT/F isoform or a HN region from a BoNT/F subtype. In another aspect of this embodiment, a BoNT/F HN region comprises amino acids 440-866 of a naturally occurring BoNT/F HN region variant of SEQ ID NO: 6, such as, e.g., amino acids 440-866 of a BoNT/F isoform of SEQ ID NO: 6 or amino acids 440-866 of a BoNT/F subtype of SEQ ID NO: 6. In still another aspect of this embodiment, a BoNT/F HN region comprises a non-naturally occurring BoNT/F HN region variant, such as, e.g., a conservative BoNT/F HN region variant, a non-conservative BoNT/F HN region variant, a BoNT/F chimeric HN region, an active BoNT/F HN region fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/F HN region comprises amino acids 440-866 of a non-naturally occurring BoNT/F HN region variant of SEQ ID NO: 6, such as, e.g., amino acids 440-866 of a conservative BoNT/F HN region variant of SEQ ID NO: 6, amino acids 440-866 of a non-conservative BoNT/F HN region variant of SEQ ID NO: 6, amino acids 440-866 of an active BoNT/F HN region fragment of SEQ ID NO: 6, or any combination thereof.
[0110] In other aspects of this embodiment, a BoNT/F HN region comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 440-866 of SEQ ID NO: 6, at least 75% amino acid identity with amino acids 440-866 of SEQ ID NO: 6, at least 80% amino acid identity with amino acids 440-866 of SEQ ID NO: 6, at least 85% amino acid identity with amino acids 440-866 of SEQ ID NO: 6, at least 90% amino acid identity with amino acids 440-866 of SEQ ID NO: 6 or at least 95% amino acid identity with amino acids 440-866 of SEQ ID NO: 6. In yet other aspects of this embodiment, a BoNT/F HN region comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 440-866 of SEQ ID NO: 6, at most 75% amino acid identity with amino acids 440-866 of SEQ ID NO: 6, at most 80% amino acid identity with amino acids 440-866 of SEQ ID NO: 6, at most 85% amino acid identity with amino acids 440-866 of SEQ ID NO: 6, at most 90% amino acid identity with amino acids 440-866 of SEQ ID NO: 6 or at most 95% amino acid identity with amino acids 440-866 of SEQ ID NO: 6.
[0111] In other aspects of this embodiment, a BoNT/F HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 440-866 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 440-866 of SEQ ID NO: 6. In yet other aspects of this embodiment, a BoNT/F HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 440-866 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 440-866 of SEQ ID NO: 6. In still other aspects of this embodiment, a BoNT/F HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 440-866 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 440-866 of SEQ ID NO: 6.
[0112] In other aspects of this embodiment, a BoNT/F HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 440-866 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 440-866 of SEQ ID NO: 6. In yet other aspects of this embodiment, a BoNT/F HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 440-866 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 440-866 of SEQ ID NO: 6. In still other aspects of this embodiment, a BoNT/F HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 440-866 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 440-866 of SEQ ID NO: 6.
[0113] In another embodiment, a Clostridial toxin translocation domain comprises a BoNT/G HN region. In an aspect of this embodiment, a BoNT/G HN region comprises amino acids 447-865 of SEQ ID NO: 7. In another aspect of this embodiment, a BoNT/G HN region comprises a naturally occurring BoNT/G HN region variant, such as, e.g., a HN region from a BoNT/G isoform or a HN region from a BoNT/G subtype. In another aspect of this embodiment, a BoNT/G HN region comprises amino acids 447-865 of a naturally occurring BoNT/G HN region variant of SEQ ID NO: 7, such as, e.g., amino acids 447-865 of a BoNT/G isoform of SEQ ID NO: 7 or amino acids 447-865 of a BoNT/G subtype of SEQ ID NO: 7. In still another aspect of this embodiment, a BoNT/G HN region comprises a non-naturally occurring BoNT/G HN region variant, such as, e.g., a conservative BoNT/G HN region variant, a non-conservative BoNT/G HN region variant, a BoNT/G chimeric HN region, an active BoNT/G HN region fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/G HN region comprises amino acids 447-865 of a non-naturally occurring BoNT/G HN region variant of SEQ ID NO: 7, such as, e.g., amino acids 447-865 of a conservative BoNT/G HN region variant of SEQ ID NO: 7, amino acids 447-865 of a non-conservative BoNT/G HN region variant of SEQ ID NO: 7, amino acids 447-865 of an active BoNT/G HN region fragment of SEQ ID NO: 7, or any combination thereof.
[0114] In other aspects of this embodiment, a BoNT/G HN region comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 447-865 of SEQ ID NO: 7, at least 75% amino acid identity with amino acids 447-865 of SEQ ID NO: 7, at least 80% amino acid identity with amino acids 447-865 of SEQ ID NO: 7, at least 85% amino acid identity with amino acids 447-865 of SEQ ID NO: 7, at least 90% amino acid identity with amino acids 447-865 of SEQ ID NO: 7 or at least 95% amino acid identity with amino acids 447-865 of SEQ ID NO: 7. In yet other aspects of this embodiment, a BoNT/G HN region comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 447-865 of SEQ ID NO: 7, at most 75% amino acid identity with amino acids 447-865 of SEQ ID NO: 7, at most 80% amino acid identity with amino acids 447-865 of SEQ ID NO: 7, at most 85% amino acid identity with amino acids 447-865 of SEQ ID NO: 7, at most 90% amino acid identity with amino acids 447-865 of SEQ ID NO: 7 or at most 95% amino acid identity with amino acids 447-865 of SEQ ID NO: 7.
[0115] In other aspects of this embodiment, a BoNT/G HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 447-865 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 447-865 of SEQ ID NO: 7. In yet other aspects of this embodiment, a BoNT/G HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 447-865 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 447-865 of SEQ ID NO: 7. In still other aspects of this embodiment, a BoNT/G HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 447-865 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 447-865 of SEQ ID NO: 7.
[0116] In other aspects of this embodiment, a BoNT/G HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 447-865 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 447-865 of SEQ ID NO: 7. In yet other aspects of this embodiment, a BoNT/G HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 447-865 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 447-865 of SEQ ID NO: 7. In still other aspects of this embodiment, a BoNT/G HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 447-865 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 447-865 of SEQ ID NO: 7.
[0117] In another embodiment, a Clostridial toxin translocation domain comprises a TeNT HN region. In an aspect of this embodiment, a TeNT HN region comprises amino acids 458-881 of SEQ ID NO: 8. In another aspect of this embodiment, a TeNT HN region comprises a naturally occurring TeNT HN region variant, such as, e.g., a HN region from a TeNT isoform or a HN region from a TeNT subtype. In another aspect of this embodiment, a TeNT HN region comprises amino acids 458-881 of a naturally occurring TeNT HN region variant of SEQ ID NO: 8, such as, e.g., amino acids 458-881 of a TeNT isoform of SEQ ID NO: 8 or amino acids 458-881 of a TeNT subtype of SEQ ID NO: 8. In still another aspect of this embodiment, a TeNT HN region comprises a non-naturally occurring TeNT HN region variant, such as, e.g., a conservative TeNT HN region variant, a non-conservative TeNT HN region variant, a TeNT chimeric HN region, an active TeNT HN region fragment, or any combination thereof. In still another aspect of this embodiment, a TeNT HN region comprises amino acids 458-881 of a non-naturally occurring TeNT HN region variant of SEQ ID NO: 8, such as, e.g., amino acids 458-881 of a conservative TeNT HN region variant of SEQ ID NO: 8, amino acids 458-881 of a non-conservative TeNT HN region variant of SEQ ID NO: 8, amino acids 458-881 of an active TeNT HN region fragment of SEQ ID NO: 8, or any combination thereof.
[0118] In other aspects of this embodiment, a TeNT HN region comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 458-881 of SEQ ID NO: 8, at least 75% amino acid identity with amino acids 458-881 of SEQ ID NO: 8, at least 80% amino acid identity with amino acids 458-881 of SEQ ID NO: 8, at least 85% amino acid identity with amino acids 458-881 of SEQ ID NO: 8, at least 90% amino acid identity with amino acids 458-881 of SEQ ID NO: 8 or at least 95% amino acid identity with amino acids 458-881 of SEQ ID NO: 8. In yet other aspects of this embodiment, a TeNT HN region comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 458-881 of SEQ ID NO: 8, at most 75% amino acid identity with amino acids 458-881 of SEQ ID NO: 8, at most 80% amino acid identity with amino acids 458-881 of SEQ ID NO: 8, at most 85% amino acid identity with amino acids 458-881 of SEQ ID NO: 8, at most 90% amino acid identity with amino acids 458-881 of SEQ ID NO: 8 or at most 95% amino acid identity with amino acids 458-881 of SEQ ID NO: 8.
[0119] In other aspects of this embodiment, a TeNT HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 458-881 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid substitutions relative to amino acids 458-881 of SEQ ID NO: 8. In yet other aspects of this embodiment, a TeNT HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 458-881 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid deletions relative to amino acids 458-881 of SEQ ID NO: 8. In still other aspects of this embodiment, a TeNT HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 458-881 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 non-contiguous amino acid additions relative to amino acids 458-881 of SEQ ID NO: 8.
[0120] In other aspects of this embodiment, a TeNT HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 458-881 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid substitutions relative to amino acids 458-881 of SEQ ID NO: 8. In yet other aspects of this embodiment, a TeNT HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 458-881 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid deletions relative to amino acids 458-881 of SEQ ID NO: 8. In still other aspects of this embodiment, a TeNT HN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 458-881 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT HN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100 or 200 contiguous amino acid additions relative to amino acids 458-881 of SEQ ID NO: 8.
[0121] Aspects of the present invention provide, in part, a translocation facilitating domain. As used herein, the term "translocation facilitating domain" means any polypeptide that can further facilitate the translocation step of the intoxication process that mediates Clostridial toxin light chain translocation. Thus, a translocation facilitating domain assists the Clostridial toxin translocation domain in the movement of a Clostridial toxin light chain across a membrane and encompasses the movement of a Clostridial toxin light chain through the membrane of an intracellular vesicle into the cytoplasm of a cell. A non-limiting example of a translocation facilitating domain is a Clostridial toxin translocation facilitating domain, such as, e.g., a Clostridial toxin HCN region such as, e.g., a BoNT/A HCN region, a BoNT/B HCN region, a BoNT/C1 HCN region, a BoNT/D HCN region, a BoNT/E HCN region, a BoNT/F HCN region, a BoNT/G HCN region, and a TeNT HCN region. Another non-limiting example of a translocation facilitating domain is a viral fusogenic peptide domain found in an enveloped virus, such as, e.g., an influenzavirus, an alphavirus, a vesiculovirus, a respirovirus, a morbillivirus, an avulavirus, a henipavirus, a metapneumovirus and a foamy virus.
[0122] Thus, in an embodiment, a translocation facilitating domain facilitates the Clostridial toxin translocation domain in the movement of a Clostridial toxin light chain across a membrane. In aspects of this embodiment, a translocation facilitating domain facilitates the Clostridial toxin translocation domain in the movement of a Clostridial toxin light chain across a membrane by increasing the amount of Clostridial toxin light chain in the cytoplasm by, e.g., at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or at least 100%. In other aspects of this embodiment, a translocation facilitating domain facilitates the Clostridial toxin translocation domain in the movement of a Clostridial toxin light chain across a membrane by increasing the amount of Clostridial toxin light chain in the cytoplasm by, e.g., at least two-fold, at least three-fold, at least four-fold, at least five-fold, at least ten-fold or at least twentγ-fold. In yet other aspects of this embodiment, a translocation facilitating domain facilitates the Clostridial toxin translocation domain in the movement of a Clostridial toxin light chain across a membrane by increasing the amount of Clostridial toxin light chain in the cytoplasm by, e.g., at most 10%, at most 20%, at most 30%, at most 40%, at most 50%, at most 60%, at most 70%, at most 80%, at most 90% or at most 100%. In other aspects of this embodiment, a translocation facilitating domain facilitates the Clostridial toxin translocation domain in the movement of a Clostridial toxin light chain across a membrane by increasing the amount of Clostridial toxin light chain in the cytoplasm by, e.g., at most two-fold, at most three-fold, at most four-fold, at most five-fold, at most ten-fold or at most twentγ-fold.
[0123] A Clostridial toxin "translocation facilitating domain includes, without limitation, naturally occurring Clostridial toxin HCN region variants, such as, e.g., Clostridial toxin HCN region isoforms and Clostridial toxin HCN region subtypes; non-naturally occurring Clostridial toxin HCN region variants, such as, e.g., conservative Clostridial toxin HCN region variants, non-conservative Clostridial toxin HCN region variants, Clostridial toxin HCN region chimerics, active Clostridial toxin HCN region fragments thereof, or any combination thereof.
[0124] As used herein, the term "Clostridial toxin HCN region variant," whether naturally-occurring or non-naturally-occurring, means a Clostridial toxin HCN region that has at least one amino acid change from the corresponding region of the disclosed reference sequences (see Table 1) and can be described in percent identity to the corresponding region of that reference sequence. Unless expressly indicated, all Clostridial toxin HCN region variants disclosed in the present specification are capable of further facilitating the translocation step of the intoxication process that mediates Clostridial toxin light chain translocation. As non-limiting examples, a BoNT/A HCN region variant comprising amino acids 874-1110 of SEQ ID NO: 1 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 874-1110 of SEQ ID NO: 1; a BoNT/B HCN region variant comprising amino acids 861-1097 of SEQ ID NO: 2 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 861-1097 of SEQ ID NO: 2; a BoNT/C1 HCN region variant comprising amino acids 869-1111 of SEQ ID NO: 3 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 869-1111 of SEQ ID NO: 3; a BoNT/D HCN region variant comprising amino acids 865-1098 of SEQ ID NO: 4 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 865-1098 of SEQ ID NO: 4; a BoNT/E HCN region variant comprising amino acids 848-1085 of SEQ ID NO: 5 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 848-1085 of SEQ ID NO: 5; a BoNT/F HCN region variant comprising amino acids 867-1105 of SEQ ID NO: 6 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 867-1105 of SEQ ID NO: 6; a BoNT/G HCN region variant comprising amino acids 866-1105 of SEQ ID NO: 7 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 866-1105 of SEQ ID NO: 7; and a TeNT HCN region variant comprising amino acids 882-1127 of SEQ ID NO: 8 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 882-1127 of SEQ ID NO: 8.
[0125] It is recognized by those of skill in the art that within each serotype of Clostridial toxin there can be naturally occurring Clostridial toxin HCN region variants that differ somewhat in their amino acid sequence, and also in the nucleic acids encoding these proteins. For example, there are presently four BoNT/A subtypes, BoNT/A1, BoNT/A2, BoNT/A3 and BoNT/A4, with specific HCN region subtypes showing approximately 87% amino acid identity when compared to another BoNT/A HCN region subtype. As used herein, the term "naturally occurring Clostridial toxin HCN region variant" means any Clostridial toxin HCN region produced by a naturally-occurring process, including, without limitation, Clostridial toxin HCN region isoforms produced from alternatively-spliced transcripts, Clostridial toxin HCN region isoforms produced by spontaneous mutation and Clostridial toxin HCN region subtypes. A naturally occurring Clostridial toxin HCN region variant can function in substantially the same manner as the reference Clostridial toxin HCN region on which the naturally occurring Clostridial toxin HCN region variant is based, and can be substituted for the reference Clostridial toxin HCN region in any aspect of the present invention. A naturally occurring Clostridial toxin HCN region variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, ten or more amino acids, 20 or more amino acids, 30 or more amino acids, 40 or more amino acids or 50 or more amino acids from the reference Clostridial toxin HCN region on which the naturally occurring Clostridial toxin HCN region variant is based. A naturally occurring Clostridial toxin HCN region variant can also substitute at least 10 contiguous amino acids, at least 15 contiguous amino acids, at least 20 contiguous amino acids, or at least 25 contiguous amino acids from the reference Clostridial toxin HCN region on which the naturally occurring Clostridial toxin HCN region variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference Clostridial toxin HCN region on which the naturally occurring Clostridial toxin HCN region variant is based.
[0126] A non-limiting examples of a naturally occurring Clostridial toxin HCN region variant is a Clostridial toxin HCN region isoform such as, e.g., a BoNT/A HCN region isoform, a BoNT/B HCN region isoform, a BoNT/C1 HCN region isoform, a BoNT/D HCN region isoform, a BoNT/E HCN region isoform, a BoNT/F HCN region isoform, a BoNT/G HCN region isoform, and a TeNT HCN region isoform. A Clostridial toxin HCN region isoform can function in substantially the same manner as the reference Clostridial toxin HCN region on which the Clostridial toxin HCN region isoform is based, and can be substituted for the reference Clostridial toxin HCN region in any aspect of the present invention.
[0127] Another non-limiting examples of a naturally occurring Clostridial toxin HCN region variant is a Clostridial toxin HCN region subtype such as, e.g., a HCN region from subtype BoNT/A1, BoNT/A2, BoNT/A3 and BoNT/A4; a HCN region from subtype BoNT/B1, BoNT/B2, BoNT/B bivalent and BoNT/B nonproteolytic; a HCN region from subtype BoNT/C1-1 and BoNT/C1-2; a HCN region from subtype BoNT/E1, BoNT/E2 and BoNT/E3; and a HCN region from subtype BoNT/F1, BoNT/F2, BoNT/F3 and BoNT/F4. A Clostridial toxin HCN region subtype can function in substantially the same manner as the reference Clostridial toxin HCN region on which the Clostridial toxin HCN region subtype is based, and can be substituted for the reference Clostridial toxin HCN region in any aspect of the present invention.
[0128] As used herein, the term "non-naturally occurring Clostridial toxin HCN region variant" means any Clostridial toxin HCN region produced with the aid of human manipulation, including, without limitation, Clostridial toxin HCN regions produced by genetic engineering using random mutagenesis or rational design and Clostridial toxin HCN regions produced by chemical synthesis. Non-limiting examples of non-naturally occurring Clostridial toxin HCN region variants include, e.g., conservative Clostridial toxin HCN region variants, non-conservative Clostridial toxin HCN region variants, Clostridial toxin HCN region chimeric variants and active Clostridial toxin HCN region fragments.
[0129] As used herein, the term "conservative Clostridial toxin HCN region variant" means a Clostridial toxin HCN region that has at least one amino acid substituted by another amino acid or an amino acid analog that has at least one property similar to that of the original amino acid from the reference Clostridial toxin HCN region sequence (Table 1). Examples of properties include, without limitation, similar size, topography, charge, hydrophobicity, hydrophilicity, lipophilicity, covalent-bonding capacity, hydrogen-bonding capacity, a physicochemical property, of the like, or any combination thereof. A conservative Clostridial toxin HCN region variant can function in substantially the same manner as the reference Clostridial toxin HCN region on which the conservative Clostridial toxin HCN region variant is based, and can be substituted for the reference Clostridial toxin HCN region in any aspect of the present invention. A conservative Clostridial toxin HCN region variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, ten or more amino acids, 20 or more amino acids, 30 or more amino acids, 40 or more amino acids, 50 or more amino acids or 100 or more amino acids from the reference Clostridial toxin HCN region on which the conservative Clostridial toxin HCN region variant is based. A conservative Clostridial toxin HCN region variant can also substitute at least 10 contiguous amino acids, at least 15 contiguous amino acids, at least 20 contiguous amino acids, or at least 25 contiguous amino acids from the reference Clostridial toxin HCN region on which the conservative Clostridial toxin HCN region variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference Clostridial toxin HCN region on which the conservative Clostridial toxin HCN region variant is based. Non-limiting examples of a conservative Clostridial toxin HCN region variant include, e.g., conservative BoNT/A HCN region variants, conservative BoNT/B HCN region variants, conservative BoNT/C1 HCN region variants, conservative BoNT/D HCN region variants, conservative BoNT/E HCN region variants, conservative BoNT/F HCN region variants, conservative BoNT/G HCN region variants, and conservative TeNT HCN region variants.
[0130] As used herein, the term "non-conservative Clostridial toxin HCN region variant" means a Clostridial toxin HCN region in which 1) at least one amino acid is deleted from the reference Clostridial toxin HCN region on which the non-conservative Clostridial toxin HCN region variant is based; 2) at least one amino acid added to the reference Clostridial toxin HCN region on which the non-conservative Clostridial toxin HCN region is based; or 3) at least one amino acid is substituted by another amino acid or an amino acid analog that does not share any property similar to that of the original amino acid from the reference Clostridial toxin HCN region sequence (Table 1). A non-conservative Clostridial toxin HCN region variant can function in substantially the same manner as the reference Clostridial toxin HCN region on which the non-conservative Clostridial toxin HCN region variant is based, and can be substituted for the reference Clostridial toxin HCN region in any aspect of the present invention. A non-conservative Clostridial toxin HCN region variant can delete one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, and ten or more amino acids from the reference Clostridial toxin HCN region on which the non-conservative Clostridial toxin HCN region variant is based. A non-conservative Clostridial toxin HCN region variant can add one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, and ten or more amino acids to the reference Clostridial toxin HCN region on which the non-conservative Clostridial toxin HCN region variant is based. A non-conservative Clostridial toxin HCN region variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, ten or more amino acids, 20 or more amino acids, 30 or more amino acids, 40 or more amino acids, 50 or more amino acids or 100 or more amino acids from the reference Clostridial toxin HCN region on which the non-conservative Clostridial toxin HCN region variant is based. A non-conservative Clostridial toxin HCN region variant can also substitute at least 10 contiguous amino acids, at least 15 contiguous amino acids, at least 20 contiguous amino acids, or at least 25 contiguous amino acids from the reference Clostridial toxin HCN region on which the non-conservative Clostridial toxin HCN region variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference Clostridial toxin HCN region on which the non-conservative Clostridial toxin HCN region variant is based. Non-limiting examples of a non-conservative Clostridial toxin HCN region variant include, e.g., non-conservative BoNT/A HCN region variants, non-conservative BoNT/B HCN region variants, non-conservative BoNT/C1 HCN region variants, non-conservative BoNT/D HCN region variants, non-conservative BoNT/E HCN region variants, non-conservative BoNT/F HCN region variants, non-conservative BoNT/G HCN region variants, and non-conservative TeNT HCN region variants.
[0131] As used herein, the term "Clostridial toxin HCN region chimeric" means a polypeptide comprising at least a portion of a Clostridial toxin HCN region and at least a portion of at least one other polypeptide to form a toxin HCN region with at least one property different from the reference Clostridial toxin HCN regions of Table 1, with the proviso that this Clostridial toxin HCN region chimeric is still capable of further facilitating the translocation step of the intoxication process where the LC is released from intracellular vesicles into the cytoplasm of the target cell and thus participate in executing the overall cellular mechanism whereby a Clostridial toxin proteolytically cleaves a substrate.
[0132] As used herein, the term "active Clostridial toxin HCN region fragment" means any of a variety of Clostridial toxin fragments comprising the HCN region can be useful in aspects of the present invention with the proviso that these active fragments can further facilitate the translocation step of the intoxication process where the LC is released from intracellular vesicles into the cytoplasm of the target cell and thus participate in executing the overall cellular mechanism whereby a Clostridial toxin proteolytically cleaves a substrate. The HCN regions from the heavy chains of Clostridial toxins are approximately 230-250 amino acids in length and comprise a translocation domain (Table 1). Additionally, while a specific amino acid positions have been identified to delineate the boundaries of the Clostridial toxin HCN region (Table 1), it is well known in the art that the functional boundaries are not definitive. For example, amino-terminus of the HCN domain for all naturally-occurring Clostridial toxins is the HN domain (translocation domain). In examining the structure for BoNT/A, a random coil linker region forms a boundary between the HN and HCN domains (see FIG. 7A). The BoNT/A HN domain appears to end with an α-helix comprising amino acids N859 to 1873. Following the α-helix there is a random coil (1873 to 1878) that leads into the HCN domain where a β-sheet begins at position 1878. The above residues define boundaries at the beginning or end of defined secondary structures and do not imply that there are not significant interactions (i.e., hydrophobic, H-bond, etc.) between residues in the random coil region and one or both of the domains that it links together. Thus, minimally an amino acid that defines the amino-terminal boundary of the BoNT/A HCN domain comprises can be any amino acid present in the amino acid region Y869 to L879. Similar analysis indicates that minimally, the amino acid that defines the amino-terminal boundary of the BoNT/B HCN domain can be any amino acid present in the amino acid region Y856 to L866; the amino acid that defines the amino-terminal boundary of the BoNT/C1 HCN domain can be any amino acid present in the amino acid region Y864 to L874; the amino acid that defines the amino-terminal boundary of the BoNT/D HCN domain can be any amino acid present in the amino acid region Y860 to L870; the amino acid that defines the amino-terminal boundary of the BoNT/E HCN domain can be any amino acid present in the amino acid region F843 to L853; the amino acid that defines the amino-terminal boundary of the BoNT/F HCN domain can be any amino acid present in the amino acid region L862 to L872; the amino acid that defines the amino-terminal boundary of the BoNT/G HCN domain can be any amino acid present in the amino acid region Y861 to L871; and the amino acid that defines the amino-terminal boundary of the TeNT HCN domain can be any amino acid present in the amino acid region 1877 to L887.
[0133] Similarly, the carboxyl-terminal portion of the HCN domain (i.e., the fusion point between the HCN and HCC domains) all naturally-occurring Clostridial toxins comprises a range of amino acids. In defining the boundary of the BoNT/A HCN domain as the beginning or the end of ordered secondary structure, the HCN domain could end at Q1091 of an α-helix and the HCC domain could begin at K1109 of a β-strand (see FIG. 7B). The intervening amino acid sequence between these two domains comprises a longer random coil but, this does not imply that the random coil is not structurally important. In fact, this random coil has a great deal of interaction with both the HCN and HCC domains (i.e., hydrophobic and H-bonding). Thus, minimally an amino acid that defines the carboxyl-terminal boundary of the BoNT/A HCN domain comprises can be any amino acid present in the amino acid region D1089 to Y1111. Similar analysis indicates that minimally, the amino acid that defines the carboxyl-terminal boundary of the BoNT/B HCN domain can be any amino acid present in the amino acid region K1076 to Y1098; the amino acid that defines the carboxyl-terminal boundary of the BoNT/C1 HCN domain can be any amino acid present in the amino acid region N1090 to Y1112; the amino acid that defines the carboxyl-terminal boundary of the BoNT/D HCN domain can be any amino acid present in the amino acid region E1077 to Y1099; the amino acid that defines the carboxyl-terminal boundary of the BoNT/E HCN domain can be any amino acid present in the amino acid region S1064 to Y1086; the amino acid that defines the carboxyl-terminal boundary of the BoNT/F HCN domain can be any amino acid present in the amino acid region S1084 to Y1106; the amino acid that defines the carboxyl-terminal boundary of the BoNT/G HCN domain can be any amino acid present in the amino acid region W1084 to Y1106; and the amino acid that defines the carboxyl-terminal boundary of the TeNT HCN domain can be any amino acid present in the amino acid region T1106 to Y1128.
[0134] Thus, aspects of this embodiment can include Clostridial toxin HCN regions comprising a translocation facilitating domain having a length of, e.g., at least 200 amino acids, at least 225 amino acids, at least 250 amino acids and at least 275 amino acids. Other aspects of this embodiment can include Clostridial toxin HCN regions comprising translocation facilitating domain having a length of, e.g., at most 200 amino acids, at most 225 amino acids, at most 250 amino acids and at most 275 amino acids.
[0135] Any of a variety of sequence alignment methods can be used to determine percent identity of naturally-occurring Clostridial toxin HCN region variants and non-naturally-occurring Clostridial toxin HCN region variants, including, without limitation, global methods, local methods and hybrid methods, such as, e.g., segment approach methods. Protocols to determine percent identity are routine procedures within the scope of one skilled in the art and from the teaching herein.
[0136] Thus, in an embodiment, a modified Clostridial toxin disclosed in the present specification comprises a Clostridial toxin translocation domain. In an aspect of this embodiment, a Clostridial toxin translocation domain comprises a naturally occurring Clostridial toxin HCN region variant, such as, e.g., a Clostridial toxin HCN region isoform or a Clostridial toxin HCN region subtype. In another aspect of this embodiment, a Clostridial toxin translocation domain comprises a non-naturally occurring Clostridial toxin HCN region variant, such as, e.g., a conservative Clostridial toxin HCN region variant, a non-conservative Clostridial toxin HCN region variant, a Clostridial toxin chimeric HCN region, an active Clostridial toxin HCN region fragment, or any combination thereof.
[0137] In another embodiment, a Clostridial toxin translocation domain comprises a BoNT/A HCN region. In an aspect of this embodiment, a BoNT/A HCN region comprises amino acids 874-1110 of SEQ ID NO: 1. In another aspect of this embodiment, a BoNT/A HCN region comprises a naturally occurring BoNT/A HCN region variant, such as, e.g., a HCN region from a BoNT/A isoform or a HCN region from a BoNT/A subtype. In another aspect of this embodiment, a BoNT/A HCN region comprises amino acids 874-1110 of a naturally occurring BoNT/A HCN region variant of SEQ ID NO: 1, such as, e.g., amino acids 874-1110 of a BoNT/A isoform of SEQ ID NO: 1 or amino acids 874-1110 of a BoNT/A subtype of SEQ ID NO: 1. In still another aspect of this embodiment, a BoNT/A HCN region comprises a non-naturally occurring BoNT/A HCN region variant, such as, e.g., a conservative BoNT/A HCN region variant, a non-conservative BoNT/A HCN region variant, a BoNT/A chimeric HCN region, an active BoNT/A HCN region fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/A HCN region comprises amino acids 874-1110 of a non-naturally occurring BoNT/A HCN region variant of SEQ ID NO: 1, such as, e.g., amino acids 874-1110 of a conservative BoNT/A HCN region variant of SEQ ID NO: 1, amino acids 874-1110 of a non-conservative BoNT/A HCN region variant of SEQ ID NO: 1, amino acids 874-1110 of an active BoNT/A HCN region fragment of SEQ ID NO: 1, or any combination thereof.
[0138] In other aspects of this embodiment, a BoNT/A HCN region comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 874-1110 of SEQ ID NO: 1, at least 75% amino acid identity with amino acids 874-1110 of SEQ ID NO: 1, at least 80% amino acid identity with amino acids 874-1110 of SEQ ID NO: 1, at least 85% amino acid identity with amino acids 874-1110 of SEQ ID NO: 1, at least 90% amino acid identity with amino acids 874-1110 of SEQ ID NO: 1 or at least 95% amino acid identity with amino acids 874-1110 of SEQ ID NO: 1. In yet other aspects of this embodiment, a BoNT/A HCN region comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 874-1110 of SEQ ID NO: 1, at most 75% amino acid identity with amino acids 874-1110 of SEQ ID NO: 1, at most 80% amino acid identity with amino acids 874-1110 of SEQ ID NO: 1, at most 85% amino acid identity with amino acids 874-1110 of SEQ ID NO: 1, at most 90% amino acid identity with amino acids 874-1110 of SEQ ID NO: 1 or at most 95% amino acid identity with amino acids 874-1110 of SEQ ID NO: 1.
[0139] In other aspects of this embodiment, a BoNT/A HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 874-1110 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid substitutions relative to amino acids 874-1110 of SEQ ID NO: 1. In yet other aspects of this embodiment, a BoNT/A HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid deletions relative to amino acids 874-1110 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid deletions relative to amino acids 874-1110 of SEQ ID NO: 1. In still other aspects of this embodiment, a BoNT/A HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid additions relative to amino acids 874-1110 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid additions relative to amino acids 874-1110 of SEQ ID NO: 1.
[0140] In other aspects of this embodiment, a BoNT/A HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid substitutions relative to amino acids 874-1110 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid substitutions relative to amino acids 874-1110 of SEQ ID NO: 1. In yet other aspects of this embodiment, a BoNT/A HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid deletions relative to amino acids 874-1110 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid deletions relative to amino acids 874-1110 of SEQ ID NO: 1. In still other aspects of this embodiment, a BoNT/A HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid additions relative to amino acids 874-1110 of SEQ ID NO: 1. In other aspects of this embodiment, a BoNT/A HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid additions relative to amino acids 874-1110 of SEQ ID NO: 1.
[0141] In another embodiment, a Clostridial toxin translocation domain comprises a BoNT/B HCN region. In an aspect of this embodiment, a BoNT/B HCN region comprises amino acids 861-1097 of SEQ ID NO: 2. In another aspect of this embodiment, a BoNT/B HCN region comprises a naturally occurring BoNT/B HCN region variant, such as, e.g., a HCN region from a BoNT/B isoform or a HCN region from a BoNT/B subtype. In another aspect of this embodiment, a BoNT/B HCN region comprises amino acids 861-1097 of a naturally occurring BoNT/B HCN region variant of SEQ ID NO: 2, such as, e.g., amino acids 861-1097 of a BoNT/B isoform of SEQ ID NO: 2 or amino acids 861-1097 of a BoNT/B subtype of SEQ ID NO: 2. In still another aspect of this embodiment, a BoNT/B HCN region comprises a non-naturally occurring BoNT/B HCN region variant, such as, e.g., a conservative BoNT/B HCN region variant, a non-conservative BoNT/B HCN region variant, a BoNT/B chimeric HCN region, an active BoNT/B HCN region fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/B HCN region comprises amino acids 861-1097 of a non-naturally occurring BoNT/B HCN region variant of SEQ ID NO: 2, such as, e.g., amino acids 861-1097 of a conservative BoNT/B HCN region variant of SEQ ID NO: 2, amino acids 861-1097 of a non-conservative BoNT/B HCN region variant of SEQ ID NO: 2, amino acids 861-1097 of an active BoNT/B HCN region fragment of SEQ ID NO: 2, or any combination thereof.
[0142] In other aspects of this embodiment, a BoNT/B HCN region comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 861-1097 of SEQ ID NO: 2, at least 75% amino acid identity with amino acids 861-1097 of SEQ ID NO: 2, at least 80% amino acid identity with amino acids 861-1097 of SEQ ID NO: 2, at least 85% amino acid identity with amino acids 861-1097 of SEQ ID NO: 2, at least 90% amino acid identity with amino acids 861-1097 of SEQ ID NO: 2 or at least 95% amino acid identity with amino acids 861-1097 of SEQ ID NO: 2. In yet other aspects of this embodiment, a BoNT/B HCN region comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 861-1097 of SEQ ID NO: 2, at most 75% amino acid identity with amino acids 861-1097 of SEQ ID NO: 2, at most 80% amino acid identity with amino acids 861-1097 of SEQ ID NO: 2, at most 85% amino acid identity with amino acids 861-1097 of SEQ ID NO: 2, at most 90% amino acid identity with amino acids 861-1097 of SEQ ID NO: 2 or at most 95% amino acid identity with amino acids 861-1097 of SEQ ID NO: 2.
[0143] In other aspects of this embodiment, a BoNT/B HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid substitutions relative to amino acids 861-1097 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid substitutions relative to amino acids 861-1097 of SEQ ID NO: 2. In yet other aspects of this embodiment, a BoNT/B HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid deletions relative to amino acids 861-1097 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid deletions relative to amino acids 861-1097 of SEQ ID NO: 2. In still other aspects of this embodiment, a BoNT/B HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid additions relative to amino acids 861-1097 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid additions relative to amino acids 861-1097 of SEQ ID NO: 2.
[0144] In other aspects of this embodiment, a BoNT/B HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid substitutions relative to amino acids 861-1097 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid substitutions relative to amino acids 861-1097 of SEQ ID NO: 2. In yet other aspects of this embodiment, a BoNT/B HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid deletions relative to amino acids 861-1097 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid deletions relative to amino acids 861-1097 of SEQ ID NO: 2. In still other aspects of this embodiment, a BoNT/B HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid additions relative to amino acids 861-1097 of SEQ ID NO: 2. In other aspects of this embodiment, a BoNT/B HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid additions relative to amino acids 861-1097 of SEQ ID NO: 2.
[0145] In another embodiment, a Clostridial toxin translocation domain comprises a BoNT/C1 HCN region. In an aspect of this embodiment, a BoNT/C1 HCN region comprises amino acids 869-1111 of SEQ ID NO: 3. In another aspect of this embodiment, a BoNT/C1 HCN region comprises a naturally occurring BoNT/C1 HCN region variant, such as, e.g., a HCN region from a BoNT/C1 isoform or a HCN region from a BoNT/C1 subtype. In another aspect of this embodiment, a BoNT/C1 HCN region comprises amino acids 869-1111 of a naturally occurring BoNT/C1 HCN region variant of SEQ ID NO: 3, such as, e.g., amino acids 869-1111 of a BoNT/C1 isoform of SEQ ID NO: 3 or amino acids 869-1111 of a BoNT/C1 subtype of SEQ ID NO: 3. In still another aspect of this embodiment, a BoNT/C1 HCN region comprises a non-naturally occurring BoNT/C1 HCN region variant, such as, e.g., a conservative BoNT/C1 HCN region variant, a non-conservative BoNT/C1 HCN region variant, a BoNT/C1 chimeric HCN region, an active BoNT/C1 HCN region fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/C1 HCN region comprises amino acids 869-1111 of a non-naturally occurring BoNT/C1 HCN region variant of SEQ ID NO: 3, such as, e.g., amino acids 869-1111 of a conservative BoNT/C1 HCN region variant of SEQ ID NO: 3, amino acids 869-1111 of a non-conservative BoNT/C1 HCN region variant of SEQ ID NO: 3, amino acids 869-1111 of an active BoNT/C1 HCN region fragment of SEQ ID NO: 3, or any combination thereof.
[0146] In other aspects of this embodiment, a BoNT/C1 HCN region comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 869-1111 of SEQ ID NO: 3, at least 75% amino acid identity with amino acids 869-1111 of SEQ ID NO: 3, at least 80% amino acid identity with amino acids 869-1111 of SEQ ID NO: 3, at least 85% amino acid identity with amino acids 869-1111 of SEQ ID NO: 3, at least 90% amino acid identity with amino acids 869-1111 of SEQ ID NO: 3 or at least 95% amino acid identity with amino acids 869-1111 of SEQ ID NO: 3. In yet other aspects of this embodiment, a BoNT/C1 HCN region comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 869-1111 of SEQ ID NO: 3, at most 75% amino acid identity with amino acids 869-1111 of SEQ ID NO: 3, at most 80% amino acid identity with amino acids 869-1111 of SEQ ID NO: 3, at most 85% amino acid identity with amino acids 869-1111 of SEQ ID NO: 3, at most 90% amino acid identity with amino acids 869-1111 of SEQ ID NO: 3 or at most 95% amino acid identity with amino acids 869-1111 of SEQ ID NO: 3.
[0147] In other aspects of this embodiment, a BoNT/C1 HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 869-1111 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid substitutions relative to amino acids 869-1111 of SEQ ID NO: 3. In yet other aspects of this embodiment, a BoNT/C1 HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid deletions relative to amino acids 869-1111 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid deletions relative to amino acids 869-1111 of SEQ ID NO: 3. In still other aspects of this embodiment, a BoNT/C1 HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid additions relative to amino acids 869-1111 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid additions relative to amino acids 869-1111 of SEQ ID NO: 3.
[0148] In other aspects of this embodiment, a BoNT/C1 HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid substitutions relative to amino acids 869-1111 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid substitutions relative to amino acids 869-1111 of SEQ ID NO: 3. In yet other aspects of this embodiment, a BoNT/C1 HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid deletions relative to amino acids 869-1111 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid deletions relative to amino acids 869-1111 of SEQ ID NO: 3. In still other aspects of this embodiment, a BoNT/C1 HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid additions relative to amino acids 869-1111 of SEQ ID NO: 3. In other aspects of this embodiment, a BoNT/C1 HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid additions relative to amino acids 869-1111 of SEQ ID NO: 3.
[0149] In another embodiment, a Clostridial toxin translocation domain comprises a BoNT/D HCN region. In an aspect of this embodiment, a BoNT/D HCN region comprises amino acids 865-1098 of SEQ ID NO: 4. In another aspect of this embodiment, a BoNT/D HCN region comprises a naturally occurring BoNT/D HCN region variant, such as, e.g., a HCN region from a BoNT/D isoform or a HCN region from a BoNT/D subtype. In another aspect of this embodiment, a BoNT/D HCN region comprises amino acids 865-1098 of a naturally occurring BoNT/D HCN region variant of SEQ ID NO: 4, such as, e.g., amino acids 865-1098 of a BoNT/D isoform of SEQ ID NO: 4 or amino acids 865-1098 of a BoNT/D subtype of SEQ ID NO: 4. In still another aspect of this embodiment, a BoNT/D HCN region comprises a non-naturally occurring BoNT/D HCN region variant, such as, e.g., a conservative BoNT/D HCN region variant, a non-conservative BoNT/D HCN region variant, a BoNT/D chimeric HCN region, an active BoNT/D HCN region fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/D HCN region comprises amino acids 865-1098 of a non-naturally occurring BoNT/D HCN region variant of SEQ ID NO: 4, such as, e.g., amino acids 865-1098 of a conservative BoNT/D HCN region variant of SEQ ID NO: 4, amino acids 865-1098 of a non-conservative BoNT/D HCN region variant of SEQ ID NO: 4, amino acids 865-1098 of an active BoNT/D HCN region fragment of SEQ ID NO: 4, or any combination thereof.
[0150] In other aspects of this embodiment, a BoNT/D HCN region comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 865-1098 of SEQ ID NO: 4, at least 75% amino acid identity with amino acids 865-1098 of SEQ ID NO: 4, at least 80% amino acid identity with amino acids 865-1098 of SEQ ID NO: 4, at least 85% amino acid identity with amino acids 865-1098 of SEQ ID NO: 4, at least 90% amino acid identity with amino acids 865-1098 of SEQ ID NO: 4 or at least 95% amino acid identity with amino acids 865-1098 of SEQ ID NO: 4. In yet other aspects of this embodiment, a BoNT/D HCN region comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 865-1098 of SEQ ID NO: 4, at most 75% amino acid identity with amino acids 865-1098 of SEQ ID NO: 4, at most 80% amino acid identity with amino acids 865-1098 of SEQ ID NO: 4, at most 85% amino acid identity with amino acids 865-1098 of SEQ ID NO: 4, at most 90% amino acid identity with amino acids 865-1098 of SEQ ID NO: 4 or at most 95% amino acid identity with amino acids 865-1098 of SEQ ID NO: 4.
[0151] In other aspects of this embodiment, a BoNT/D HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 865-1098 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid substitutions relative to amino acids 865-1098 of SEQ ID NO: 4. In yet other aspects of this embodiment, a BoNT/D HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid deletions relative to amino acids 865-1098 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid deletions relative to amino acids 865-1098 of SEQ ID NO: 4. In still other aspects of this embodiment, a BoNT/D HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid additions relative to amino acids 865-1098 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid additions relative to amino acids 865-1098 of SEQ ID NO: 4.
[0152] In other aspects of this embodiment, a BoNT/D HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid substitutions relative to amino acids 865-1098 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid substitutions relative to amino acids 865-1098 of SEQ ID NO: 4. In yet other aspects of this embodiment, a BoNT/D HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid deletions relative to amino acids 865-1098 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid deletions relative to amino acids 865-1098 of SEQ ID NO: 4. In still other aspects of this embodiment, a BoNT/D HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid additions relative to amino acids 865-1098 of SEQ ID NO: 4. In other aspects of this embodiment, a BoNT/D HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid additions relative to amino acids 865-1098 of SEQ ID NO: 4.
[0153] In another embodiment, a Clostridial toxin translocation domain comprises a BoNT/E HCN region. In an aspect of this embodiment, a BoNT/E HCN region comprises amino acids 848-1085 of SEQ ID NO: 5. In another aspect of this embodiment, a BoNT/E HCN region comprises a naturally occurring BoNT/E HCN region variant, such as, e.g., a HCN region from a BoNT/E isoform or a HCN region from a BoNT/E subtype. In another aspect of this embodiment, a BoNT/E HCN region comprises amino acids 848-1085 of a naturally occurring BoNT/E HCN region variant of SEQ ID NO: 5, such as, e.g., amino acids 848-1085 of a BoNT/E isoform of SEQ ID NO: 5 or amino acids 848-1085 of a BoNT/E subtype of SEQ ID NO: 5. In still another aspect of this embodiment, a BoNT/E HCN region comprises a non-naturally occurring BoNT/E HCN region variant, such as, e.g., a conservative BoNT/E HCN region variant, a non-conservative BoNT/E HCN region variant, a BoNT/E chimeric HCN region, an active BoNT/E HCN region fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/E HCN region comprises amino acids 848-1085 of a non-naturally occurring BoNT/E HCN region variant of SEQ ID NO: 5, such as, e.g., amino acids 848-1085 of a conservative BoNT/E HCN region variant of SEQ ID NO: 5, amino acids 848-1085 of a non-conservative BoNT/E HCN region variant of SEQ ID NO: 5, amino acids 848-1085 of an active BoNT/E HCN region fragment of SEQ ID NO: 5, or any combination thereof.
[0154] In other aspects of this embodiment, a BoNT/E HCN region comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 848-1085 of SEQ ID NO: 5, at least 75% amino acid identity with amino acids 848-1085 of SEQ ID NO: 5, at least 80% amino acid identity with amino acids 848-1085 of SEQ ID NO: 5, at least 85% amino acid identity with amino acids 848-1085 of SEQ ID NO: 5, at least 90% amino acid identity with amino acids 848-1085 of SEQ ID NO: 5 or at least 95% amino acid identity with amino acids 848-1085 of SEQ ID NO: 5. In yet other aspects of this embodiment, a BoNT/E HCN region comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 848-1085 of SEQ ID NO: 5, at most 75% amino acid identity with amino acids 848-1085 of SEQ ID NO: 5, at most 80% amino acid identity with amino acids 848-1085 of SEQ ID NO: 5, at most 85% amino acid identity with amino acids 848-1085 of SEQ ID NO: 5, at most 90% amino acid identity with amino acids 848-1085 of SEQ ID NO: 5 or at most 95% amino acid identity with amino acids 848-1085 of SEQ ID NO: 5.
[0155] In other aspects of this embodiment, a BoNT/E HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 848-1085 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid substitutions relative to amino acids 848-1085 of SEQ ID NO: 5. In yet other aspects of this embodiment, a BoNT/E HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid deletions relative to amino acids 848-1085 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid deletions relative to amino acids 848-1085 of SEQ ID NO: 5. In still other aspects of this embodiment, a BoNT/E HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid additions relative to amino acids 848-1085 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid additions relative to amino acids 848-1085 of SEQ ID NO: 5.
[0156] In other aspects of this embodiment, a BoNT/E HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid substitutions relative to amino acids 848-1085 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid substitutions relative to amino acids 848-1085 of SEQ ID NO: 5. In yet other aspects of this embodiment, a BoNT/E HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid deletions relative to amino acids 848-1085 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid deletions relative to amino acids 848-1085 of SEQ ID NO: 5. In still other aspects of this embodiment, a BoNT/E HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid additions relative to amino acids 848-1085 of SEQ ID NO: 5. In other aspects of this embodiment, a BoNT/E HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid additions relative to amino acids 848-1085 of SEQ ID NO: 5.
[0157] In another embodiment, a Clostridial toxin translocation domain comprises a BoNT/F HCN region. In an aspect of this embodiment, a BoNT/F HCN region comprises amino acids 867-1105 of SEQ ID NO: 6. In another aspect of this embodiment, a BoNT/F HCN region comprises a naturally occurring BoNT/F HCN region variant, such as, e.g., a HCN region from a BoNT/F isoform or a HCN region from a BoNT/F subtype. In another aspect of this embodiment, a BoNT/F HCN region comprises amino acids 867-1105 of a naturally occurring BoNT/F HCN region variant of SEQ ID NO: 6, such as, e.g., amino acids 867-1105 of a BoNT/F isoform of SEQ ID NO: 6 or amino acids 867-1105 of a BoNT/F subtype of SEQ ID NO: 6. In still another aspect of this embodiment, a BoNT/F HCN region comprises a non-naturally occurring BoNT/F HCN region variant, such as, e.g., a conservative BoNT/F HCN region variant, a non-conservative BoNT/F HCN region variant, a BoNT/F chimeric HCN region, an active BoNT/F HCN region fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/F HCN region comprises amino acids 867-1105 of a non-naturally occurring BoNT/F HCN region variant of SEQ ID NO: 6, such as, e.g., amino acids 867-1105 of a conservative BoNT/F HCN region variant of SEQ ID NO: 6, amino acids 867-1105 of a non-conservative BoNT/F HCN region variant of SEQ ID NO: 6, amino acids 867-1105 of an active BoNT/F HCN region fragment of SEQ ID NO: 6, or any combination thereof.
[0158] In other aspects of this embodiment, a BoNT/F HCN region comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 867-1105 of SEQ ID NO: 6, at least 75% amino acid identity with amino acids 867-1105 of SEQ ID NO: 6, at least 80% amino acid identity with amino acids 867-1105 of SEQ ID NO: 6, at least 85% amino acid identity with amino acids 867-1105 of SEQ ID NO: 6, at least 90% amino acid identity with amino acids 867-1105 of SEQ ID NO: 6 or at least 95% amino acid identity with amino acids 867-1105 of SEQ ID NO: 6. In yet other aspects of this embodiment, a BoNT/F HCN region comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 867-1105 of SEQ ID NO: 6, at most 75% amino acid identity with amino acids 867-1105 of SEQ ID NO: 6, at most 80% amino acid identity with amino acids 867-1105 of SEQ ID NO: 6, at most 85% amino acid identity with amino acids 867-1105 of SEQ ID NO: 6, at most 90% amino acid identity with amino acids 867-1105 of SEQ ID NO: 6 or at most 95% amino acid identity with amino acids 867-1105 of SEQ ID NO: 6.
[0159] In other aspects of this embodiment, a BoNT/F HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 867-1105 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid substitutions relative to amino acids 867-1105 of SEQ ID NO: 6. In yet other aspects of this embodiment, a BoNT/F HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid deletions relative to amino acids 867-1105 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid deletions relative to amino acids 867-1105 of SEQ ID NO: 6. In still other aspects of this embodiment, a BoNT/F HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid additions relative to amino acids 867-1105 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid additions relative to amino acids 867-1105 of SEQ ID NO: 6.
[0160] In other aspects of this embodiment, a BoNT/F HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid substitutions relative to amino acids 867-1105 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid substitutions relative to amino acids 867-1105 of SEQ ID NO: 6. In yet other aspects of this embodiment, a BoNT/F HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid deletions relative to amino acids 867-1105 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid deletions relative to amino acids 867-1105 of SEQ ID NO: 6. In still other aspects of this embodiment, a BoNT/F HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid additions relative to amino acids 867-1105 of SEQ ID NO: 6. In other aspects of this embodiment, a BoNT/F HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid additions relative to amino acids 867-1105 of SEQ ID NO: 6.
[0161] In another embodiment, a Clostridial toxin translocation domain comprises a BoNT/G HCN region. In an aspect of this embodiment, a BoNT/G HCN region comprises amino acids 866-1105 of SEQ ID NO: 7. In another aspect of this embodiment, a BoNT/G HCN region comprises a naturally occurring BoNT/G HCN region variant, such as, e.g., a HCN region from a BoNT/G isoform or a HCN region from a BoNT/G subtype. In another aspect of this embodiment, a BoNT/G HCN region comprises amino acids 866-1105 of a naturally occurring BoNT/G HCN region variant of SEQ ID NO: 7, such as, e.g., amino acids 866-1105 of a BoNT/G isoform of SEQ ID NO: 7 or amino acids 866-1105 of a BoNT/G subtype of SEQ ID NO: 7. In still another aspect of this embodiment, a BoNT/G HCN region comprises a non-naturally occurring BoNT/G HCN region variant, such as, e.g., a conservative BoNT/G HCN region variant, a non-conservative BoNT/G HCN region variant, a BoNT/G chimeric HCN region, an active BoNT/G HCN region fragment, or any combination thereof. In still another aspect of this embodiment, a BoNT/G HCN region comprises amino acids 866-1105 of a non-naturally occurring BoNT/G HCN region variant of SEQ ID NO: 7, such as, e.g., amino acids 866-1105 of a conservative BoNT/G HCN region variant of SEQ ID NO: 7, amino acids 866-1105 of a non-conservative BoNT/G HCN region variant of SEQ ID NO: 7, amino acids 866-1105 of an active BoNT/G HCN region fragment of SEQ ID NO: 7, or any combination thereof.
[0162] In other aspects of this embodiment, a BoNT/G HCN region comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 866-1105 of SEQ ID NO: 7, at least 75% amino acid identity with amino acids 866-1105 of SEQ ID NO: 7, at least 80% amino acid identity with amino acids 866-1105 of SEQ ID NO: 7, at least 85% amino acid identity with amino acids 866-1105 of SEQ ID NO: 7, at least 90% amino acid identity with amino acids 866-1105 of SEQ ID NO: 7 or at least 95% amino acid identity with amino acids 866-1105 of SEQ ID NO: 7. In yet other aspects of this embodiment, a BoNT/G HCN region comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 866-1105 of SEQ ID NO: 7, at most 75% amino acid identity with amino acids 866-1105 of SEQ ID NO: 7, at most 80% amino acid identity with amino acids 866-1105 of SEQ ID NO: 7, at most 85% amino acid identity with amino acids 866-1105 of SEQ ID NO: 7, at most 90% amino acid identity with amino acids 866-1105 of SEQ ID NO: 7 or at most 95% amino acid identity with amino acids 866-1105 of SEQ ID NO: 7.
[0163] In other aspects of this embodiment, a BoNT/G HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 866-1105 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid substitutions relative to amino acids 866-1105 of SEQ ID NO: 7. In yet other aspects of this embodiment, a BoNT/G HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid deletions relative to amino acids 866-1105 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid deletions relative to amino acids 866-1105 of SEQ ID NO: 7. In still other aspects of this embodiment, a BoNT/G HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid additions relative to amino acids 866-1105 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid additions relative to amino acids 866-1105 of SEQ ID NO: 7.
[0164] In other aspects of this embodiment, a BoNT/G HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid substitutions relative to amino acids 866-1105 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid substitutions relative to amino acids 866-1105 of SEQ ID NO: 7. In yet other aspects of this embodiment, a BoNT/G HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid deletions relative to amino acids 866-1105 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid deletions relative to amino acids 866-1105 of SEQ ID NO: 7. In still other aspects of this embodiment, a BoNT/G HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid additions relative to amino acids 866-1105 of SEQ ID NO: 7. In other aspects of this embodiment, a BoNT/G HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid additions relative to amino acids 866-1105 of SEQ ID NO: 7.
[0165] In another embodiment, a Clostridial toxin translocation domain comprises a TeNT HCN region. In an aspect of this embodiment, a TeNT HCN region comprises amino acids 882-1127 of SEQ ID NO: 8. In another aspect of this embodiment, a TeNT HCN region comprises a naturally occurring TeNT HCN region variant, such as, e.g., a HCN region from a TeNT isoform or a HCN region from a TeNT subtype. In another aspect of this embodiment, a TeNT HCN region comprises amino acids 882-1127 of a naturally occurring TeNT HCN region variant of SEQ ID NO: 8, such as, e.g., amino acids 882-1127 of a TeNT isoform of SEQ ID NO: 8 or amino acids 882-1127 of a TeNT subtype of SEQ ID NO: 8. In still another aspect of this embodiment, a TeNT HCN region comprises a non-naturally occurring TeNT HCN region variant, such as, e.g., a conservative TeNT HCN region variant, a non-conservative TeNT HCN region variant, a TeNT chimeric HCN region, an active TeNT HCN region fragment, or any combination thereof. In still another aspect of this embodiment, a TeNT HCN region comprises amino acids 882-1127 of a non-naturally occurring TeNT HCN region variant of SEQ ID NO: 8, such as, e.g., amino acids 882-1127 of a conservative TeNT HCN region variant of SEQ ID NO: 8, amino acids 882-1127 of a non-conservative TeNT HCN region variant of SEQ ID NO: 8, amino acids 882-1127 of an active TeNT HCN region fragment of SEQ ID NO: 8, or any combination thereof.
[0166] In other aspects of this embodiment, a TeNT HCN region comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 882-1127 of SEQ ID NO: 8, at least 75% amino acid identity with amino acids 882-1127 of SEQ ID NO: 8, at least 80% amino acid identity with amino acids 882-1127 of SEQ ID NO: 8, at least 85% amino acid identity with amino acids 882-1127 of SEQ ID NO: 8, at least 90% amino acid identity with amino acids 882-1127 of SEQ ID NO: 8 or at least 95% amino acid identity with amino acids 882-1127 of SEQ ID NO: 8. In yet other aspects of this embodiment, a TeNT HCN region comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 882-1127 of SEQ ID NO: 8, at most 75% amino acid identity with amino acids 882-1127 of SEQ ID NO: 8, at most 80% amino acid identity with amino acids 882-1127 of SEQ ID NO: 8, at most 85% amino acid identity with amino acids 882-1127 of SEQ ID NO: 8, at most 90% amino acid identity with amino acids 882-1127 of SEQ ID NO: 8 or at most 95% amino acid identity with amino acids 882-1127 of SEQ ID NO: 8.
[0167] In other aspects of this embodiment, a TeNT HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50, 100, or 200 non-contiguous amino acid substitutions relative to amino acids 882-1127 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid substitutions relative to amino acids 882-1127 of SEQ ID NO: 8. In yet other aspects of this embodiment, a TeNT HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid deletions relative to amino acids 882-1127 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid deletions relative to amino acids 882-1127 of SEQ ID NO: 8. In still other aspects of this embodiment, a TeNT HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid additions relative to amino acids 882-1127 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 non-contiguous amino acid additions relative to amino acids 882-1127 of SEQ ID NO: 8.
[0168] In other aspects of this embodiment, a TeNT HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid substitutions relative to amino acids 882-1127 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid substitutions relative to amino acids 882-1127 of SEQ ID NO: 8. In yet other aspects of this embodiment, a TeNT HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid deletions relative to amino acids 882-1127 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid deletions relative to amino acids 882-1127 of SEQ ID NO: 8. In still other aspects of this embodiment, a TeNT HCN region comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid additions relative to amino acids 882-1127 of SEQ ID NO: 8. In other aspects of this embodiment, a TeNT HCN region comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10, 20, 30, 40, 50 or 100 contiguous amino acid additions relative to amino acids 882-1127 of SEQ ID NO: 8.
[0169] The fusion of the membrane of enveloped viruses to a cellular membrane is an essential step in the release of the viral capsule into the cytoplasm of the host cell. This fusion event is mediated by a fusogenic peptide segment present in viral glycoproteins located on the viral membrane and involves either a pH-dependent or pH-independent process, see, e.g., Frederick M. Hughson, Structural Characterization of Viral Fusion Proteins, 5β) Curr. Biol. 158-274 (1128); Trudy G. Morrison, Structure and Function of a Paramyxovirus Fusion Protein, 1304(1) Biochim. Biophys. Acta. 73-84; David J. Schibli and Winfried Weissenhorn, Class I and Class II Viral Fusion Protein Structures Reveal Similar Principles in Membrane Fusion, 21(6) Mol. Membr. Biol. 361-371 (1137). The fusogenic peptide domain comprises a hydrophobic, glycine-rich peptide of approximately 20-30 amino acids that assist in the insertion of the viral capsule into a cellular membrane. Thus, an enveloped virus fusogenic peptide domain can be useful as a translocation facilitating domain.
[0170] An enveloped virus fusogenic peptide domain includes, without limitation, naturally occurring enveloped virus fusogenic peptide domain variants, such as, e.g., enveloped virus fusogenic peptide domain isoforms and enveloped virus fusogenic peptide domain subtypes; non-naturally occurring enveloped virus fusogenic peptide domain variants, such as, e.g., conservative enveloped virus fusogenic peptide domain variants, non-conservative enveloped virus fusogenic peptide domain variants, enveloped virus fusogenic peptide domain chimerics, active enveloped virus fusogenic peptide domain fragments thereof, or any combination thereof.
[0171] As used herein, the term "enveloped virus fusogenic peptide domain variant," whether naturally-occurring or non-naturally-occurring, means an enveloped virus fusogenic peptide domain that has at least one amino acid change from the corresponding region of the disclosed reference sequences and can be described in percent identity to the corresponding region of that reference sequence. Unless expressly indicated, all Clostridial toxin HCN region variants disclosed in the present specification are capable of further facilitating the translocation step of the intoxication process that mediates Clostridial toxin light chain translocation. As non-limiting examples, an Influenza virus A fusogenic peptide domain variant comprising SEQ ID NO: 87 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to SEQ ID NO: 87; a Semliki Forest virus fusogenic peptide domain variant comprising SEQ ID NO: 92 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to SEQ ID NO: 92; an Eastern equine encephalitis virus fusogenic peptide domain variant comprising SEQ ID NO: 94 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to SEQ ID NO: 94; a Venezuelan equine encephalitis virus fusogenic peptide domain variant comprising SEQ ID NO: 102 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to SEQ ID NO: 102; a Vesicular stomatitis virus fusogenic peptide domain variant comprising SEQ ID NO: 119 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to SEQ ID NO: 119; a Sendai virus fusogenic peptide domain variant comprising SEQ ID NO: 130 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to SEQ ID NO: 130; a Canine distemper virus fusogenic peptide domain variant comprising SEQ ID NO: 137 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to SEQ ID NO: 137; a Newcastle disease virus fusogenic peptide domain variant comprising SEQ ID NO: 147 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to SEQ ID NO: 147; and a Hendra virus fusogenic peptide domain variant comprising SEQ ID NO: 160 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to SEQ ID NO: 160.
[0172] It is recognized by those of skill in the art that for each enveloped virus there can be naturally occurring fusogenic peptide domain variants that differ somewhat in their amino acid sequence, and also in the nucleic acids encoding these proteins. For example, at least five naturally-occurring variants of the fusogenic peptide domain present in the Influenza A virus haemagglutinin are known (SEQ ID NO: 87 to SEQ ID NO: 91); at least six naturally-occurring variants of the fusogenic peptide domain present in the Eastern equine encephalitis virus E1 protein are known (SEQ ID NO: 94 to SEQ ID NO: 99); at least eight naturally-occurring variants of the fusogenic peptide domain present in the Venezuelan equine encephalitis virus E1 protein are known (SEQ ID NO: 102 to SEQ ID NO: 109); at least seven naturally-occurring variants of the fusogenic peptide domain present in the Vesicular stomatitis virus (VSV) glycoprotein G are known (SEQ ID NO: 119 to SEQ ID NO: 125); and at least eleven naturally-occurring variants of the fusogenic peptide domain present in the Newcastle disease virus F protein are known (SEQ ID NO: 147 to SEQ ID NO: 157). As used herein, the term "enveloped virus fusogenic peptide domain variant" means any enveloped virus fusogenic peptide domain produced by a naturally-occurring process, including, without limitation, enveloped virus fusogenic peptide domain isoforms produced from alternatively-spliced transcripts, enveloped virus fusogenic peptide domain isoforms produced by spontaneous mutation and enveloped virus fusogenic peptide domain subtypes. A naturally occurring enveloped virus fusogenic peptide domain variant can function in substantially the same manner as the reference enveloped virus fusogenic peptide domain on which the naturally occurring enveloped virus fusogenic peptide domain variant is based, and can be substituted for the reference enveloped virus fusogenic peptide domain in any aspect of the present invention. A naturally occurring enveloped virus fusogenic peptide domain variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids or ten or more amino acids from the reference enveloped virus fusogenic peptide domain on which the naturally occurring enveloped virus fusogenic peptide domain is based. A naturally occurring enveloped virus fusogenic peptide domain variant can also substitute at least 2 contiguous amino acids, at least 3 contiguous amino acids, at least 4 contiguous amino acids or at least 5 contiguous amino acids from the reference enveloped virus fusogenic peptide domain on which the naturally occurring enveloped virus fusogenic peptide domain variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference enveloped virus fusogenic peptide domain on which the naturally occurring enveloped virus fusogenic peptide domain variant is based.
[0173] A non-limiting examples of a naturally occurring enveloped virus fusogenic peptide domain variant is a enveloped virus fusogenic peptide domain isoform such as, e.g., an influenzavirus fusogenic peptide domain isoform, an alphavirus fusogenic peptide domain isoform, a vesiculovirus fusogenic peptide domain isoform, a respirovirus fusogenic peptide domain isoform, a morbillivirus fusogenic peptide domain isoform, an avulavirus fusogenic peptide domain isoform, a henipavirus fusogenic peptide domain isoform, a metapneumovirus fusogenic peptide domain isoform and a foamy virus fusogenic peptide domain isoform. An enveloped virus fusogenic peptide domain isoform can function in substantially the same manner as the reference enveloped virus fusogenic peptide domain on which the enveloped virus fusogenic peptide domain isoform is based, and can be substituted for the reference enveloped virus fusogenic peptide domain in any aspect of the present invention.
[0174] A non-limiting examples of a naturally occurring enveloped virus fusogenic peptide domain variant is a enveloped virus fusogenic peptide domain subtype such as, e.g., an influenzavirus fusogenic peptide domain subtype, an alphavirus fusogenic peptide domain subtype, a vesiculovirus fusogenic peptide domain subtype, a respirovirus fusogenic peptide domain subtype, a morbillivirus fusogenic peptide domain subtype, an avulavirus fusogenic peptide domain subtype, a henipavirus fusogenic peptide domain subtype, a metapneumovirus fusogenic peptide domain subtype and a foamy virus fusogenic peptide domain subtype. An enveloped virus fusogenic peptide domain subtype can function in substantially the same manner as the reference enveloped virus fusogenic peptide domain on which the enveloped virus fusogenic peptide domain subtype is based, and can be substituted for the reference enveloped virus fusogenic peptide domain in any aspect of the present invention.
[0175] As used herein, the term "non-naturally occurring enveloped virus fusogenic peptide domain variant" means any enveloped virus fusogenic peptide domain produced with the aid of human manipulation, including, without limitation, enveloped virus fusogenic peptide domains produced by genetic engineering using random mutagenesis or rational design and enveloped virus fusogenic peptide domains produced by chemical synthesis. Non-limiting examples of non-naturally occurring enveloped virus fusogenic peptide domain variants include, e.g., conservative enveloped virus fusogenic peptide domain variants, non-conservative enveloped virus fusogenic peptide domain variants, enveloped virus fusogenic peptide domain chimeric variants and active enveloped virus fusogenic peptide domain fragments.
[0176] As used herein, the term "conservative enveloped virus fusogenic peptide domain variant" means a enveloped virus fusogenic peptide domain that has at least one amino acid substituted by another amino acid or an amino acid analog that has at least one property similar to that of the original amino acid from the reference enveloped virus fusogenic peptide domain sequence. Examples of properties include, without limitation, similar size, topography, charge, hydrophobicity, hydrophilicity, lipophilicity, covalent-bonding capacity, hydrogen-bonding capacity, a physicochemical property, of the like, or any combination thereof. A conservative enveloped virus fusogenic peptide domain variant can function in substantially the same manner as the reference enveloped virus fusogenic peptide domain on which the conservative enveloped virus fusogenic peptide domain variant is based, and can be substituted for the reference enveloped virus fusogenic peptide domain in any aspect of the present invention. A conservative enveloped virus fusogenic peptide domain variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids or ten or more amino acids from the reference enveloped virus fusogenic peptide domain on which the conservative enveloped virus fusogenic peptide domain variant is based. A conservative enveloped virus fusogenic peptide domain variant can also substitute at least 2 contiguous amino acids, at least 3 contiguous amino acids, at least 4 contiguous amino acids or at least 5 contiguous amino acids from the reference enveloped virus fusogenic peptide domain on which the conservative enveloped virus fusogenic peptide domain variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference enveloped virus fusogenic peptide domain on which the conservative enveloped virus fusogenic peptide domain variant is based. Non-limiting examples of a conservative enveloped virus fusogenic peptide domain variant include, e.g., conservative influenzavirus fusogenic peptide domain variants, conservative alphavirus fusogenic peptide domain variants, conservative vesiculovirus fusogenic peptide domain variants, conservative respirovirus fusogenic peptide domain variants, conservative morbillivirus fusogenic peptide domain variants, conservative avulavirus fusogenic peptide domain variants, conservative henipavirus fusogenic peptide domain variants, conservative metapneumovirus fusogenic peptide domain variants and conservative foamy virus fusogenic peptide domain variants.
[0177] As used herein, the term "non-conservative enveloped virus fusogenic peptide domain variant" means a enveloped virus fusogenic peptide domain in which 1) at least one amino acid is deleted from the reference enveloped virus fusogenic peptide domain on which the non-conservative enveloped virus fusogenic peptide domain variant is based; 2) at least one amino acid added to the reference enveloped virus fusogenic peptide domain on which the non-conservative enveloped virus fusogenic peptide domain is based; or 3) at least one amino acid is substituted by another amino acid or an amino acid analog that does not share any property similar to that of the original amino acid from the reference enveloped virus fusogenic peptide domain sequence. A non-conservative enveloped virus fusogenic peptide domain variant can function in substantially the same manner as the reference enveloped virus fusogenic peptide domain on which the non-conservative enveloped virus fusogenic peptide domain variant is based, and can be substituted for the reference enveloped virus fusogenic peptide domain in any aspect of the present invention. A non-conservative enveloped virus fusogenic peptide domain variant can delete one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids or five or more amino acids from the reference enveloped virus fusogenic peptide domain on which the non-conservative enveloped virus fusogenic peptide domain variant is based. A non-conservative enveloped virus fusogenic peptide domain variant can add one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids or five or more amino acids to the reference enveloped virus fusogenic peptide domain on which the non-conservative enveloped virus fusogenic peptide domain variant is based. A non-conservative enveloped virus fusogenic peptide domain variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids or ten or more amino acids from the reference enveloped virus fusogenic peptide domain on which the non-conservative enveloped virus fusogenic peptide domain variant is based. A non-conservative enveloped virus fusogenic peptide domain variant can also substitute at least 2 contiguous amino acids, at least 3 contiguous amino acids, at least 4 contiguous amino acids or at least 5 contiguous amino acids from the reference enveloped virus fusogenic peptide domain on which the non-conservative enveloped virus fusogenic peptide domain variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference enveloped virus fusogenic peptide domain on which the non-conservative enveloped virus fusogenic peptide domain variant is based. Non-limiting examples of a non-conservative enveloped virus fusogenic peptide domain variant include, e.g., non-conservative influenzavirus fusogenic peptide domain variants, non-conservative alphavirus fusogenic peptide domain variants, non-conservative vesiculovirus fusogenic peptide domain variants, non-conservative respirovirus fusogenic peptide domain variants, non-conservative morbillivirus fusogenic peptide domain variants, non-conservative avulavirus fusogenic peptide domain variants, non-conservative henipavirus fusogenic peptide domain variants, non-conservative metapneumovirus fusogenic peptide domain variants and non-conservative foamy virus fusogenic peptide domain variants.
[0178] As used herein, the term "enveloped virus fusogenic peptide domain chimeric" means a polypeptide comprising at least a portion of an enveloped virus fusogenic peptide domain and at least a portion of at least one other polypeptide to form an enveloped virus fusogenic peptide domain with at least one property different from the reference enveloped virus fusogenic peptide domain, with the proviso that this enveloped virus fusogenic peptide domain chimeric is still capable of further facilitating the translocation step of the intoxication process where the LC is released from intracellular vesicles into the cytoplasm of the target cell and thus participate in executing the overall cellular mechanism whereby a Clostridial toxin proteolytically cleaves a substrate.
[0179] As used herein, the term "active enveloped virus fusogenic peptide domain fragment" means any of a variety of enveloped virus fusogenic peptide domain fragments that can further facilitate the translocation step of the intoxication process where the LC is released from intracellular vesicles into the cytoplasm of the target cell and thus participate in executing the overall cellular mechanism whereby a Clostridial toxin proteolytically cleaves a substrate. Enveloped virus fusogenic peptide domains are approximately 15-30 amino acids in length. Thus, aspects of this embodiment can include a translocation facilitating domain comprising an active enveloped virus fusogenic peptide domain fragment having a length of, e.g., at least 10 amino acids, at least 15 amino acids, at least 20 amino acids and at least 25 amino acids. Other aspects of this embodiment can include a translocation facilitating domain comprising an active enveloped virus fusogenic peptide domain fragment having a length of, e.g., at most 10 amino acids, at most 15 amino acids, at most 20 amino acids and at most 25 amino acids.
[0180] Any of a variety of sequence alignment methods can be used to determine percent identity of naturally-occurring enveloped virus fusogenic peptide domain variants and non-naturally-occurring enveloped virus fusogenic peptide domain variants, including, without limitation, global methods, local methods and hybrid methods, such as, e.g., segment approach methods. Protocols to determine percent identity are routine procedures within the scope of one skilled in the art and from the teaching herein.
[0181] Thus, in an embodiment, a modified Clostridial toxin disclosed in the present specification comprises a Clostridial toxin translocation facilitating domain comprising an enveloped virus fusogenic peptide domain. In an aspect of this embodiment, a Clostridial toxin translocation facilitating domain comprises a naturally occurring enveloped virus fusogenic peptide domain variant, such as, e.g., a enveloped virus fusogenic peptide domain isoform or a enveloped virus fusogenic peptide domain subtype. In another aspect of this embodiment, a Clostridial toxin translocation domain comprises a non-naturally occurring enveloped virus fusogenic peptide domain variant, such as, e.g., a conservative enveloped virus fusogenic peptide domain variant, a non-conservative enveloped virus fusogenic peptide domain variant, a enveloped virus fusogenic peptide domain chimeric, an active enveloped virus fusogenic peptide domain fragment, or any combination thereof.
[0182] In another embodiment, a Clostridial toxin translocation facilitating domain comprises an influenzavirus fusogenic peptide domain. In another aspect of this embodiment, an influenzavirus fusogenic peptide domain comprises a naturally occurring influenzavirus fusogenic peptide domain variant, such as, e.g., an influenzavirus fusogenic peptide domain isoform or an influenzavirus fusogenic peptide domain subtype. In another aspect of this embodiment, an influenzavirus fusogenic peptide domain comprises a naturally occurring influenzavirus fusogenic peptide domain variant of SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91, such as, e.g., an influenzavirus fusogenic peptide domain isoform of SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91 or an influenzavirus fusogenic peptide domain subtype of SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91. In still another aspect of this embodiment, an influenzavirus fusogenic peptide domain comprises a non-naturally occurring influenzavirus fusogenic peptide domain variant, such as, e.g., a conservative influenzavirus fusogenic peptide domain variant, a non-conservative influenzavirus fusogenic peptide domain variant, an influenzavirus fusogenic peptide domain chimeric, an active influenzavirus fusogenic peptide domain fragment, or any combination thereof. In still another aspect of this embodiment, an influenzavirus fusogenic peptide domain comprises amino acids a non-naturally occurring influenzavirus fusogenic peptide domain variant of SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91, such as, e.g., a conservative influenzavirus fusogenic peptide domain variant of SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91, a non-conservative influenzavirus fusogenic peptide domain variant of SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91, an active influenzavirus fusogenic peptide domain fragment of SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91, or any combination thereof.
[0183] In other aspects of this embodiment, an influenzavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least 70% amino acid identity with SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91, at least 75% amino acid identity with SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91, at least 80% amino acid identity with SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91, at least 85% amino acid identity with SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91, at least 90% amino acid identity with SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91 or at least 95% amino acid identity with SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91. In yet other aspects of this embodiment, an influenzavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most 70% amino acid identity with SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91, at most 75% amino acid identity with SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91, at most 80% amino acid identity with SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91, at most 85% amino acid identity with SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91, at most 90% amino acid identity with SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91 or at most 95% amino acid identity with SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91.
[0184] In other aspects of this embodiment, an influenzavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91. In other aspects of this embodiment, an influenzavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91. In yet other aspects of this embodiment, an influenzavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91. In other aspects of this embodiment, an influenzavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91. In still other aspects of this embodiment, an influenzavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91. In other aspects of this embodiment, an influenzavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91.
[0185] In other aspects of this embodiment, an influenzavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91. In other aspects of this embodiment, an influenzavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91. In yet other aspects of this embodiment, an influenzavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91. In other aspects of this embodiment, an influenzavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91. In still other aspects of this embodiment, an influenzavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91. In other aspects of this embodiment, an influenzavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91.
[0186] In another embodiment, a Clostridial toxin translocation facilitating domain comprises an alphavirus fusogenic peptide domain. In another aspect of this embodiment, an alphavirus fusogenic peptide domain comprises a naturally occurring alphavirus fusogenic peptide domain variant, such as, e.g., an alphavirus fusogenic peptide domain isoform or an alphavirus fusogenic peptide domain subtype. In another aspect of this embodiment, an alphavirus fusogenic peptide domain comprises a naturally occurring alphavirus fusogenic peptide domain variant of SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118, such as, e.g., an alphavirus fusogenic peptide domain isoform of SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118 or an alphavirus fusogenic peptide domain subtype of SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118. In still another aspect of this embodiment, an alphavirus fusogenic peptide domain comprises a non-naturally occurring alphavirus fusogenic peptide domain variant, such as, e.g., a conservative alphavirus fusogenic peptide domain variant, a non-conservative alphavirus fusogenic peptide domain variant, an alphavirus fusogenic peptide domain chimeric, an active alphavirus fusogenic peptide domain fragment, or any combination thereof. In still another aspect of this embodiment, an alphavirus fusogenic peptide domain comprises amino acids a non-naturally occurring alphavirus fusogenic peptide domain variant of SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118, such as, e.g., a conservative alphavirus fusogenic peptide domain variant of SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118, a non-conservative alphavirus fusogenic peptide domain variant of SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118, an active alphavirus fusogenic peptide domain fragment of SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118, or any combination thereof.
[0187] In other aspects of this embodiment, an alphavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least 70% amino acid identity with SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118, at least 75% amino acid identity with SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118, at least 80% amino acid identity with SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91, at least 85% amino acid identity with SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118, at least 90% amino acid identity with SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118 or at least 95% amino acid identity with SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118. In yet other aspects of this embodiment, an alphavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most 70% amino acid identity with SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118, at most 75% amino acid identity with SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118, at most 80% amino acid identity with SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118, at most 85% amino acid identity with SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118, at most 90% amino acid identity with SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118 or at most 95% amino acid identity with SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118.
[0188] In other aspects of this embodiment, an alphavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118. In other aspects of this embodiment, an alphavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118. In yet other aspects of this embodiment, an alphavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118. In other aspects of this embodiment, an alphavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118. In still other aspects of this embodiment, an alphavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118. In other aspects of this embodiment, an alphavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118.
[0189] In other aspects of this embodiment, an alphavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118. In other aspects of this embodiment, an alphavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118. In yet other aspects of this embodiment, an alphavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118. In other aspects of this embodiment, an alphavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118. In still other aspects of this embodiment, an alphavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118. In other aspects of this embodiment, an alphavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118.
[0190] In another embodiment, a Clostridial toxin translocation facilitating domain comprises a vesiculovirus fusogenic peptide domain. In another aspect of this embodiment, a vesiculovirus fusogenic peptide domain comprises a naturally occurring vesiculovirus fusogenic peptide domain variant, such as, e.g., a vesiculovirus fusogenic peptide domain isoform or a vesiculovirus fusogenic peptide domain subtype. In another aspect of this embodiment, a vesiculovirus fusogenic peptide domain comprises a naturally occurring vesiculovirus fusogenic peptide domain variant of SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129, such as, e.g., a vesiculovirus fusogenic peptide domain isoform of SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129 or a vesiculovirus fusogenic peptide domain subtype of SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129. In still another aspect of this embodiment, a vesiculovirus fusogenic peptide domain comprises a non-naturally occurring vesiculovirus fusogenic peptide domain variant, such as, e.g., a conservative vesiculovirus fusogenic peptide domain variant, a non-conservative vesiculovirus fusogenic peptide domain variant, a vesiculovirus fusogenic peptide domain chimeric, an active vesiculovirus fusogenic peptide domain fragment, or any combination thereof. In still another aspect of this embodiment, a vesiculovirus fusogenic peptide domain comprises amino acids a non-naturally occurring vesiculovirus fusogenic peptide domain variant of SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129, such as, e.g., a conservative vesiculovirus fusogenic peptide domain variant of SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129, a non-conservative vesiculovirus fusogenic peptide domain variant of SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129, an active vesiculovirus fusogenic peptide domain fragment of SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129, or any combination thereof.
[0191] In other aspects of this embodiment, a vesiculovirus fusogenic peptide domain comprises a polypeptide having, e.g., at least 70% amino acid identity with SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129, at least 75% amino acid identity with SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129, at least 80% amino acid identity with SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129, at least 85% amino acid identity with SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129, at least 90% amino acid identity with SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129 or at least 95% amino acid identity with SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129. In yet other aspects of this embodiment, a vesiculovirus fusogenic peptide domain comprises a polypeptide having, e.g., at most 70% amino acid identity with SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129, at most 75% amino acid identity with SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129, at most 80% amino acid identity with SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129, at most 85% amino acid identity with SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129, at most 90% amino acid identity with SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129 or at most 95% amino acid identity with SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129.
[0192] In other aspects of this embodiment, a vesiculovirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129. In other aspects of this embodiment, a vesiculovirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129. In yet other aspects of this embodiment, a vesiculovirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129. In other aspects of this embodiment, a vesiculovirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129. In still other aspects of this embodiment, a vesiculovirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129. In other aspects of this embodiment, a vesiculovirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129.
[0193] In other aspects of this embodiment, a vesiculovirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129. In other aspects of this embodiment, a vesiculovirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129. In yet other aspects of this embodiment, a vesiculovirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129. In other aspects of this embodiment, a vesiculovirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129. In still other aspects of this embodiment, a vesiculovirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129. In other aspects of this embodiment, a vesiculovirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 or SEQ ID NO: 129.
[0194] In another embodiment, a Clostridial toxin translocation facilitating domain comprises a respirovirus fusogenic peptide domain. In another aspect of this embodiment, a respirovirus fusogenic peptide domain comprises a naturally occurring respirovirus fusogenic peptide domain variant, such as, e.g., a respirovirus fusogenic peptide domain isoform or a respirovirus fusogenic peptide domain subtype. In another aspect of this embodiment, a respirovirus fusogenic peptide domain comprises a naturally occurring respirovirus fusogenic peptide domain variant of SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136, such as, e.g., a respirovirus fusogenic peptide domain isoform of SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136 or a respirovirus fusogenic peptide domain subtype of SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136. In still another aspect of this embodiment, a respirovirus fusogenic peptide domain comprises a non-naturally occurring respirovirus fusogenic peptide domain variant, such as, e.g., a conservative respirovirus fusogenic peptide domain variant, a non-conservative respirovirus fusogenic peptide domain variant, a respirovirus fusogenic peptide domain chimeric, an active respirovirus fusogenic peptide domain fragment, or any combination thereof. In still another aspect of this embodiment, a respirovirus fusogenic peptide domain comprises amino acids a non-naturally occurring respirovirus fusogenic peptide domain variant of SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136, such as, e.g., a conservative respirovirus fusogenic peptide domain variant of SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136, a non-conservative respirovirus fusogenic peptide domain variant of SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136, an active respirovirus fusogenic peptide domain fragment of SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136, or any combination thereof.
[0195] In other aspects of this embodiment, a respirovirus fusogenic peptide domain comprises a polypeptide having, e.g., at least 70% amino acid identity with SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136, at least 75% amino acid identity with SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136, at least 80% amino acid identity with SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136, at least 85% amino acid identity with SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136, at least 90% amino acid identity with SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136 or at least 95% amino acid identity with SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136. In yet other aspects of this embodiment, a respirovirus fusogenic peptide domain comprises a polypeptide having, e.g., at most 70% amino acid identity with SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136, at most 75% amino acid identity with SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136, at most 80% amino acid identity with SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136, at most 85% amino acid identity with SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136, at most 90% amino acid identity with SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136 or at most 95% amino acid identity with SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136.
[0196] In other aspects of this embodiment, a respirovirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136. In other aspects of this embodiment, a respirovirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136. In yet other aspects of this embodiment, a respirovirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136. In other aspects of this embodiment, a respirovirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136. In still other aspects of this embodiment, a respirovirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136. In other aspects of this embodiment, a respirovirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136.
[0197] In other aspects of this embodiment, a respirovirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136. In other aspects of this embodiment, a respirovirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136. In yet other aspects of this embodiment, a respirovirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136. In other aspects of this embodiment, a respirovirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136. In still other aspects of this embodiment, a respirovirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136. In other aspects of this embodiment, a respirovirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 or SEQ ID NO: 136.
[0198] In another embodiment, a Clostridial toxin translocation facilitating domain comprises a morbillivirus fusogenic peptide domain. In another aspect of this embodiment, a morbillivirus fusogenic peptide domain comprises a naturally occurring morbillivirus fusogenic peptide domain variant, such as, e.g., a morbillivirus fusogenic peptide domain isoform or a morbillivirus fusogenic peptide domain subtype. In another aspect of this embodiment, a morbillivirus fusogenic peptide domain comprises a naturally occurring morbillivirus fusogenic peptide domain variant of SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146, such as, e.g., a morbillivirus fusogenic peptide domain isoform of SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146 or a morbillivirus fusogenic peptide domain subtype of SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146. In still another aspect of this embodiment, a morbillivirus fusogenic peptide domain comprises a non-naturally occurring morbillivirus fusogenic peptide domain variant, such as, e.g., a conservative morbillivirus fusogenic peptide domain variant, a non-conservative morbillivirus fusogenic peptide domain variant, a morbillivirus fusogenic peptide domain chimeric, an active morbillivirus fusogenic peptide domain fragment, or any combination thereof. In still another aspect of this embodiment, a morbillivirus fusogenic peptide domain comprises amino acids a non-naturally occurring morbillivirus fusogenic peptide domain variant of SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146, such as, e.g., a conservative morbillivirus fusogenic peptide domain variant of SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146, a non-conservative morbillivirus fusogenic peptide domain variant of SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146, an active morbillivirus fusogenic peptide domain fragment of SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146, or any combination thereof.
[0199] In other aspects of this embodiment, a morbillivirus fusogenic peptide domain comprises a polypeptide having, e.g., at least 70% amino acid identity with SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146, at least 75% amino acid identity with SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146, at least 80% amino acid identity with SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146, at least 85% amino acid identity with SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146, at least 90% amino acid identity with SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146 or at least 95% amino acid identity with SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146. In yet other aspects of this embodiment, a morbillivirus fusogenic peptide domain comprises a polypeptide having, e.g., at most 70% amino acid identity with SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146, at most 75% amino acid identity with SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146, at most 80% amino acid identity with SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146, at most 85% amino acid identity with SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146, at most 90% amino acid identity with SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146 or at most 95% amino acid identity with SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146.
[0200] In other aspects of this embodiment, a morbillivirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146. In other aspects of this embodiment, a morbillivirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146. In yet other aspects of this embodiment, a morbillivirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146. In other aspects of this embodiment, a morbillivirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146. In still other aspects of this embodiment, a morbillivirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146. In other aspects of this embodiment, a morbillivirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146.
[0201] In other aspects of this embodiment, a morbillivirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146. In other aspects of this embodiment, a morbillivirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146. In yet other aspects of this embodiment, a morbillivirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146. In other aspects of this embodiment, a morbillivirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146. In still other aspects of this embodiment, a morbillivirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146. In other aspects of this embodiment, a morbillivirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 or SEQ ID NO: 146.
[0202] In another embodiment, a Clostridial toxin translocation facilitating domain comprises an avulavirus fusogenic peptide domain. In another aspect of this embodiment, an avulavirus fusogenic peptide domain comprises a naturally occurring avulavirus fusogenic peptide domain variant, such as, e.g., an avulavirus fusogenic peptide domain isoform or an avulavirus fusogenic peptide domain subtype. In another aspect of this embodiment, an avulavirus fusogenic peptide domain comprises a naturally occurring avulavirus fusogenic peptide domain variant of SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159, such as, e.g., an avulavirus fusogenic peptide domain isoform of SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159 or an avulavirus fusogenic peptide domain subtype of SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159. In still another aspect of this embodiment, an avulavirus fusogenic peptide domain comprises a non-naturally occurring avulavirus fusogenic peptide domain variant, such as, e.g., a conservative avulavirus fusogenic peptide domain variant, a non-conservative avulavirus fusogenic peptide domain variant, an avulavirus fusogenic peptide domain chimeric, an active avulavirus fusogenic peptide domain fragment, or any combination thereof. In still another aspect of this embodiment, an avulavirus fusogenic peptide domain comprises amino acids a non-naturally occurring avulavirus fusogenic peptide domain variant of SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159, such as, e.g., a conservative avulavirus fusogenic peptide domain variant of SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159, a non-conservative avulavirus fusogenic peptide domain variant of SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159, an active avulavirus fusogenic peptide domain fragment of SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159, or any combination thereof.
[0203] In other aspects of this embodiment, an avulavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least 70% amino acid identity with SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159, at least 75% amino acid identity with SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159, at least 80% amino acid identity with SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159, at least 85% amino acid identity with SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159, at least 90% amino acid identity with SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159 or at least 95% amino acid identity with SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159. In yet other aspects of this embodiment, an avulavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most 70% amino acid identity with SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159, at most 75% amino acid identity with SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159, at most 80% amino acid identity with SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159, at most 85% amino acid identity with SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159, at most 90% amino acid identity with SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159 or at most 95% amino acid identity with SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159.
[0204] In other aspects of this embodiment, an avulavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159. In other aspects of this embodiment, an avulavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159. In yet other aspects of this embodiment, an avulavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159. In other aspects of this embodiment, an avulavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159. In still other aspects of this embodiment, an avulavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159. In other aspects of this embodiment, an avulavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159.
[0205] In other aspects of this embodiment, an avulavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159. In other aspects of this embodiment, an avulavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159. In yet other aspects of this embodiment, an avulavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159. In other aspects of this embodiment, an avulavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159. In still other aspects of this embodiment, an avulavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159. In other aspects of this embodiment, an avulavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 or SEQ ID NO: 159.
[0206] In another embodiment, a Clostridial toxin translocation facilitating domain comprises a henipavirus fusogenic peptide domain. In another aspect of this embodiment, a henipavirus fusogenic peptide domain comprises a naturally occurring henipavirus fusogenic peptide domain variant, such as, e.g., a henipavirus fusogenic peptide domain isoform or a henipavirus fusogenic peptide domain subtype.
[0207] In another aspect of this embodiment, a henipavirus fusogenic peptide domain comprises a naturally occurring henipavirus fusogenic peptide domain variant of SEQ ID NO: 160 or SEQ ID NO: 161, such as, e.g., a henipavirus fusogenic peptide domain isoform of SEQ ID NO: 160 or SEQ ID NO: 161 or a henipavirus fusogenic peptide domain subtype of SEQ ID NO: 160 or SEQ ID NO: 161. In still another aspect of this embodiment, a henipavirus fusogenic peptide domain comprises a non-naturally occurring henipavirus fusogenic peptide domain variant, such as, e.g., a conservative henipavirus fusogenic peptide domain variant, a non-conservative henipavirus fusogenic peptide domain variant, a henipavirus fusogenic peptide domain chimeric, an active henipavirus fusogenic peptide domain fragment, or any combination thereof. In still another aspect of this embodiment, a henipavirus fusogenic peptide domain comprises amino acids a non-naturally occurring henipavirus fusogenic peptide domain variant of SEQ ID NO: 160 or SEQ ID NO: 161, such as, e.g., a conservative henipavirus fusogenic peptide domain variant of SEQ ID NO: 160 or SEQ ID NO: 161, a non-conservative henipavirus fusogenic peptide domain variant of SEQ ID NO: 160 or SEQ ID NO: 161, an active henipavirus fusogenic peptide domain fragment of SEQ ID NO: 160 or SEQ ID NO: 161, or any combination thereof.
[0208] In other aspects of this embodiment, a henipavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least 70% amino acid identity with SEQ ID NO: 160 or SEQ ID NO: 161, at least 75% amino acid identity with SEQ ID NO: 160 or SEQ ID NO: 161, at least 80% amino acid identity with SEQ ID NO: 160 or SEQ ID NO: 161, at least 85% amino acid identity with SEQ ID NO: 160 or SEQ ID NO: 161, at least 90% amino acid identity with SEQ ID NO: 160 or SEQ ID NO: 161 or at least 95% amino acid identity with SEQ ID NO: 160 or SEQ ID NO: 161. In yet other aspects of this embodiment, a henipavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most 70% amino acid identity with SEQ ID NO: 160 or SEQ ID NO: 161, at most 75% amino acid identity with SEQ ID NO: 160 or SEQ ID NO: 161, at most 80% amino acid identity with SEQ ID NO: 160 or SEQ ID NO: 161, at most 85% amino acid identity with SEQ ID NO: 160 or SEQ ID NO: 161, at most 90% amino acid identity with SEQ ID NO: 160 or SEQ ID NO: 161 or at most 95% amino acid identity with SEQ ID NO: 160 or SEQ ID NO: 161.
[0209] In other aspects of this embodiment, a henipavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to SEQ ID NO: 160 or SEQ ID NO: 161. In other aspects of this embodiment, a henipavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to SEQ ID NO: 160 or SEQ ID NO: 161. In yet other aspects of this embodiment, a henipavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to SEQ ID NO: 160 or SEQ ID NO: 161. In other aspects of this embodiment, a henipavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to SEQ ID NO: 160 or SEQ ID NO: 161. In still other aspects of this embodiment, a henipavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to SEQ ID NO: 160 or SEQ ID NO: 161. In other aspects of this embodiment, a henipavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to SEQ ID NO: 160 or SEQ ID NO: 161.
[0210] In other aspects of this embodiment, a henipavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to SEQ ID NO: 160 or SEQ ID NO: 161. In other aspects of this embodiment, a henipavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to SEQ ID NO: 160 or SEQ ID NO: 161. In yet other aspects of this embodiment, a henipavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to SEQ ID NO: 160 or SEQ ID NO: 161. In other aspects of this embodiment, a henipavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to SEQ ID NO: 160 or SEQ ID NO: 161. In still other aspects of this embodiment, a henipavirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to SEQ ID NO: 160 or SEQ ID NO: 161. In other aspects of this embodiment, a henipavirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to SEQ ID NO: 160 or SEQ ID NO: 161.
[0211] In another embodiment, a Clostridial toxin translocation facilitating domain comprises a metapneumovirus fusogenic peptide domain. In another aspect of this embodiment, a metapneumovirus fusogenic peptide domain comprises a naturally occurring metapneumovirus fusogenic peptide domain variant, such as, e.g., a metapneumovirus fusogenic peptide domain isoform or a metapneumovirus fusogenic peptide domain subtype. In another aspect of this embodiment, a metapneumovirus fusogenic peptide domain comprises a naturally occurring metapneumovirus fusogenic peptide domain variant of SEQ ID NO: 162, such as, e.g., a metapneumovirus fusogenic peptide domain isoform of SEQ ID NO: 162 or a metapneumovirus fusogenic peptide domain subtype of SEQ ID NO: 162. In still another aspect of this embodiment, a metapneumovirus fusogenic peptide domain comprises a non-naturally occurring metapneumovirus fusogenic peptide domain variant, such as, e.g., a conservative metapneumovirus fusogenic peptide domain variant, a non-conservative metapneumovirus fusogenic peptide domain variant, a metapneumovirus fusogenic peptide domain chimeric, an active metapneumovirus fusogenic peptide domain fragment, or any combination thereof. In still another aspect of this embodiment, a metapneumovirus fusogenic peptide domain comprises amino acids a non-naturally occurring metapneumovirus fusogenic peptide domain variant of SEQ ID NO: 162, such as, e.g., a conservative metapneumovirus fusogenic peptide domain variant of SEQ ID NO: 162, a non-conservative metapneumovirus fusogenic peptide domain variant of SEQ ID NO: 162, an active metapneumovirus fusogenic peptide domain fragment of SEQ ID NO: 162, or any combination thereof.
[0212] In other aspects of this embodiment, a metapneumovirus fusogenic peptide domain comprises a polypeptide having, e.g., at least 70% amino acid identity with SEQ ID NO: 162, at least 75% amino acid identity with SEQ ID NO: 162, at least 80% amino acid identity with SEQ ID NO: 162, at least 85% amino acid identity with SEQ ID NO: 162, at least 90% amino acid identity with SEQ ID NO: 162 or at least 95% amino acid identity with SEQ ID NO: 162. In yet other aspects of this embodiment, a metapneumovirus fusogenic peptide domain comprises a polypeptide having, e.g., at most 70% amino acid identity with SEQ ID NO: 162, at most 75% amino acid identity with SEQ ID NO: 162, at most 80% amino acid identity with SEQ ID NO: 162, at most 85% amino acid identity with SEQ ID NO: 162, at most 90% amino acid identity with SEQ ID NO: 162 or at most 95% amino acid identity with SEQ ID NO: 162.
[0213] In other aspects of this embodiment, a metapneumovirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to SEQ ID NO: 162. In other aspects of this embodiment, a metapneumovirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to SEQ ID NO: 162. In yet other aspects of this embodiment, a metapneumovirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to SEQ ID NO: 162. In other aspects of this embodiment, a metapneumovirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to SEQ ID NO: 162. In still other aspects of this embodiment, a metapneumovirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to SEQ ID NO: 162. In other aspects of this embodiment, a metapneumovirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to SEQ ID NO: 162.
[0214] In other aspects of this embodiment, a metapneumovirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to SEQ ID NO: 162. In other aspects of this embodiment, a metapneumovirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to SEQ ID NO: 162. In yet other aspects of this embodiment, a metapneumovirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to SEQ ID NO: 162. In other aspects of this embodiment, a metapneumovirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to SEQ ID NO: 162. In still other aspects of this embodiment, a metapneumovirus fusogenic peptide domain comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to SEQ ID NO: 162. In other aspects of this embodiment, a metapneumovirus fusogenic peptide domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to SEQ ID NO: 162.
[0215] Aspects of the present invention provide, in part, an altered targeting domain. As used herein, the term "altered targeting domain" means any polypeptide that can selectively bind to a non-Clostridial toxin receptor present on a non-Clostridial toxin target cell and initiate the overall internalization mechanism whereby the modified Clostridial toxin disclosed in the present specification intoxicates a target cell. As used herein, the term "selectively" means having a highly preferred activity or effect. As used herein, the term "selectively bind" means a molecule is able to bind its target receptor under physiological conditions, or in vitro conditions substantially approximating physiological conditions, to a statistically significantly greater degree relative to other, non-target receptors. Thus, with reference to an altered targeting domain of the present specification, there is a discriminatory binding of the altered targeting domain to a non-Clostridial toxin receptor presence in a non-Clostridial toxin target cell.
[0216] Aspects of the present invention provide, in part, an enhanced targeting domain. As used herein, the term "enhanced targeting domain" means any polypeptide that can selectively bind to an endogenous Clostridial toxin receptor found on a Clostridial toxin target cell and initiate the overall internalization mechanism whereby the modified Clostridial toxin disclosed in the present specification intoxicates a target cell with the proviso that an enhanced targeting domain is not a naturally-occurring binding domain from a naturally occurring Clostridial toxin. As used herein, the term "selectively" means having a highly preferred activity or effect. As used herein, the term "selectively bind" means a molecule is able to bind its target receptor under physiological conditions, or in vitro conditions substantially approximating physiological conditions, to a statistically significantly greater degree relative to other non-target receptors. Thus, with reference to an enhanced targeting domain of the present specification, there is a discriminatory binding of the enhanced targeting domain to an endogenous Clostridial toxin receptor.
[0217] An enhanced targeting domain disclosed in the present specification facilitates the binding activity of the modified Clostridial toxins disclosed in the present specification to an endogenous Clostridial toxin receptor located at the surface of a Clostridial toxin target cell. As used herein, the term "binding activity" means that one molecule is directly or indirectly contacting another molecule via at least one intermolecular or intramolecular force, including, without limitation, a covalent bond, an ionic bond, a metallic bond, a hydrogen bond, a hydrophobic interaction, a van der Waals interaction, and the like, or any combination thereof. "Bound" and "bind" are considered terms for binding.
[0218] As used herein, the term "binding affinity" means how strong a molecule's binding activity is for a particular receptor. In general, high binding affinity results from greater intermolecular force between a binding domain and its receptor while low binding affinity involves less intermolecular force between the ligand and its receptor. High binding affinity involves a longer residence time for the binding domain at its receptor binding site than is the case for low binding affinity. As such, a molecule with a high binding affinity means a lower concentration of that molecule is required to maximally occupy the binding sites of a receptor and trigger a physiological response. Conversely, low binding affinity means a relatively high concentration of a molecule is required before the receptor binding sites of a receptor is maximally occupied and the maximum physiological response is achieved. Thus, modified Clostridial toxins with increased binding activity due to high binding affinity will allow administration of reduced doses of the toxin, thereby reducing or preventing unwanted side-effects associated with toxin dispersal into non-targeted areas.
[0219] As used herein, the term "binding specificity" means how specific a molecule's binding activity is one particular receptor. In general, high binding specificity results in a more exclusive interaction with one particular receptor or subgroup of receptors while low binding specificity results in a more promiscuous interaction with a larger group of receptors. As such, a molecule with a high binding specificity means that molecule will occupy the binding sites of a particular receptor and trigger a physiological response. Conversely, low binding specificity means a molecule will occupy the binding sites of many receptors and trigger a multitude of physiological responses. Thus, modified Clostridial toxins with increased binding activity due to high binding specificity will only target a subgroup of Clostridial toxin target cells, thereby reducing the side effects associated with the targeting of all Clostridial toxin target cells.
[0220] It is envisioned that any and all enhanced targeting domains can be used to practice aspects of the present invention, including, without limitation, an enhanced targeting domain that increases binding affinity for an endogenous Clostridial toxin receptor present on a naturally-occurring Clostridial toxin target cell; and an enhanced targeting domain that increases binding specificity for a subgroup of endogenous Clostridial toxin receptors present on a naturally-occurring Clostridial toxin target cell.
[0221] Assays that determine modified Clostridial toxin binding activity or uptake properties can be used to assess whether a modified Clostridial toxin disclosed in the present specification has an enhanced binding activity, such as an increased binding affinity or an increased binding specificity. It is envisioned that heterogeneous assay types, homogeneous assay types and non-separating homogeneous assay types can be used to determine the binding activity of a modified Clostridial toxin with an enhanced targeting domain, see, e.g., Lutea A. A. de Jong et al., Receptor-Binding Assays: Technologies and Applications, 829 J. Chromatogr. B 1-25 (2005). It is further envisioned that the binding activity of a modified Clostridial toxin with an enhanced targeting domain can be determined by affinity chromatography using immobilized receptors and interfacial optical assays, such as, e.g., total internal reflection fluorescence (TIRF) and surface plasmon resonance (SPR). Non-limiting examples of these assays include, e.g., FCS using diffusion mediated intensity fluctuations, SPR using a mass-dependent refractive index, TIRF using a mass-independent refractive index, microarrays using optical intensity changes and QAC using retention volume.
[0222] As a non-limiting example, cross-linking assays using radio-labeled or non-radio-labeled modified Clostridial toxins can determine whether such a modified toxin has an enhanced targeting activity to a Clostridial toxin receptor as compared to the Clostridial toxin from which the modified toxin was derived. Other non-limiting assays include immunocytochemical assays that detect modified toxin binding using labeled or unlabeled antibodies and immunoprecipitation assays that detect bound modified toxin using labeled or unlabeled antibodies. Antibodies useful for these assays include, without limitation, antibodies selected against a portion of a Clostridial toxin heavy chain comprising the HN translocation domain or a portion of a Clostridial toxin light chain; or antibodies selected against the Clostridial toxin receptor. If the antibody is labeled, the binding of the molecule can be detected by various means, including Western blotting, direct microscopic observation of the cellular location of the antibody, measurement of cell or substrate-bound antibody following a wash step, or electrophoresis, employing techniques well-known to those of skill in the art. If the antibody is unlabeled, one may employ a labeled secondary antibody for indirect detection of the bound molecule, and detection can proceed as for a labeled antibody. It is understood that these and similar assays that determine modified Clostridial toxin uptake properties or characteristics can be useful in determining whether a modified toxin disclosed in the present specification has an enhanced targeting activity.
[0223] Assays that monitor the release of a molecule after exposure to a modified Clostridial toxin disclosed in the present specification can also be used to assess whether such a modified toxin has enhanced binding activity to a Clostridial toxin receptor as compared to the Clostridial toxin from which the modified toxin was derived. In these assays, a greater or faster inhibition of the molecule's release would occur in cells exposed to a modified Clostridial toxin with an enhanced targeting activity after exposure to a modified Clostridial toxin. Well known assays include methods that measure inhibition of radio-labeled catecholamine release from neurons, such as, e.g., [3H] noradrenaline or [3H] dopamine release, see e.g., A Fassio et al., Evidence for calcium-dependent vesicular transmitter release insensitive to tetanus toxin and botulinum toxin type F, 90β) Neuroscience 893-902 (1999); and Sara Stigliani et al., The sensitivity of catecholamine release to botulinum toxin C1 and E suggests selective targeting of vesicles set into the readily releasable pool, 85(2) J. Neurochem. 409-421 (2003), or measures catecholamine release using a fluorometric procedure, see, e.g., Anton de Paiva et al., A role for the interchain disulfide or its participating thiols in the internalization of botulinum neurotoxin A revealed by a toxin derivative that binds to ecto-acceptors and inhibits transmitter release intracellularly, 268(28) J. Biol. Chem. 20838-20844 (1993); Gary W. Lawrence et al., Distinct exocytotic responses of intact and permeabilised chromaffin cells after cleavage of the 25-kDa synaptosomal-associated protein (SNAP-25) or synaptobrevin by botulinum toxin A or B, 236β) Eur. J. Biochem. 877-886 (1996); and Patrick Foran et al., Botulinum neurotoxin C1 cleaves both syntaxin and SNAP-25 in intact and permeabilized chromaffin cells: correlation with its blockade of catecholamine release, 35(8) Biochemistry 2630-2636 (1996). Other non-limiting examples include assays that measure inhibition of hormone release from endocrine cells, such as, e.g., anterior pituitary cells or ovarian cells. It is understood that these and similar assays for molecule release can be useful in determining whether a modified toxin disclosed in the present specification has an enhanced targeting activity.
[0224] Assays that detect the cleavage of a Clostridial toxin substrate after exposure to a modified Clostridial toxin disclosed in the present specification can also be used to assess whether such a modified toxin has enhanced binding activity to a Clostridial toxin receptor as compared to the Clostridial toxin from which the modified toxin was derived. In these assays, generation of a Clostridial toxin substrate cleavage-product would be detected in cells expressing a receptor of interest after modified Clostridial toxin treatment. Non-limiting examples of specific Western blotting procedures, as well as well-characterized reagents, conditions and protocols are readily available from commercial vendors that include, without limitation, Amersham Biosciences, Piscataway, N.J.; Bio-Rad Laboratories, Hercules, Calif.; Pierce Biotechnology, Inc., Rockford, Ill.; Promega Corporation, Madison, Wis., and Stratagene, Inc., La Jolla, Calif. It is understood that these and similar assays for Clostridial toxin substrate cleavage can be useful in determining whether a modified toxin disclosed in the present specification has an enhanced targeting activity.
[0225] As non-limiting examples, western blot analysis using an antibody that specifically recognizes a BoNT/A substrate cleavage product at the SNAP-25 site can be used to assay whether a modified toxin has an enhanced binding activity to a Clostridial toxin receptor as compared to the Clostridial toxin from which the modified toxin was derived; western blot analysis using an antibody that specifically recognizes a BoNT/C1 substrate cleavage product at the SNAP-25 site can be used to assay whether a modified toxin has an enhanced binding activity to a Clostridial toxin receptor as compared to the Clostridial toxin from which the modified toxin was derived; and western blot analysis using an antibody that specifically recognizes a BoNT/E substrate cleaved product can be used to assay whether a modified toxin has an enhanced binding activity to a Clostridial toxin receptor as compared to the Clostridial toxin from which the modified toxin was derived. Examples of anti-SNAP-25 antibodies useful for these assays include, without limitation, rabbit polyclonal anti-SNAP25197 antiserum pAb anti-SNAP25197 #1 (Allergan, Inc., Irvine, Calif.), mouse monoclonal anti-SNAP-25 antibody SMI-81 (Sternberger Monoclonals, Lutherville, Md.), mouse monoclonal anti-SNAP-25 antibody Cl 71.1 (Synaptic Systems, Goettingen, Germany), mouse monoclonal anti-SNAP-25 antibody Cl 71.2 (Synaptic Systems, Goettingen, Germany), mouse monoclonal anti-SNAP-25 antibody SP12 (Abcam, Cambridge, Mass.), rabbit polyclonal anti-SNAP-25 antiserum (Synaptic Systems, Goettingen, Germany), and rabbit polyclonal anti-SNAP-25 antiserum (Abcam, Cambridge, Mass.).
[0226] As additional non-limiting examples, western blot analysis using an antibody that specifically recognizes a BoNT/B substrate cleaved product can be used to assay whether a modified toxin has an enhanced binding activity to a Clostridial toxin receptor as compared to the Clostridial toxin from which the modified toxin was derived; western blot analysis using an antibody that specifically recognizes a BoNT/D substrate cleaved product can be used to assay whether a modified toxin has an enhanced binding activity to a Clostridial toxin receptor as compared to the Clostridial toxin from which the modified toxin was derived; western blot analysis using an antibody that specifically recognizes a BoNT/F substrate cleaved product can be used to assay whether a modified toxin has an enhanced binding activity to a Clostridial toxin receptor as compared to the Clostridial toxin from which the modified toxin was derived; western blot analysis using an antibody that specifically recognizes a BoNT/G substrate cleaved product can be used to assay whether a modified toxin has an enhanced binding activity to a Clostridial toxin receptor as compared to the Clostridial toxin from which the modified toxin was derived; and western blot analysis using an antibody that specifically recognizes a TeNT substrate cleaved product can be used to assay whether a modified toxin has an enhanced binding activity to a Clostridial toxin receptor as compared to the Clostridial toxin from which the modified toxin was derived. Examples of anti-VAMP antibodies useful for these assays include, without limitation, mouse monoclonal anti-VAMP-1 antibody Cl 10.1 (Synaptic Systems, Goettingen, Germany), mouse monoclonal anti-VAMP-1 antibody SP10 (Abcam, Cambridge, Mass.), mouse monoclonal anti-VAMP-1 antibody SP11 (Abcam, Cambridge, Mass.), rabbit polyclonal anti-VAMP-1 antiserum (Synaptic Systems, Goettingen, Germany), rabbit polyclonal anti-VAMP-1 antiserum (Abcam, Cambridge, Mass.), mouse monoclonal anti-VAMP-2 antibody Cl 69.1 (Synaptic Systems, Goettingen, Germany), rabbit polyclonal anti-VAMP-2 antiserum (Synaptic Systems, Goettingen, Germany), rabbit polyclonal anti-VAMP-2 antiserum (Abcam, Cambridge, Mass.), mouse monoclonal anti-VAMP-3 antibody Cl 10.1 (Synaptic Systems, Goettingen, Germany), rabbit polyclonal anti-VAMP-3 antiserum (Synaptic Systems, Goettingen, Germany) and rabbit polyclonal anti-VAMP-3 antiserum (Abcam, Cambridge, Mass.),
[0227] As another non-limiting example, western blot analysis using an antibody that specifically recognizes a BoNT/C1 substrate cleaved product at the Syntaxin site can be used to assay whether a modified toxin has an enhanced binding activity to a Clostridial toxin receptor as compared to the Clostridial toxin from which the modified toxin was derived. Examples of anti-Syntaxin antibodies useful for these assays include, without limitation, mouse monoclonal anti-Syntaxin-1 antibody Cl 78.2 (Synaptic Systems, Goettingen, Germany), mouse monoclonal anti-Syntaxin-1A antibody Cl 78.3 (Synaptic Systems, Goettingen, Germany), rabbit polyclonal anti-Syntaxin-1A antiserum (Synaptic Systems, Goettingen, Germany), rabbit polyclonal anti-Syntaxin-1B antiserum (Synaptic Systems, Goettingen, Germany), rabbit polyclonal anti-Syntaxin antiserum (Abcam, Cambridge, Mass.), rabbit polyclonal anti-Syntaxin-2 antiserum (Abcam, Cambridge, Mass.) and rabbit polyclonal anti-Syntaxin-3 antiserum (Abcam, Cambridge, Mass.),
[0228] Thus, in an embodiment, a modified Clostridial toxin with an enhanced targeting activity is a modified Clostridial toxin with an increased binding affinity for a Clostridial toxin receptor. Increased binding affinity for a Clostridial toxin receptor is determined by comparing the binding affinity of the modified Clostridial toxin to that of the binding affinity for the same Clostridial toxin receptor of a Clostridial toxin lacking the enhanced targeting domain modification from which the modified Clostridial toxin is derived. In aspects of this embodiment, a modified Clostridial toxin with an increased binding affinity for a Clostridial toxin receptor exhibits a binding affinity that is, e.g., at least 10% greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least 20% greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least 30% greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least 40% greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least 50% greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least 60% greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least 70% greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least 80% greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least 90% greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived or at least 100% greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived. In aspects of this embodiment, a modified Clostridial toxin with an increased binding affinity for a Clostridial toxin receptor exhibits a binding affinity that is, e.g., at most 10% greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most 20% greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most 30% greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most 40% greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most 50% greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most 60% greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most 70% greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most 80% greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most 90% greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived or at most 100% greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived.
[0229] In yet other aspects of this embodiment, a modified Clostridial toxin with an increased binding affinity for a Clostridial toxin receptor exhibits a binding affinity that is, e.g., at least two-fold greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least three-fold greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least four-fold greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least five-fold greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least ten-fold greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived or at least twentγ-fold greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived. In yet other aspects of this embodiment, a modified Clostridial toxin with an increased binding affinity for a Clostridial toxin receptor exhibits a binding affinity that is, e.g., at most two-fold greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most three-fold greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most four-fold greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most five-fold greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most ten-fold greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived or at most twentγ-fold greater than the binding affinity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived.
[0230] In another embodiment, a modified Clostridial toxin with an enhanced targeting activity is a modified Clostridial toxin with an increased binding specificity for a Clostridial toxin receptor. Increased binding specificity for a Clostridial toxin receptor is determined by comparing the binding specificity of the modified Clostridial toxin to that of the binding specificity for the same Clostridial toxin receptor of a Clostridial toxin lacking the enhanced targeting domain modification from which the modified Clostridial toxin is derived. In aspects of this embodiment, a modified Clostridial toxin with an increased binding specificity for a Clostridial toxin receptor exhibits a binding specificity that is, e.g., at least 10% greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least 20% greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least 30% greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least 40% greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least 50% greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least 60% greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least 70% greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least 80% greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least 90% greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived or at least 100% greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived. In aspects of this embodiment, a modified Clostridial toxin with an increased binding specificity for a Clostridial toxin receptor exhibits a binding specificity that is, e.g., at most 10% greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most 20% greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most 30% greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most 40% greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most 50% greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most 60% greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most 70% greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most 80% greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most 90% greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived or at most 100% greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived.
[0231] In yet other aspects of this embodiment, a modified Clostridial toxin with an increased binding specificity for a Clostridial toxin receptor exhibits a binding specificity that is, e.g., at least two-fold greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least three-fold greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least four-fold greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least five-fold greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at least ten-fold greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived or at least twentγ-fold greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived. In yet other aspects of this embodiment, a modified Clostridial toxin with an increased binding specificity for a Clostridial toxin receptor exhibits a binding specificity that is, e.g., at most two-fold greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most three-fold greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most four-fold greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most five-fold greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived, at most ten-fold greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived or at most twentγ-fold greater than the binding specificity of the naturally-occurring Clostridial toxin from which the modified Clostridial toxin is derived.
[0232] As used herein, the term "Clostridial toxin target cell" means a cell that is a naturally occurring cell that a naturally occurring Clostridial toxin is capable of intoxicating, including, without limitation, motor neurons; sensory neurons; autonomic neurons; such as, e.g., sympathetic neurons and parasympathetic neurons; non-peptidergic neurons, such as, e.g., cholinergic neurons, adrenergic neurons, noradrenergic neurons, serotonergic neurons, GABAergic neurons; and peptidergic neurons, such as, e.g., Substance P neurons, Calcitonin Gene Related Peptide neurons, vasoactive intestinal peptide neurons, Neuropeptide Y neurons, cholecystokinin neurons.
[0233] An enhanced targeting domain disclosed in the present specification replaces the binding activity of the Clostridial toxin targeting domain found in naturally occurring Clostridial toxins. As used herein, the term "naturally occurring Clostridial toxin targeting domain" is synonymous with "naturally occurring Clostridial toxin HCC targeting domain" and means any naturally occurring Clostridial toxin polypeptide that can execute the cell binding step of the intoxication process, including, e.g., the binding of the Clostridial toxin to a Clostridial toxin-specific receptor located on the plasma membrane surface of a target cell. It is envisioned that replacement of the binding activity of a naturally occurring Clostridial toxin HCC targeting domain by an enhanced targeting domain can be achieved by, e.g., replacing the entire naturally occurring Clostridial toxin HCC targeting domain with an enhanced targeting domain; replacing a portion of a naturally occurring Clostridial toxin HCC targeting domain with an enhanced targeting domain; and operably-linking an enhanced targeting domain to a naturally occurring Clostridial toxin comprising a Clostridial toxin HCC targeting domain.
[0234] An example of an enhanced targeting domain that increases binding activity for an endogenous Clostridial toxin receptor present on a naturally-occurring Clostridial toxin target cell, includes, without limitation, a modified Clostridial toxin HCC targeting domain with enhanced binding activity, such as, e.g., a modified BoNT/A HCC targeting domain with enhanced binding activity, a modified BoNT/B HCC targeting domain with enhanced binding activity, a modified BoNT/C1 HCC targeting domain with enhanced binding activity, a modified BoNT/D HCC targeting domain with enhanced binding activity, a modified BoNT/E HCC targeting domain with enhanced binding activity, a modified BoNT/F HCC targeting domain with enhanced binding activity, a modified BoNT/G HCC targeting domain with enhanced binding activity and a modified TeNT HCC targeting domain with enhanced binding activity. Examples of a modified Clostridial toxin HCC targeting domain that increase binding activity include, e.g., a modified Clostridial toxin HCC targeting domain that increases binding affinity for an endogenous Clostridial toxin receptor present on a naturally-occurring Clostridial toxin target cell and a modified Clostridial toxin HCC targeting domain that increases binding specificity for a subgroup of endogenous Clostridial toxin receptors present on a naturally-occurring Clostridial toxin target cell.
[0235] The three-dimensional crystal structures of BoNT/A, BoNT/B and the HC domain of TeNT indicate that the carboxyl-terminal HCC domain comprises a modified β-trefoil domain which forms three distinct carbohydrate binding regions that resembles the carbohydrate binding moiety found in many sugar-binding proteins, such as, e.g., serum amyloid P, sialidase, cryia, insecticidal δ-endotoxin and lectins. Biochemical studies indicate that the β-trefoil domain structure of the HCC domain appears to mediate the binding to specific carbohydrate containing components of the Clostridial toxin receptor on the cell surface, see, e.g., Krzysztof Ginalski et al., Structure-based Sequence Alignment for the Beta-Trefoil Subdomain of the Clostridial Neurotoxin Family Provides Residue Level Information About the Putative Ganglioside Binding Site, 482(1-2) FEBS Lett. 119-124 (2000).
[0236] Proteins containing the structural β-trefoil domain represents a diverse group of proteins, see, e.g., C. A. Orengo et al., Protein Superfamilies and Domain Superfolds, 372 Nature 631-634 (1994). The β-trefoil domain comprises a six-stranded β-barrel closed off at one end by three β-hairpin structures that exhibits a characteristic pseudo-threefold axis symmetry. The monomeric structural unit of this three-fold symmetry is referred to as the β-trefoil fold that contains four β-sheets organized as a pair of antiparallel β-sheets. Dividing each of these β-trefoil folds is a β-hairpin turn. Therefore, in a linear fashion, a β-trefoil domain comprises four β-sheets of the first β-trefoil fold (α-fold), a β-hairpin turn, four β-sheets of the second β-trefoil fold (β-fold), a second β-hairpin turn four β-sheets of the third β-trefoil fold (γ-fold)(see FIG. 2). Because the first hairpin turn is located between the fourth and fifth β-sheets of the β-trefoil domain, it is designated the β4/β5 β-hairpin turn. Likewise, since the second hairpin turn is located between the eight and ninth β-sheets of the β-trefoil domain, it is designated the β8/β9 β-hairpin turn.
[0237] Continuing research has elucidated that β4/β5 and β8/β9 β-hairpin turns are important in conferring the proper pseudo-threefold axis symmetry observed in the β-trefoil domain. Additionally, this work has demonstrated that amino acid changes in these two β-hairpin turns can increase the stability of the β-trefoil domain, which in turn results in increased binding activity, see, e.g., Stephen R. Brych et al., Structure and Stability Effects of Mutations Designed to Increase the Primary Sequence Symmetry Within the Core Region of a β-trefoil, 10 Protein Sci. 2587-2599 (2001); Jaewon Kim et al., Alternative Type I and I' Turn Conformations in the β8/β9 β-hairpin of Human Acidic Fibroblast Growth Factor, 11 Protein Sci. 459-466 (2002); Jaewon Kim et al., Sequence swapping Does Not Result in Conformation Swapping for the β4/β5 and β8/β9 β-hairpin Turns in Human Acidic Fibroblast Growth Factor, 14 Protein Sci. 351-359 (2005). As a non-limiting example, replacement of an amino acid comprising either the β4/β5 hairpin turn or β8/β9 β-hairpin turn with a glycine results in increased stabilization of the β-trefoil domain. Therefore, replacement of amino acids located in the β4/β5 and β8/β9 β-hairpin turns of the β-trefoil domains present in the binding domain of Clostridial toxins will increase binding activity of such a modified Clostridial toxin by increasing the structural stability of the β-trefoil domain. The amino acid sequences comprising the β-trefoil domains found in various Clostridial toxins are shown in Table 2.
TABLE-US-00002 TABLE 2 β-trefoil Domains of Clostridial Toxins Amino Acid Sequence Region of Carbohydrate Binding Moieties β4/β5 β8/β9 Protein SEQ ID NO: α-fold β-hairpin turn β-fold β-hairpin turn γ-fold BoNT/A 1 1111-1162 1163-1178 1179-1223 1224-1236 1237-1296 BoNT/B 2 1098-1147 1148-1165 1166-1210 1211-1222 1223-1291 BoNT/C1 3 1112-1150 1151-1166 1167-1218 1219-1229 1230-1291 BoNT/D 4 1099-1137 1138-1153 1154-1207 1208-1218 1219-1276 BoNT/E 5 1086-1129 1130-1146 1147-1190 1191-1198 1199-1252 BoNT/F 6 1106-1152 1153-1171 1172-1213 1214-1221 1222-1274 BoNT/G 7 1106-1153 1154-1172 1173-1218 1219-1230 1231-1297 TeNT 8 1128-1177 1178-1194 1195-1240 1241-1254 1255-1315
[0238] As is typical for proteins containing a β-trefoil fold, the overall amino acid sequence identity of the HCC domain between Clostridial toxins is low. However, key residues essential for binding activity have been identified by structural analysis and mutagenesis experiments, see, e.g., Krzysztof Ginalski et al., Structure-based Sequence Alignment for the Beta-Trefoil Subdomain of the Clostridial Neurotoxin Family Provides Residue Level Information About the Putative Ganglioside Binding Site, 482(1-2) FEBS Lett. 119-124 (2000). For example, analysis of the HCC domain structure by crystallography identified five highly conserved residues critical for forming a shallow surface pocket of a carbohydrate binding moiety. These polar residues make hydrogen bonds with the carbohydrate ring. In BoNT/A these five polar residues are Glu 1203, Phe 1252, Ser 1264, Tyr 1267 and Gly 1279, while in TeNT, these residues are Asp 1222, Thr 1270, Ser 1287, Tyr 1290 and Gly 1300. Additionally, tyrosine residues forming the hydrophilic wall of this pocket were also important (Trp 1266 of BoNT/A and Trp 1289 of TeNT) and tryptophan fluorescence quenching experiments indicated that Trp 1266 of BoNT/A bound carbohydrate molecules. In another studies, photoaffinity labeling experiments revealed that Gln 1270 of BoNT/A and His 1293 of TeNT were also involved in binding carbohydrate molecules. Mutagenesis experiments designed to assay loss-of-function binding activity mutations confirmed the importance of many of the residues described above for BoNT/A and TeNT and extended this analysis to BoNT/B (Glu 1190, H is 1241, Typ 1262, Tyr 1263), see, e.g., Andreas Rummel et al., The HCC-Domain of Botulinum Neurotoxins A and B Exhibits a Singular Ganglioside Binding Site Displaying Serotype Specific Carbohydrate Interaction, 51β) Mol. Microbiol. 631-643 (2004).
[0239] As used herein, the term "Clostridial toxin HCC targeting domain" means any naturally occurring Clostridial toxin polypeptide that can execute the cell binding step of the intoxication process, including, e.g., the selective binding of the Clostridial toxin to a toxin-specific receptor located on the plasma membrane surface of a target cell. As used herein, the term "modified Clostridial toxin HCC targeting domain" means a naturally occurring Clostridial toxin HCC targeting domain modified to enhance its cell binding activity for an endogenous Clostridial toxin receptor, such as, e.g., a binding affinity or a binding specificity, to a statistically significantly degree relative to the unmodified naturally occurring Clostridial toxin HCC targeting domain from which the modified Clostridial toxin HCC targeting domain was derived. By definition, a modified Clostridial toxin HCC targeting domain has at least one amino acid change from the corresponding region of the disclosed reference sequences (see Table 1) and can be described in percent identity to the corresponding region of that reference sequence.
[0240] As another non-limiting examples, a modified BoNT/A HCC targeting domain comprising amino acids 1092-1296 of SEQ ID NO: 1 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1092-1296 of SEQ ID NO: 1; a modified BoNT/B HCC targeting domain comprising amino acids 1079-1291 of SEQ ID NO: 2 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1079-1291 of SEQ ID NO: 2; a modified BoNT/C1 HCC targeting domain comprising amino acids 1093-1291 of SEQ ID NO: 3 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 2093-1291 of SEQ ID NO: 3; a modified BoNT/D HCC targeting domain comprising amino acids 1080-1276 of SEQ ID NO: 4 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1080-1276 of SEQ ID NO: 4; a modified BoNT/E HCC targeting domain comprising amino acids 1067-1252 of SEQ ID NO: 5 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1067-1252 of SEQ ID NO: 5; a modified BoNT/F HCC targeting domain comprising amino acids 1087-1274 of SEQ ID NO: 6 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1087-1274 of SEQ ID NO: 6; a modified BoNT/G HCC targeting domain comprising amino acids 1087-1297 of SEQ ID NO: 7 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1087-1297 of SEQ ID NO: 7; and a modified TeNT HCC targeting domain comprising amino acids 1109-1315 of SEQ ID NO: 8 will have at least one amino acid difference, such as, e.g., an amino acid substitution, deletion or addition, as compared to the amino acid region 1109-1315 of SEQ ID NO: 8.
[0241] It is also envisioned that any of a variety of modified Clostridial toxin HCC targeting domain fragments comprising a binding domain with enhanced binding activity can be useful in aspects of the present invention with the proviso that these active fragments can provide enhanced binding activity of the toxin to the receptor located at the surface of the target cell. The HCC targeting domain from the heavy chains of Clostridial toxins are approximately 165-195 amino acids in length and comprise a binding domain (Table 1). Research has shown that the entire length of a HCC targeting domain from a Clostridial toxin heavy chain is not necessary for the binding activity of the binding domain. Thus, aspects of this embodiment can include a Clostridial toxin HCC targeting domain comprising a binding domain having a length of, e.g., at least 150 amino acids, at least 175 amino acids, at least 200 amino acids and at least 225 amino acids. Other aspects of this embodiment can include a Clostridial toxin HCC targeting domain comprising a binding domain having a length of, e.g., at most 150 amino acids, at most 175 amino acids, at most 200 amino acids and at most 225 amino acids.
[0242] Any of a variety of sequence alignment methods can be used to determine percent identity of a modified Clostridial toxin HCC targeting domain relative to a naturally-occurring Clostridial toxin HCC targeting domain, including, without limitation, global methods, local methods and hybrid methods, such as, e.g., segment approach methods. Protocols to determine percent identity are routine procedures within the scope of one skilled in the art and from the teaching herein.
[0243] One general approach well known to one skilled in the art on how to modify a Clostridial toxin HCC targeting domain in order to increase its binding activity for a naturally-occurring Clostridial toxin receptor present on a naturally-occurring Clostridial toxin target cell involves changing specifically-identified amino acids. As described above, amino acids essential to binding activity have been identified and methods useful for determining which amino acid substitutions will enhance binding activity are known to one skilled in the art. For example, recent advances in computational protein design algorithms have markedly improved capabilities for generating novel proteins with optimized properties, including, enhanced stability, altered substrate specificity, improved binding affinity and optimized pharmacokinetics, see, e.g., Tanja Kortemme et al., Computational redesign of protein-protein interaction specificity, 11(4) Nat. Struct. Mol. Biol. 371-379 (2004); Tanja Kortemme and David Baker, Computational design of protein-protein interactions, 8(1) Curr. Opin. Chem. Biol. 91-97 (2004); Motomu Shimaoka et al., Computational design of an integrin I domain stabilized in the open high affinity conformation, 7(8) Nat. Struct. Biol. 674-678 (2000); Loic Martin et al., Rational Design of a CD4 Mimic that Inhibits HIV-1 Entry and Exposes Cryptic Neutralization Epitopes, 21(1) Nat. Biotechnol. 71-76 (2003); and Casim A. Sarkar et al., Rational Cytokine Design for Increased Lifetime and Enhanced Potency Using pH-activated "Histidine Switching,"20(9) Nat. Biotechnol. 908-913 (2002).
[0244] In addition, methods capable of altering an amino acid present in a Clostridial toxin HCC targeting domain, include, without limitation, site-directed mutagenesis, oligonucleotide-directed mutagenesis and site-specific mutagenesis. Non-limiting examples of specific mutagenesis protocols for making mutations in a Clostridial toxin are described in, e.g., Mutagenesis, pp. 13.1-13.105 (Sambrook and Russell, eds., Molecular Cloning A Laboratory Manual, Vol. 3, 3rd ed. 2001). In addition, non-limiting examples of well-characterized mutagenesis protocols available from commercial vendors include, without limitation, Altered Sites® II in vitro Mutagenesis Systems (Promega Corp., Madison, Wis.); Erase-a-Base® System (Promega, Madison, Wis.); GeneTailor® Site-Directed Mutagenesis System (Invitrogen, Inc., Carlsbad, Calif.); QuikChange® II Site-Directed Mutagenesis Kits (Stratagene, La Jolla, Calif.); and Transformer® Site-Directed Mutagenesis Kit (BD-Clontech, Mountain View, Calif.).
[0245] Lastly, methods to test the binding activity of modified Clostridial toxins comprising a modified Clostridial toxin HCC targeting domain with altered binding capability are also well known to one skilled in the art, see, e.g., Lutea A. A. de Jong et al., Receptor-Binding Assays: Technologies and Applications, 829 J. Chromatogr. B 1-25 (2005). It is envisioned that heterogeneous assay types, homogeneous assay types and non-separating homogeneous assay types can be used to determine the binding activity of a modified Clostridial toxin with enhanced binding activity disclosed in the present specification. In a heterogeneous assay, the free ligand is separated from the bound ligand by, e.g., filtration, centrifugation or dialysis, before measurement of the binding activity. In a homogeneous assay, no separation of the free ligand from the bound ligand is required before measurement of the binding activity. In non-separating homogeneous assays, either the ligand or the receptor is immobilized on a solid phase support, in addition to the no separation aspect of all homogeneous assay. Non-limiting examples of heterogeneous, homogeneous and non-separating homogeneous assays include, e.g., radioactive heterogeneous assays, such as, e.g., filtration assays using radioactive energy transfer, SPA/flash plate assays using radioactive energy transfer; and non-radioactive heterogeneous assays, such as, e.g., filtration assays using fluorescence, FRET assays using fluorescence energy transfer, FP assays using light polarization, single-cell FMAT assays and flow cytometry. In addition, non-limiting examples of well-characterized receptor binding protocols available from commercial vendors include, without limitation, Homogeneous Time Resolved Fluorescense-based receptor binding assays (HTRF®; Cisbio International, Bedford, Mass.); DELFIA®-based receptor binding assays (PerkinElmer Lifesciences, Boston, Mass.); and AlphaScreen®-based receptor binding assays (PerkinElmer Lifesciences, Boston, Mass.).
[0246] It is further envisioned that the binding activity of a modified Clostridial toxin with altered binding capability disclosed in the present specification can be determined by affinity chromatography using immobilized receptors and interfacial optical assays, such as, e.g., total internal reflection fluorescence (TIRF) and surface plasmon resonance (SPR). Non-limiting examples of these assays include, e.g., FCS using diffusion mediated intensity fluctuations, SPR using a mass-dependent refractive index, TIRF using a mass-independent refractive index, microarrays using optical intensity changes and QAC using retention volume.
[0247] As another general approach well known to one skilled in the art on how to modify a Clostridial toxin HCC targeting domain in order to increase its binding activity for a naturally-occurring Clostridial toxin receptor present on a naturally-occurring Clostridial toxin target cell involves directed-evolution methods, see, e.g., Andre Koltermann et al., Process for Generating Sequence-Specific Proteases by Directed Evolution and Uses Thereof, U.S. Patent Publication 2004/0072276 (Apr. 15, 2004); Lance E. Steward and Kei Roger Aoki, Evolved Clostridial Toxins with Altered Protease Activity, U.S. Patent Publication 2004/0115727 (Jun. 17, 2004); and L Yuan et al., Laboratory-directed protein evolution, 69β) Microbiol. Mol. Biol. Rev. 373-392 (2005).
[0248] Often the first step of directed evolution is error-prone PCR amplification of the gene of interest or gene recombination when a family of related genes is available. In this case, the gene corresponding to full-length Clostridial toxin or the HCC targeting domain alone would be amplified under conditions that yield one to three amino acid substitutions per molecule. The protein would then be expressed and screened for the desired activity (i.e., receptor binding and/or enhanced activity). Any constructs with even a nominal improvement in receptor binding, regardless of the magnitude of the change, would be submitted for additional rounds of evolution. As a result of the random mutagenesis studies, any amino acids displaying improved binding or even dramatically reduced binding could then be submitted to saturation mutagenesis. This is a process in which the codon of interest it completely randomized so that different constructs containing each of the 20 amino acids substituted at the site of interest are generated.
[0249] For improvement of receptor binding characteristics, several different screening approaches could be utilized. If the receptor is known the soluble portion of the receptor can be expressed recombinantly for use in SPR binding assays. For example, the soluble portion of the receptor can be expressed as a fusion to streptavidin, polyhistidine tag, etc. and the receptor can then be immobilized on an appropriate sensor chip. Utilizing a SPR instrument, changes in local refractive index as a result of receptor binding are measured as a change in the SPR angle. The rates of change in the SPR angle can then be analyzed to determine association and dissociation phases and therefore equilibrium constants. This type of assay could be measured either with the full-length Clostridial toxin or the HCC targeting domain. Additionally, binding type assays relying on affinity pull-down experiments with affinity tagged receptors acting as a "bait molecule" could be used. The modified Clostridial toxin or HCC targeting domain could then be labeled with radioisotopes for analysis of the amount of target protein associated with the bait. Alternatively, radiolabeled ligands can be competed with Clostridial toxin or HCC targeting domain variants that are not labeled.
[0250] If the receptor is not known, variants of full-length Clostridial toxins can be screened using cells that are known to be sensitive to treatment with native the Clostridial toxin. In this case there are several potential readouts for improved receptor binding, including the presence of the Clostridial toxin in the cell, measurement of cleaved SNARE protein by, e.g., Western blot or cell-based FRET activity assay, or inhibition of exocytosis, e.g., a neurotransmitter release assay.
[0251] Thus, in an embodiment, a modified Clostridial toxin comprising a targeting domain with enhanced binding activity comprises a modified Clostridial toxin HCC targeting domain with enhanced binding activity. In an aspect of this embodiment, a modified Clostridial toxin HCC targeting domain comprises a modified Clostridial toxin HCC targeting domain with an increased binding affinity or a modified Clostridial toxin HCC targeting domain fragment with an increased binding affinity. In another aspect of this embodiment, a modified Clostridial toxin binding domain comprises a modified Clostridial toxin HCC targeting domain with an increased binding specificity or a modified Clostridial toxin HCC targeting domain fragment with an increased binding specificity.
[0252] In another embodiment, a modified Clostridial toxin comprising a targeting domain with enhanced binding activity comprises a modified BoNT/A HCC targeting domain with enhanced binding activity. In an aspect of this embodiment, a modified Clostridial toxin comprises a modified BoNT/A HCC targeting domain with an increased binding affinity or a modified BoNT/A HCC targeting domain fragment with an increased binding affinity. In another aspect of this embodiment, a modified Clostridial toxin comprises a modified BoNT/A HCC targeting domain with an increased binding specificity or a modified BoNT/A HCC targeting domain fragment with an increased binding specificity.
[0253] In another embodiment, a modified BoNT/A HCC targeting domain with enhanced binding activity comprises a modification of amino acids 1111-1296 of SEQ ID NO: 1. In another aspect of this embodiment, a modified BoNT/A HCC targeting domain with an altered cell binding capability comprises a modified α-fold motif of a β-trefoil domain of a BoNT/A HCC targeting domain, a modified β-fold motif of a β-trefoil domain of a BoNT/A HCC targeting domain, or a modified γ-fold motif of a β-trefoil domain of a BoNT/A HCC targeting domain. In another aspect of this embodiment, a modified BoNT/A HCC targeting domain with an altered cell binding capability comprises a modification to amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1.
[0254] In other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1, at least 75% amino acid identity with amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1, at least 80% amino acid identity with amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1, at least 85% amino acid identity with amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1, at least 90% amino acid identity with amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1 or at least 95% amino acid identity with amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1. In yet other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1, at most 75% amino acid identity with amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1, at most 80% amino acid identity with amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1, at most 85% amino acid identity with amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1, at most 90% amino acid identity with amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1 or at most 95% amino acid identity with amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1.
[0255] In other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1. In other aspects of this embodiment, a modified BoNT/A HCC targeting domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1. In yet other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1. In other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1. In still other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1. In other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1.
[0256] In other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1. In other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1. In yet other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1. In other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1. In still other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1. In other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1111-1162, amino acids 1179-1223, or amino acids 1237-1296 of SEQ ID NO: 1.
[0257] In another embodiment, a modified BoNT/A HCC targeting domain with enhanced binding activity comprises a modified BoNT/A HCC targeting domain with enhanced binding activity of comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a BoNT/A HCC targeting domain or a β8/β9 hairpin turn of a β-trefoil domain of a BoNT/A HCC targeting domain. In another aspect of this embodiment, a modified BoNT/A HCC targeting domain with enhanced binding activity comprises a modification of amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1.
[0258] In other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1, at least 75% amino acid identity with amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1, at least 80% amino acid identity with amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1, at least 85% amino acid identity with amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1, at least 90% amino acid identity with amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1 or at least 95% amino acid identity with amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1. In yet other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1, at most 75% amino acid identity with amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1, at most 80% amino acid identity with amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1, at most 85% amino acid identity with amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1, at most 90% amino acid identity with amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1 or at most 95% amino acid identity with amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1.
[0259] In other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1. In other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1 can be replaced with phenylalanine. In yet other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1. In other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1. In still other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1. In other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1.
[0260] In other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1. In other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1 can be replaced with phenylalanine. In yet other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1. In other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1. In still other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1. In other aspects of this embodiment, a modified BoNT/A HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to amino acids 1163-1178 or amino acids 1224-1236 of SEQ ID NO: 1.
[0261] In other aspects of this embodiment, a modified BoNT/A HCC targeting domain with enhanced binding activity comprises a substitution of amino acid Trp 1101, Gly 1102, Leu 1105, Tyr 1111, Tyr 1112, Gly 1158, Ile 1163, Asp 1179, Glu 1203, Phe 1252, Ser 1264, Trp 1266, Tyr 1267, Gln 1270, Gly 1279 or Trp 1282, or any combination thereof, the substitution enhancing the binding activity of the modified BoNT/A HCC targeting domain. In other aspects of this embodiment, a modified BoNT/A HCC targeting domain with enhanced binding activity comprises a deletion of amino acid Trp 1101, Gly 1102, Leu 1105, Tyr 1111, Tyr 1112, Gly 1158, Ile 1163, Asp 1179, Glu 1203, Phe 1252, Ser 1264, Trp 1266, Tyr 1267, Gln 1270, Gly 1279 or Trp 1282, or any combination thereof, the deletion enhancing the binding activity of the modified BoNT/A HCC targeting domain.
[0262] In another embodiment, a modified Clostridial toxin comprising a targeting domain with enhanced binding activity comprises a modified BoNT/B HCC targeting domain with enhanced binding activity. In an aspect of this embodiment, a modified Clostridial toxin comprises a modified BoNT/B HCC targeting domain with an increased binding affinity or a modified BoNT/B HCC targeting domain fragment with an increased binding affinity. In another aspect of this embodiment, a modified Clostridial toxin comprises a modified BoNT/B HCC targeting domain with an increased binding specificity or a modified BoNT/B HCC targeting domain fragment with an increased binding specificity.
[0263] In another embodiment, a modified BoNT/B HCC targeting domain with enhanced binding activity comprises a modification of amino acids 1098-1291 of SEQ ID NO: 2. In another aspect of this embodiment, a modified BoNT/B HCC targeting domain with an altered cell binding capability comprises a modified α-fold motif of a β-trefoil domain of a BoNT/B HCC targeting domain, a modified β-fold motif of a β-trefoil domain of a BoNT/B HCC targeting domain, or a modified γ-fold motif of a β-trefoil domain of a BoNT/B HCC targeting domain. In another aspect of this embodiment, a modified BoNT/B HCC targeting domain with an altered cell binding capability comprises a modification to amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2.
[0264] In other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2, at least 75% amino acid identity with amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2, at least 80% amino acid identity with amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2, at least 85% amino acid identity with amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2, at least 90% amino acid identity with amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2 or at least 95% amino acid identity with amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2. In yet other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2, at most 75% amino acid identity with amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2, at most 80% amino acid identity with amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2, at most 85% amino acid identity with amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2, at most 90% amino acid identity with amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2 or at most 95% amino acid identity with amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2.
[0265] In other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2. In other aspects of this embodiment, a modified BoNT/B HCC targeting domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2. In yet other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2. In other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2. In still other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2. In other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2.
[0266] In other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a 11-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2. In other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2. In yet other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2. In other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2. In still other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2. In other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1098-1147, amino acids 1166-1210, or amino acids 1223-1291 of SEQ ID NO: 2.
[0267] In another embodiment, a modified BoNT/B HCC targeting domain with enhanced binding activity comprises a modified BoNT/B HCC targeting domain with enhanced binding activity of comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a BoNT/B HCC targeting domain or a β8/β9 hairpin turn of a β-trefoil domain of a BoNT/B HCC targeting domain. In another aspect of this embodiment, a modified BoNT/B HCC targeting domain with enhanced binding activity comprises a modification of amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2.
[0268] In other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2, at least 75% amino acid identity with amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2, at least 80% amino acid identity with amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2, at least 85% amino acid identity with amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2, at least 90% amino acid identity with amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2 or at least 95% amino acid identity with amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2. In yet other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2, at most 75% amino acid identity with amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2, at most 80% amino acid identity with amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2, at most 85% amino acid identity with amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2, at most 90% amino acid identity with amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2 or at most 95% amino acid identity with amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2.
[0269] In other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2. In other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2 can be replaced with phenylalanine. In yet other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2. In other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2. In still other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2. In other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2.
[0270] In other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a 11-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2. In other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2 can be replaced with phenylalanine. In yet other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2. In other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2. In still other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2. In other aspects of this embodiment, a modified BoNT/B HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to amino acids 1148-1165 or amino acids 1211-1222 of SEQ ID NO: 2.
[0271] In other aspects of this embodiment, a modified BoNT/B HCC targeting domain with enhanced binding activity comprises a substitution of amino acid Trp 1088, Gly 1089, Leu 1092, Tyr 1098, Tyr 1099, Gly 1142, Ile 1147, Asp 1165, Glu 1191, Ile 1240, Ser 1260, Trp 1262, Tyr 1263, Glu 1266, Gly 1277 or Trp 1280, or any combination thereof, the substitution enhancing the binding capability of the modified BoNT/B HCC targeting domain. In other aspects of this embodiment, a modified BoNT/B HCC targeting domain with enhanced binding activity comprises a deletion of amino acid Trp 1088, Gly 1089, Leu 1092, Tyr 1098, Tyr 1099, Gly 1142, Ile 1147, Asp 1165, Glu 1191, Ile 1240, Ser 1260, Trp 1262, Tyr 1263, Glu 1266, Gly 1277 or Trp 1280, or any combination thereof, the deletion enhancing the binding capability of the modified BoNT/B HCC targeting domain.
[0272] In another embodiment, a modified Clostridial toxin comprising a targeting domain with enhanced binding activity comprises a modified BoNT/C1 HCC targeting domain with enhanced binding activity. In an aspect of this embodiment, a modified Clostridial toxin comprises a modified BoNT/C1 HCC targeting domain with an increased binding affinity or a modified BoNT/C1 HCC targeting domain fragment with an increased binding affinity. In another aspect of this embodiment, a modified Clostridial toxin comprises a modified BoNT/C1 HCC targeting domain with an increased binding specificity or a modified BoNT/C1 HCC targeting domain fragment with an increased binding specificity.
[0273] In another embodiment, a modified BoNT/C1 HCC targeting domain with enhanced binding activity comprises a modification of amino acids 1112-1291 of SEQ ID NO: 3. In another aspect of this embodiment, a modified BoNT/C1 HCC targeting domain with an altered cell binding capability comprises a modified α-fold motif of a β-trefoil domain of a BoNT/C1 HCC targeting domain, a modified β-fold motif of a β-trefoil domain of a BoNT/C1 HCC targeting domain, or a modified γ-fold motif of a β-trefoil domain of a BoNT/C1 HCC targeting domain. In another aspect of this embodiment, a modified BoNT/C1 HCC targeting domain with an altered cell binding capability comprises a modification to amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3.
[0274] In other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a 11-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3, at least 75% amino acid identity with amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3, at least 80% amino acid identity with amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3, at least 85% amino acid identity with amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3, at least 90% amino acid identity with amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3 or at least 95% amino acid identity with amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3. In yet other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3, at most 75% amino acid identity with amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3, at most 80% amino acid identity with amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3, at most 85% amino acid identity with amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3, at most 90% amino acid identity with amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3 or at most 95% amino acid identity with amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3.
[0275] In other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3. In other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3. In yet other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3. In other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3. In still other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3. In other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3.
[0276] In other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3. In other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3. In yet other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3. In other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3. In still other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3. In other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1112-1150, amino acids 1167-1218, or amino acids 1230-1291 of SEQ ID NO: 3.
[0277] In another embodiment, a modified BoNT/C1 HCC targeting domain with enhanced binding activity comprises a modified BoNT/C1 HCC targeting domain with enhanced binding activity of comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a BoNT/C1 HCC targeting domain or a β8/β9 hairpin turn of a β-trefoil domain of a BoNT/C1 HCC targeting domain. In another aspect of this embodiment, a modified BoNT/C1 HCC targeting domain with enhanced binding activity comprises a modification of amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3.
[0278] In other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3, at least 75% amino acid identity with amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3, at least 80% amino acid identity with amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3, at least 85% amino acid identity with amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3, at least 90% amino acid identity with amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3 or at least 95% amino acid identity with amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3. In yet other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3, at most 75% amino acid identity with amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3, at most 80% amino acid identity with amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3, at most 85% amino acid identity with amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3, at most 90% amino acid identity with amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3 or at most 95% amino acid identity with amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3.
[0279] In other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3. In other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3 can be replaced with phenylalanine. In yet other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3. In other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3. In still other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3. In other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3.
[0280] In other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3. In other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3 can be replaced with phenylalanine. In yet other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3. In other aspects of this embodiment, a modified BoNT/C1HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3. In still other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3. In other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to amino acids 1151-1166 or amino acids 1219-1229 of SEQ ID NO: 3.
[0281] In other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain with enhanced binding activity comprises a substitution of amino acid Trp 1102, Gly 1103, Leu 1106, Tyr 1112, Tyr 1113, Gly 1145, Ile 1150, Asp 1166, Glu 1196, Ile 1247, Gly 1256, Trp 1258, Tyr 1259, H is 1261, Gly 1281 or Trp 1284, or any combination thereof, the substitution enhancing the binding activity of the modified BoNT/C1 HCC targeting domain. In other aspects of this embodiment, a modified BoNT/C1 HCC targeting domain with enhanced binding activity comprises a deletion of amino acid Trp 1102, Gly 1103, Leu 1106, Tyr 1112, Tyr 1113, Gly 1145, Ile 1150, Asp 1166, Glu 1196, Ile 1247, Gly 1256, Trp 1258, Tyr 1259, H is 1261, Gly 1281 or Trp 1284, or any combination thereof, the deletion enhancing the binding activity of the modified BoNT/C1 HCC targeting domain.
[0282] In another embodiment, a modified Clostridial toxin comprising a targeting domain with enhanced binding activity comprises a modified BoNT/D HCC targeting domain with enhanced binding activity. In an aspect of this embodiment, a modified Clostridial toxin comprises a modified BoNT/D HCC targeting domain with an increased binding affinity or a modified BoNT/D HCC targeting domain fragment with an increased binding affinity. In another aspect of this embodiment, a modified Clostridial toxin comprises a modified BoNT/D HCC targeting domain with an increased binding specificity or a modified BoNT/D HCC targeting domain fragment with an increased binding specificity.
[0283] In another embodiment, a modified BoNT/D HCC targeting domain with enhanced binding activity comprises a modification of amino acids 1099-1276 of SEQ ID NO: 4. In another aspect of this embodiment, a modified BoNT/D HCC targeting domain with an altered cell binding capability comprises a modified α-fold motif of a β-trefoil domain of a BoNT/D HCC targeting domain, a modified β-fold motif of a β-trefoil domain of a BoNT/D HCC targeting domain, or a modified γ-fold motif of a β-trefoil domain of a BoNT/D HCC targeting domain. In another aspect of this embodiment, a modified BoNT/D HCC targeting domain with an altered cell binding capability comprises a modification to amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4.
[0284] In other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4, at least 75% amino acid identity with amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4, at least 80% amino acid identity with amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4, at least 85% amino acid identity with amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4, at least 90% amino acid identity with amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4 or at least 95% amino acid identity with amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4. In yet other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4, at most 75% amino acid identity with amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4, at most 80% amino acid identity with amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4, at most 85% amino acid identity with amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4, at most 90% amino acid identity with amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4 or at most 95% amino acid identity with amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4.
[0285] In other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4. In other aspects of this embodiment, a modified BoNT/D HCC targeting domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4. In yet other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4. In other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4. In still other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4. In other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4.
[0286] In other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4. In other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4. In yet other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4. In other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4. In still other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4. In other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1099-1137, amino acids 1154-1207, or amino acids 1219-1276 of SEQ ID NO: 4.
[0287] In another embodiment, a modified BoNT/D HCC targeting domain with enhanced binding activity comprises a modified BoNT/D HCC targeting domain with enhanced binding activity of comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a BoNT/D HCC targeting domain or a β8/β9 hairpin turn of a β-trefoil domain of a BoNT/D HCC targeting domain. In another aspect of this embodiment, a modified BoNT/D HCC targeting domain with enhanced binding activity comprises a modification of amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4.
[0288] In other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4, at least 75% amino acid identity with amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4, at least 80% amino acid identity with amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4, at least 85% amino acid identity with amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4, at least 90% amino acid identity with amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4 or at least 95% amino acid identity with amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4. In yet other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4, at most 75% amino acid identity with amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4, at most 80% amino acid identity with amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4, at most 85% amino acid identity with amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4, at most 90% amino acid identity with amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4 or at most 95% amino acid identity with amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4.
[0289] In other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4. In other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4 can be replaced with phenylalanine. In yet other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4. In other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4. In still other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4. In other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4.
[0290] In other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4. In other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4 can be replaced with phenylalanine. In yet other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4. In other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4. In still other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4. In other aspects of this embodiment, a modified BoNT/D HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to amino acids 1138-1153 or amino acids 1208-1218 of SEQ ID NO: 4.
[0291] In other aspects of this embodiment, a modified BoNT/D HCC targeting domain with enhanced binding activity comprises a substitution of amino acid Trp 1089, Gly 1090, Leu 1093, Tyr 1099, Tyr 1100, Gly 1132, Ile 1137, Asp 1153, Asn 1186, Lys 1236, Trp 1238, Arg 1239, Phe 1242, Ser 1262 or Trp 1265, or any combination thereof, the substitution enhancing the binding activity of the modified BoNT/D HCC targeting domain. In other aspects of this embodiment, a modified BoNT/D HCC targeting domain with enhanced binding activity comprises a deletion of amino acid Trp 1089, Gly 1090, Leu 1093, Tyr 1099, Tyr 1100, Gly 1132, Ile 1137, Asp 1153, Asn 1186, Lys 1236, Trp 1238, Arg 1239, Phe 1242, Ser 1262 or Trp 1265, or any combination thereof, the deletion enhancing the binding activity of the modified BoNT/D HCC targeting domain.
[0292] In another embodiment, a modified Clostridial toxin comprising a targeting domain with enhanced binding activity comprises a modified BoNT/E HCC targeting domain with enhanced binding activity. In an aspect of this embodiment, a modified Clostridial toxin comprises a modified BoNT/E HCC targeting domain with an increased binding affinity or a modified BoNT/E HCC targeting domain fragment with an increased binding affinity. In another aspect of this embodiment, a modified Clostridial toxin comprises a modified BoNT/E HCC targeting domain with an increased binding specificity or a modified BoNT/E HCC targeting domain fragment with an increased binding specificity.
[0293] In another embodiment, a modified BoNT/E HCC targeting domain with enhanced binding activity comprises a modification of amino acids 1086-1252 of SEQ ID NO: 5. In another aspect of this embodiment, a modified BoNT/E HCC targeting domain with an altered cell binding capability comprises a modified α-fold motif of a β-trefoil domain of a BoNT/E HCC targeting domain, a modified β-fold motif of a β-trefoil domain of a BoNT/E HCC targeting domain, or a modified γ-fold motif of a β-trefoil domain of a BoNT/E HCC targeting domain. In another aspect of this embodiment, a modified BoNT/E HCC targeting domain with an altered cell binding capability comprises a modification to amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5.
[0294] In other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a 11-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5, at least 75% amino acid identity with amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5, at least 80% amino acid identity with amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5, at least 85% amino acid identity with amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5, at least 90% amino acid identity with amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5 or at least 95% amino acid identity with amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5. In yet other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5, at most 75% amino acid identity with amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5, at most 80% amino acid identity with amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5, at most 85% amino acid identity with amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5, at most 90% amino acid identity with amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5 or at most 95% amino acid identity with amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5.
[0295] In other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5. In other aspects of this embodiment, a modified BoNT/E HCC targeting domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5. In yet other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5. In other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5. In still other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5. In other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5.
[0296] In other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5. In other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5. In yet other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5. In other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5. In still other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5. In other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1086-1129, amino acids 1147-1190, or amino acids 1199-1252 of SEQ ID NO: 5.
[0297] In another embodiment, a modified BoNT/E HCC targeting domain with enhanced binding activity comprises a modified BoNT/E HCC targeting domain with enhanced binding activity of comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a BoNT/E HCC targeting domain or a β8/β9 hairpin turn of a β-trefoil domain of a BoNT/E HCC targeting domain. In another aspect of this embodiment, a modified BoNT/E HCC targeting domain with enhanced binding activity comprises a modification of amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5.
[0298] In other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a 11-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5, at least 75% amino acid identity with amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5, at least 80% amino acid identity with amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5, at least 85% amino acid identity with amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5, at least 90% amino acid identity with amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5 or at least 95% amino acid identity with amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5. In yet other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5, at most 75% amino acid identity with amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5, at most 80% amino acid identity with amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5, at most 85% amino acid identity with amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5, at most 90% amino acid identity with amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5 or at most 95% amino acid identity with amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5.
[0299] In other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5. In other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5 can be replaced with phenylalanine. In yet other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5. In other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5. In still other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5. In other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5.
[0300] In other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5. In other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5 can be replaced with phenylalanine. In yet other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5. In other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5. In still other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5. In other aspects of this embodiment, a modified BoNT/E HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to amino acids 1130-1146 or amino acids 1191-1198 of SEQ ID NO: 5.
[0301] In other aspects of this embodiment, a modified BoNT/E HCC targeting domain with enhanced binding activity comprises a substitution of amino acid Trp 1076, Gly 1077, Leu 1080, Tyr 1086, Tyr 1087, Gly 1124, Ile 1129, Asp 1146, Glu 1172, Phe 1213, Ser 1221, Trp 1223, Tyr 1224, H is 1227, Gly 1236 or Trp 1239, or any combination thereof, the substitution enhancing the binding activity of the modified BoNT/E HCC targeting domain. In other aspects of this embodiment, a modified BoNT/E HCC targeting domain with enhanced binding activity comprises a deletion of amino acid Trp 1076, Gly 1077, Leu 1080, Tyr 1086, Tyr 1087, Gly 1124, Ile 1129, Asp 1146, Glu 1172, Phe 1213, Ser 1221, Trp 1223, Tyr 1224, His 1227, Gly 1236 or Trp 1239, or any combination thereof, the deletion enhancing the binding activity of the modified BoNT/E HCC targeting domain.
[0302] In another embodiment, a modified Clostridial toxin comprising a targeting domain with enhanced binding activity comprises a modified BoNT/F HCC targeting domain with enhanced binding activity. In an aspect of this embodiment, a modified Clostridial toxin comprises a modified BoNT/F HCC targeting domain with an increased binding affinity or a modified BoNT/F HCC targeting domain fragment with an increased binding affinity. In another aspect of this embodiment, a modified Clostridial toxin comprises a modified BoNT/F HCC targeting domain with an increased binding specificity or a modified BoNT/F HCC targeting domain fragment with an increased binding specificity.
[0303] In another embodiment, a modified BoNT/F HCC targeting domain with enhanced binding activity comprises a modification of amino acids 1106-1274 of SEQ ID NO: 6. In another aspect of this embodiment, a modified BoNT/F HCC targeting domain with an altered cell binding capability comprises a modified α-fold motif of a β-trefoil domain of a BoNT/F HCC targeting domain, a modified β-fold motif of a β-trefoil domain of a BoNT/F HCC targeting domain, or a modified γ-fold motif of a β-trefoil domain of a BoNT/F HCC targeting domain. In another aspect of this embodiment, a modified BoNT/F HCC targeting domain with an altered cell binding capability comprises a modification to amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6.
[0304] In other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6, at least 75% amino acid identity with amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6, at least 80% amino acid identity with amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6, at least 85% amino acid identity with amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6, at least 90% amino acid identity with amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6 or at least 95% amino acid identity with amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6. In yet other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6, at most 75% amino acid identity with amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6, at most 80% amino acid identity with amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6, at most 85% amino acid identity with amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6, at most 90% amino acid identity with amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6 or at most 95% amino acid identity with amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6.
[0305] In other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6. In other aspects of this embodiment, a modified BoNT/F HCC targeting domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6. In yet other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6. In other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6. In still other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6. In other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6.
[0306] In other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6. In other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6. In yet other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6. In other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6. In still other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6. In other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1106-1152, amino acids 1172-1213, or amino acids 1222-1274 of SEQ ID NO: 6.
[0307] In another embodiment, a modified BoNT/F HCC targeting domain with enhanced binding activity comprises a modified BoNT/F HCC targeting domain with enhanced binding activity of comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a BoNT/F HCC targeting domain or a β8/β9 hairpin turn of a β-trefoil domain of a BoNT/F HCC targeting domain. In another aspect of this embodiment, a modified BoNT/F HCC targeting domain with enhanced binding activity comprises a modification of amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6.
[0308] In other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6, at least 75% amino acid identity with amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6, at least 80% amino acid identity with amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6, at least 85% amino acid identity with amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6, at least 90% amino acid identity with amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6 or at least 95% amino acid identity with amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6. In yet other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6, at most 75% amino acid identity with amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6, at most 80% amino acid identity with amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6, at most 85% amino acid identity with amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6, at most 90% amino acid identity with amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6 or at most 95% amino acid identity with amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6.
[0309] In other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a 11-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6. In other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6 can be replaced with phenylalanine. In yet other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6. In other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6. In still other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6. In other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6.
[0310] In other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6. In other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6 can be replaced with phenylalanine. In yet other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6. In other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6. In still other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6. In other aspects of this embodiment, a modified BoNT/F HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to amino acids 1153-1171 or amino acids 1214-1221 of SEQ ID NO: 6.
[0311] In other aspects of this embodiment, a modified BoNT/F HCC targeting domain with enhanced binding activity comprises a substitution of amino acid Trp 1096, Gly 1097, Leu 1100, Tyr 1106, Tyr 1107, Gly 1147, Ile 1152, Asp 1171, Glu 1195, Phe 1237, Ser 1245, Trp 1247, Tyr 1248, Asn 1251, Gly 1260 or Trp 1263, or any combination thereof, the substitution enhancing the binding activity of the modified BoNT/F HCC targeting domain. In other aspects of this embodiment, a modified BoNT/F HCC targeting domain with enhanced binding activity comprises a deletion of amino acid Trp 1096, Gly 1097, Leu 1100, Tyr 1106, Tyr 1107, Gly 1147, Ile 1152, Asp 1171, Glu 1195, Phe 1237, Ser 1245, Trp 1247, Tyr 1248, Asn 1251, Gly 1260 or Trp 1263, or any combination thereof, the deletion enhancing the binding activity of the modified BoNT/F HCC targeting domain.
[0312] In another embodiment, a modified Clostridial toxin comprising a targeting domain with enhanced binding activity comprises a modified BoNT/G HCC targeting domain with enhanced binding activity. In an aspect of this embodiment, a modified Clostridial toxin comprises a modified BoNT/G HCC targeting domain with an increased binding affinity or a modified BoNT/G HCC targeting domain fragment with an increased binding affinity. In another aspect of this embodiment, a modified Clostridial toxin comprises a modified BoNT/G HCC targeting domain with an increased binding specificity or a modified BoNT/G HCC targeting domain fragment with an increased binding specificity.
[0313] In another embodiment, a modified BoNT/G HCC targeting domain with enhanced binding activity comprises a modification of amino acids 1106-1297 of SEQ ID NO: 7. In another aspect of this embodiment, a modified BoNT/G HCC targeting domain with an altered cell binding capability comprises a modified α-fold motif of a β-trefoil domain of a BoNT/G HCC targeting domain, a modified β-fold motif of a β-trefoil domain of a BoNT/G HCC targeting domain, or a modified γ-fold motif of a β-trefoil domain of a BoNT/G HCC targeting domain. In another aspect of this embodiment, a modified BoNT/G HCC targeting domain with an altered cell binding capability comprises a modification to amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7.
[0314] In other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a 11-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7, at least 75% amino acid identity with amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7, at least 80% amino acid identity with amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7, at least 85% amino acid identity with amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7, at least 90% amino acid identity with amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7 or at least 95% amino acid identity with amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7. In yet other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7, at most 75% amino acid identity with amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7, at most 80% amino acid identity with amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7, at most 85% amino acid identity with amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7, at most 90% amino acid identity with amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7 or at most 95% amino acid identity with amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7.
[0315] In other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7. In other aspects of this embodiment, a modified BoNT/G HCC targeting domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7. In yet other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7. In other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7. In still other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7. In other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7.
[0316] In other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7. In other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7. In yet other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7. In other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7. In still other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7. In other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1106-1153, amino acids 1173-1218, or amino acids 1231-1297 of SEQ ID NO: 7.
[0317] In another embodiment, a modified BoNT/G HCC targeting domain with enhanced binding activity comprises a modified BoNT/G HCC targeting domain with enhanced binding activity of comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a BoNT/G HCC targeting domain or a β8/β9 hairpin turn of a β-trefoil domain of a BoNT/G HCC targeting domain. In another aspect of this embodiment, a modified BoNT/G HCC targeting domain with enhanced binding activity comprises a modification of amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7.
[0318] In other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a 11-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7, at least 75% amino acid identity with amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7, at least 80% amino acid identity with amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7, at least 85% amino acid identity with amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7, at least 90% amino acid identity with amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7 or at least 95% amino acid identity with amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7. In yet other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7, at most 75% amino acid identity with amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7, at most 80% amino acid identity with amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7, at most 85% amino acid identity with amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7, at most 90% amino acid identity with amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7 or at most 95% amino acid identity with amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7.
[0319] In other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7. In other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7 can be replaced with phenylalanine. In yet other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7. In other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7. In still other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7. In other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7.
[0320] In other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7. In other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7 can be replaced with phenylalanine. In yet other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7. In other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7. In still other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7. In other aspects of this embodiment, a modified BoNT/G HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to amino acids 1154-1172 or amino acids 1219-1230 of SEQ ID NO: 7.
[0321] In other aspects of this embodiment, a modified BoNT/G HCC targeting domain with enhanced binding activity comprises a substitution of amino acid Trp 1096, Gly 1097, Leu 1100, Tyr 1106, Tyr 1107, Gly 1148, Ile 1153, Asp 1172, Gln 1198, Ile 1245, Ser 1266, Trp 1268, Tyr 1269, Arg 1272, Gly 1283 or Trp 1285, or any combination thereof, the substitution enhancing the binding activity of the modified BoNT/G HCC targeting domain. In other aspects of this embodiment, a modified BoNT/G HCC targeting domain with enhanced binding activity comprises a deletion of amino acid Trp 1096, Gly 1097, Leu 1100, Tyr 1106, Tyr 1107, Gly 1148, Ile 1153, Asp 1172, Gln 1198, Ile 1245, Ser 1266, Trp 1268, Tyr 1269, Arg 1272, Gly 1283 or Trp 1285, or any combination thereof, the deletion enhancing the binding activity of the modified BoNT/G HCC targeting domain.
[0322] In another embodiment, a modified Clostridial toxin comprising a targeting domain with enhanced binding activity comprises a modified TeNT HCC targeting domain with enhanced binding activity. In an aspect of this embodiment, a modified Clostridial toxin comprises a modified TeNT HCC targeting domain with an increased binding affinity or a modified TeNT HCC targeting domain fragment with an increased binding affinity. In another aspect of this embodiment, a modified Clostridial toxin comprises a modified TeNT HCC targeting domain with an increased binding specificity or a modified TeNT HCC targeting domain fragment with an increased binding specificity.
[0323] In another embodiment, a modified TeNT HCC targeting domain with enhanced binding activity comprises a modification of amino acids 1128-1315 of SEQ ID NO: 8. In another aspect of this embodiment, a modified TeNT HCC targeting domain with an altered cell binding capability comprises a modified α-fold motif of a β-trefoil domain of a TeNT HCC targeting domain, a modified β-fold motif of a β-trefoil domain of a TeNT HCC targeting domain, or a modified γ-fold motif of a β-trefoil domain of a TeNT HCC targeting domain. In another aspect of this embodiment, a modified TeNT HCC targeting domain with an altered cell binding capability comprises a modification to amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8.
[0324] In other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8, at least 75% amino acid identity with amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8, at least 80% amino acid identity with amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8, at least 85% amino acid identity with amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8, at least 90% amino acid identity with amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8 or at least 95% amino acid identity with amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8. In yet other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8, at most 75% amino acid identity with amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8, at most 80% amino acid identity with amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8, at most 85% amino acid identity with amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8, at most 90% amino acid identity with amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8 or at most 95% amino acid identity with amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8.
[0325] In other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8. In other aspects of this embodiment, a modified TeNT HCC targeting domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8. In yet other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8. In other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8. In still other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8. In other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8.
[0326] In other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8. In other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8. In yet other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8. In other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8. In still other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8. In other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1128-1177, amino acids 1195-1240, or amino acids 1255-1315 of SEQ ID NO: 8.
[0327] In another embodiment, a modified TeNT HCC targeting domain with enhanced binding activity comprises a modified TeNT HCC targeting domain with enhanced binding activity of comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a TeNT HCC targeting domain or a β8/β9 hairpin turn of a β-trefoil domain of a TeNT HCC targeting domain. In another aspect of this embodiment, a modified TeNT HCC targeting domain with enhanced binding activity comprises a modification of amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8.
[0328] In other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8, at least 75% amino acid identity with amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8, at least 80% amino acid identity with amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8, at least 85% amino acid identity with amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8, at least 90% amino acid identity with amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8 or at least 95% amino acid identity with amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8. In yet other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8, at most 75% amino acid identity with amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8, at most 80% amino acid identity with amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8, at most 85% amino acid identity with amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8, at most 90% amino acid identity with amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8 or at most 95% amino acid identity with amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8.
[0329] In other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8. In other aspects of this embodiment, a modified TeNT HCC targeting domain comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid substitutions relative to amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8 can be replaced with phenylalanine. In yet other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8. In other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid deletions relative to amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8. In still other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8. In other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 non-contiguous amino acid additions relative to amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8.
[0330] In other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8. In other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid substitutions relative to amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8 can be replaced with phenylalanine. In yet other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8. In other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid deletions relative to amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8. In still other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8. In other aspects of this embodiment, a modified TeNT HCC targeting domain comprising a β-trefoil fold domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine or 10 contiguous amino acid additions relative to amino acids 1178-1194 or amino acids 1241-1254 of SEQ ID NO: 8.
[0331] In other aspects of this embodiment, a modified TeNT HCC targeting domain with enhanced binding activity comprises a substitution of amino acid Trp 1118, Gly 1119, Leu 1122, Tyr 1128, Tyr 1129, Gly 1172, Ile 1177, Asp 1194, Asp 1222, Thr 1270, Ser 1287, Trp 1289, Tyr 1290, H is 1293, Gly 1300 or Trp 1303, or any combination thereof, the substitution enhancing the binding activity of the modified TeNT HCC targeting domain. In other aspects of this embodiment, a modified TeNT HCC targeting domain with enhanced binding activity comprises a deletion of amino acid Trp 1118, Gly 1119, Leu 1122, Tyr 1128, Tyr 1129, Gly 1172, Ile 1177, Asp 1194, Asp 1222, Thr 1270, Ser 1287, Trp 1289, Tyr 1290, H is 1293, Gly 1300 or Trp 1303, or any combination thereof, the deletion enhancing the binding activity of the modified TeNT HCC targeting domain.
[0332] Another example of an enhanced targeting domain that increases binding activity for an endogenous Clostridial toxin receptor present on a naturally-occurring Clostridial toxin target cell, includes, without limitation, non-toxin associated proteins of Clostridial toxins, such as, e.g., non-toxic non-hemagglutinin (NTNH), hemagglutinin-17 (HA-17), hemagglutinin-33 (HA-33) and hemagglutinin-70 (HA-70). In vivo, Clostridial bacteria produce a toxin complex comprising the approximately 150-kDa Clostridial toxin and other proteins collectively called nontoxin associated proteins (NAPs). Identified NAPs include proteins possessing hemaglutination activity, such, e.g., a hemagglutinin of approximately 17-kDa (HA-17), a hemagglutinin of approximately 33-kDa (HA-33) and a hemagglutinin of approximately 70-kDa (HA-70); as well as non-toxic non-hemagglutinin (NTNH), a protein of approximately 130-kDa, see, e.g., Eric A. Johnson and Marite Bradshaw, Clostridial botulinum and its Neurotoxins: A Metabolic and Cellular Perspective, 39 Toxicon 1703-1722 (2001); and Stephanie Raffestin et al., Organization and Regulation of the Neurotoxin Genes in Clostridium botulinum and Clostridium tetani, 10 Anaerobe 93-100 (2004). The toxin complex is important for the intoxication process because it provides protection from adverse environmental conditions, resistance to protease digestion, and appears to facilitate internalization and activation of the toxin.
[0333] Recent crystallography experiments have revealed that HA-17, HA-33 and NTNH from various Clostridial bacteria contain a region comprising β-trefoil domains very similar to the single β-trefoil domain present in the binding domain of Clostridial toxins, see, e.g., Kaoru Inoue et al., Structural Analysis by X-Ray Crystallography and calorimtry of a Haemagglutinin Component (HA1) of the Progenitor Toxin from Clostridium botulinum, 149 Microbiol. 3361-3370 (2003); and Joseph W. Arndt et al., The Structure of the Neurotoxin-Associated Protein HA33/A from Clostridial botulinum Suggests a Reoccurring β-trefoil Fold in the Progenitor Toxin Complex, 346 J. Mol. Biol. 1083-1093 (2005). For example, HA-33 from Clostridium botulinum serotype A has two β-trefoil domains, each of which consists of three potential carbohydrate binding moieties or β-trefoil folds, designated 1α (amino acids 10-55 of SEQ ID NO: 9), 111 (amino acids 56-102 of SEQ ID NO: 9) and 1γ (amino acids 103-144 of SEQ ID NO: 9) for the first β-trefoil domain and 2α (amino acids 151-197 of SEQ ID NO: 9), 2β (amino acids 198-245 of SEQ ID NO: 9) and 2γ (amino acids 246-293 of SEQ ID NO: 9) for the second β-trefoil domain. Mutations in conserved amino acids of the carbohydrate binding moiety result in a loss of carbohydrate binding, see, e.g., Kaoru Inoue et al., Structural Analysis by X-Ray Crystallography and calorimetry of a Haemagglutinin Component (HA1) of the Progenitor Toxin from Clostridium botulinum, 149 Microbiol. 3361-3370 (2003).
[0334] These β-trefoil domains are also found in the HA-33 proteins produced by Clostridium botulinum serotype B, serotype C1 and serotype D and sequence alignments revealed that amino acids essential for overall carbohydrate binding are conserved. The amino acids predicted to be essential for carbohydrate binding are as follows Asp 263, Tyr 265, Gln 268, Gln 276, Phe 278 and Gln 286 of HA-33/A1 of SEQ ID NO: 9, HA-33/A2 of SEQ ID NO: 10, HA-33/A3 of SEQ ID NO: 11, HA-33/A5 of SEQ ID NO: 12 and HA-33/B2 of SEQ ID NO: 15; Asp 264, Tyr 266, Gln 269, Gln 277, Phe 279 and Gln 287 of HA-33/A4 of SEQ ID NO: 12; Asp 262, Tyr 264, Gln 267, Gln 275, Phe 277 and Gln 285 of HA-33/B1 of SEQ ID NO: 14; Asp 255, Val 257, Gly 260, Gln 268, Typ 270 and Gln 278 of HA-33/C1 of SEQ ID NO: 16; and Asp 256, Tyr 258, Gln 261, Ile 269, Asp 271 and Gln 279 of HA-33/C2 of SEQ ID NO: 17 and HA-33/D of SEQ ID NO: 18. Immunoaffinity column chromatography and pull-down assays have shown that HA-33 can bind synaptotagmin II, a putative Clostridial toxin receptor, see, e.g., Yu Zhou et al., Haemagglutinin-33 of Type Q Botulinum Neurotoxin Complex Binds with Synaptotagmin II, 272 FEBS Lett. 2717-2726 (2005). The amino acid sequences comprising the β-trefoil domains found in various Clostridial HA-33 proteins are shown in Tables 3 and 4.
TABLE-US-00003 TABLE 3 β-trefoil Domains of Clostridial HA-33 Proteins Amino Acid Sequence Region of Carbohydrate Binding Moieties 1β4/β5 1β8/β9 Protein SEQ ID NO: 1α-fold β-hairpin turn 1β-fold β-hairpin turn 1γ-fold HA-33/A1 9 10-54 55-59 60-100 101-104 105-144 HA-33/A2 10 10-54 55-59 60-100 101-104 105-144 HA-33/A3 11 10-54 55-59 60-100 101-104 105-144 HA-33/A4 12 10-56 57-61 62-102 103-106 107-146 HA-33/A5 13 10-54 55-59 60-100 101-104 105-144 HA-33/B1 14 10-54 55-59 60-100 101-104 105-144 HA-33/B2 15 10-56 57-61 62-102 103-106 107-146 HA-33/C1-1 16 10-54 55-59 60-98 99-102 103-141 HA-33/C1-2 17 10-54 55-59 60-98 99-102 103-141 HA-33/D1 18 10-54 55-59 60-98 99-102 103-141
TABLE-US-00004 TABLE 4 β-trefoil Domains of Clostridial HA-33 Proteins Amino Acid Sequence Region of Carbohydrate Binding Moieties 2β4/β5 2β8/β9 Protein SEQ ID NO: 2α-fold β-hairpin turn 2β-fold β-hairpin turn 2γ-fold HA-33/A1 9 151-195 196-199 200-242 243-248 249-293 HA-33/A2 10 151-195 196-199 200-242 243-248 249-293 HA-33/A3 11 151-195 196-199 200-242 243-248 249-293 HA-33/A4 12 153-197 198-201 202-243 244-249 250-294 HA-33/A5 13 151-195 196-199 200-242 243-248 249-279 HA-33/B1 14 151-195 196-199 200-241 242-247 248-292 HA-33/B2 15 153-197 198-201 200-242 243-248 249-291 HA-33/C1-1 16 148-190 191-194 195-234 235-240 241-285 HA-33/C1-2 17 148-190 191-194 195-235 236-241 242-286 HA-33/D1 18 148-190 191-194 195-235 236-241 242-286
[0335] Further analysis of the β-trefoil domain sequence of HA-33 also identified β-trefoil domains in HA-17 and NTNH, see, e.g., Joseph W. Arndt et al., The Structure of the Neurotoxin-Associated Protein HA33/A from Clostridial botulinum Suggests a Reoccurring β-trefoil Fold in the Progenitor Toxin Complex, 346 J. Mol. Biol. 1083-1093 (2005). The HA-17 comprises a single β-trefoil domain containing three carbohydrate binding moieties or β-trefoil folds. The carbohydrate binding moieties of HA-17 exhibits the greatest sequence similarity with the 2γ carbohydrate binding moiety of HA-33. These β-trefoil domains are also found in the HA-17 proteins produced by Clostridium botulinum serotype B, serotype C1 and serotype D and sequence alignments revealed that amino acids essential for overall carbohydrate binding are conserved. The amino acids predicted to be essential for carbohydrate binding are as follows Tyr 110, Typ 112, Tyr 115, Pro 130, Phe 132 and Asn 138 of HA-17/A of SEQ ID NO: 19, HA-17/B of SEQ ID NO: 20, HA-17/C1 of SEQ ID NO: 21 and HA-17/D of SEQ ID NO: 22. The amino acid sequences comprising the β-trefoil domains found in various Clostridial HA-17 proteins are shown in Table 5.
TABLE-US-00005 TABLE 5 β-trefoil Domains of Clostridial HA-17 Proteins Amino Acid Sequence Region of Carbohydrate Binding Moieties β4/β5 β8/β9 Protein SEQ ID NO: α-fold β-hairpin turn β-fold β-hairpin turn γ-fold HA-17/A 19 9-50 51-54 55-91 92-94 95-146 HA-17/B 20 9-50 51-54 55-91 92-94 95-146 HA-17/C1 21 9-50 51-54 55-91 92-94 95-146 HA-17/D 22 9-50 51-54 55-91 92-94 95-146
[0336] NTNH from various Clostridial bacteria shows significant sequence similarity to the β-trefoil domains present in the cell binding domain of BoNT/A and TeNT. The high degree of structural similarity is interesting in light of the low sequence similarity between NTNH and the Clostridial toxins. Furthermore, since NTNH of the various serotypes have greater sequence similarity than the Clostridial toxins, it is likely that the NTNH produced by other Clostridial strains will also have β-trefoil domains exhibiting high structural similarity with the binding domains of Clostridial toxins. The β-trefoil domains of various Clostridial NTNHs are as follows: amino acids 1050-1193 of NTNH/A1 of SEQ ID NO: 23; amino acids 1050-1198 of NTNH/A2 of SEQ ID NO: 24; amino acids 1050-1193 of NTNH/A3 of SEQ ID NO: 25; amino acids 1049-1197 of NTNH/B of SEQ ID NO: 26; amino acids 1049-1196 of NTNH/C1 of SEQ ID NO: 27; amino acids 1049-1196 of NTNH/D of SEQ ID NO: 28; amino acids 1014-1162 of NTNH/E of SEQ ID NO: 29; amino acids 1016-1159 of NTNH/F1 of SEQ ID NO: 30; amino acids 1017-1165 of NTNH/F2 of SEQ ID NO: 31; and amino acids 1050-1198 of NTNH/G of SEQ ID NO: 32. The amino acid sequences comprising the β-trefoil domains found in various Clostridial NTNH proteins are shown in Table 6.
[0337] The β-trefoil domains present in the Clostridial toxin, HA-33, HA-17 and NTNH collectively form nearly half the mass of a Clostridial toxin complex and underlies the apparent importance of carbohydrate binding in the cell binding step of the intoxication process. This observation is further enhanced by the fact that a Clostridial toxin alone is not as effective in intoxicating a cell as the entire toxin complex. One potential explanation for this enhanced binding activity is the presence, both in type and in quantity, of the β-trefoil domains present in HA-33, HA-17 and NTNH. Therefore, the high prediction of structural similarity of the β-trefoil domains present in HA-33, HA-17 and NTNH relative to the β-trefoil domain found in Clostridial toxins provides a potential source of binding domains useful for developing modified Clostridial toxins with enhanced binding activity. As a non-limiting example, a carbohydrate binding moiety or a β-trefoil fold from HA-33, HA-17 or NTNH can be substituted for the naturally occurring carbohydrate binding moiety present in a Clostridial toxin. As another non-limiting example, a carbohydrate binding moiety or a β-trefoil fold from HA-33, HA-17 or NTNH can be added in addition to the naturally occurring carbohydrate binding moiety present in a Clostridial toxin. As yet another non-limiting example, a multiple carbohydrate binding moieties or a β-trefoil folds from HA-33, HA-17 or NTNH can be substituted for the naturally occurring carbohydrate binding moiety present in a Clostridial toxin. As still another non-limiting example, multiple carbohydrate binding moieties or a β-trefoil folds from HA-33, HA-17 or NTNH can be added in addition to the naturally occurring carbohydrate binding moiety present in a Clostridial toxin. As another non-limiting example, multiple carbohydrate binding moieties or a β-trefoil folds from a Clostridial toxin binding domain can be added in addition to the naturally occurring carbohydrate binding moiety present in a Clostridial toxin.
TABLE-US-00006 TABLE 6 β-trefoil Domains of Clostridial NTNH Proteins Amino Acid Sequence Region of Carbohydrate Binding Moieties β4/β5 β8/β9 Protein SEQ ID NO: α-fold β-hairpin turn β-fold β-hairpin turn γ-fold NTNH/A1 23 1050-1097 1098-1110 1111-1138 1139-1148 1149-1194 NTNH/A2 24 1050-1097 1098-1110 1111-1139 1140-1148 1149-1199 NTNH/A3 25 1050-1097 1098-1110 1111-1138 1139-1148 1149-1194 NTNH/B 26 1049-1096 1097-1109 1110-1138 1139-1147 1148-1198 NTNH/C1 27 1049-1096 1097-1109 1110-1138 1139-1147 1148-1197 NTNH/D 28 1049-1096 1097-1109 1110-1138 1139-1147 1148-1197 NTNH/E 29 1014-1061 1062-1074 1075-1103 1104-1113 1114-1163 NTNH/F1 30 1016-1063 1064-1076 1077-1104 1105-1114 1115-1160 NTNH/F2 31 1017-1064 1065-1077 1078-1106 1107-1116 1117-1166 NTNH/G 32 1050-1097 1098-1110 1111-1139 1140-1149 1150-1199
[0338] As used herein, the term "Non-toxin Associated Protein" is synonymous with "NAP" and means a Clostridial NAP with selective binding activity, such as, e.g., a binding affinity or a binding specificity, for an endogenous Clostridial toxin receptor. It is envisioned that both naturally occurring NAPs as well as NAPs with enhanced binding activity can be used to practice aspects of the present invention. As used herein, the term "NAP with enhanced binding activity" means a Clostridial NAP with enhanced binding activity for an endogenous Clostridial toxin receptor, such as, e.g., a binding affinity or a binding specificity, to a statistically significantly degree relative to an unmodified naturally occurring Clostridial toxin binding domain from a Clostridial toxin. By definition, a NAP with enhanced binding activity has at least one amino acid change from the corresponding region of the disclosed reference sequences (see Table 3-6) and can be described in percent identity to the corresponding region of that reference sequence.
[0339] Any of a variety of sequence alignment methods can be used to determine percent identity of a modified Clostridial NAP relative to a naturally-occurring Clostridial NAP, including, without limitation, global methods, local methods and hybrid methods, such as, e.g., segment approach methods. Protocols to determine percent identity are routine procedures within the scope of one skilled in the art and from the teaching herein.
[0340] Approaches well known to one skilled in the art on how to modify a Clostridial NAP in order to increase its binding activity for an endogenous Clostridial toxin receptor present on a naturally-occurring Clostridial toxin target cell. As described above, one approach involves identifying amino acids using computational protein design algorithms; changing specifically-identified amino acids using, without limitation, site-directed mutagenesis, oligonucleotide-directed mutagenesis and site-specific mutagenesis; and testing the binding activity of modified Clostridial toxins comprising a modified Clostridial NAP with enhanced binding activity using, e.g., heterogeneous assays, homogeneous assays and non-separating homogeneous assays. It is further envisioned that the binding activity of a modified Clostridial toxin with enhanced binding activity disclosed in the present specification can be determined by affinity chromatography using immobilized receptors and interfacial optical assays. In another approach described above, a binding activity of a modified Clostridial NAP for a naturally-occurring Clostridial toxin receptor present on a naturally-occurring Clostridial toxin target cell can be achieved using directed-evolution methods.
[0341] A Clostridial NAP includes, without limitation, naturally occurring Clostridial NAP variants, such as, e.g., Clostridial NAP isoforms and Clostridial NAP subtypes; non-naturally occurring Clostridial NAP variants, such as, e.g., conservative Clostridial NAP variants, non-conservative Clostridial NAP variants, Clostridial NAP chimerics, active Clostridial NAP fragments thereof, or any combination thereof.
[0342] As used herein, the term "Clostridial NAP variant," whether naturally-occurring or non-naturally-occurring, means a Clostridial NAP that has at least one amino acid change from the corresponding region of the disclosed reference sequences (see Tables 3-6) and can be described in percent identity to the corresponding region of that reference sequence. Unless expressly indicated, all Clostridial NAP variants disclosed in the present specification are capable of executing the cell binding step of the intoxication process.
[0343] It is recognized by those of skill in the art that within each Clostridial bacterium there can be naturally occurring Clostridial NAP variants that differ somewhat in their amino acid sequence, and also in the nucleic acids encoding these proteins. For example, there are presently five Clostridial botulinum serotype A HA-33 variants, HA-33/A1, HA-33/A2, HA-33/A3, HA-33/A4 and HA-33/A5 (Tables 3 and 4), with specific HA-33 variants showing various degrees of amino acid divergence when compared to another HA-33 variant. As another example, there are presently three Clostridial botulinum serotype A NTNH-33 variants, NTNH/A1, NTNH/A2 and NTNH/A3 (Table 6), with specific NTNH variant showing various degrees of amino acid divergence when compared to another NTNH variant. As used herein, the term "naturally occurring Clostridial NAP variant" means any Clostridial NAP produced by a naturally-occurring process, including, without limitation, Clostridial NAP isoforms produced from alternatively-spliced transcripts, Clostridial NAP isoforms produced by spontaneous mutation and Clostridial NAP subtypes. A naturally occurring Clostridial NAP variant can function in substantially the same manner as the reference Clostridial NAP on which the naturally occurring Clostridial NAP variant is based, and can be substituted for the reference Clostridial NAP in any aspect of the present invention. A naturally occurring Clostridial NAP variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, ten or more amino acids, 20 or more amino acids, 30 or more amino acids, 40 or more amino acids, 50 or more amino acids or 100 or more amino acids from the reference Clostridial NAP on which the naturally occurring Clostridial NAP variant is based. A naturally occurring Clostridial NAP variant can also substitute at least 10 contiguous amino acids, at least 15 contiguous amino acids, at least 20 contiguous amino acids, or at least 25 contiguous amino acids from the reference Clostridial NAP on which the naturally occurring Clostridial NAP variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference Clostridial NAP on which the naturally occurring Clostridial NAP variant is based.
[0344] A non-limiting examples of a naturally occurring Clostridial NAP variant is a Clostridial NAP isoform such as, e.g., a Clostridial botulinum serotype A HA-33 isoform, a Clostridial botulinum serotype B HA-33 isoform, a Clostridial botulinum serotype C1 HA-33 isoform, a Clostridial botulinum serotype D HA-33 isoform, a Clostridial botulinum serotype A HA-17 isoform, a Clostridial botulinum serotype B HA-17 isoform, a Clostridial botulinum serotype C1 HA-17 isoform, a Clostridial botulinum serotype D HA-17 isoform, a Clostridial botulinum serotype A NTNH isoform, a Clostridial botulinum serotype B NTNH isoform, a Clostridial botulinum serotype C1 NTNH isoform, a Clostridial botulinum serotype D NTNH isoform, a Clostridial botulinum serotype E NTNH isoform, a Clostridial botulinum serotype F NTNH isoform and a Clostridial botulinum serotype G NTNH isoform. A Clostridial NAP isoform can function in substantially the same manner as the reference Clostridial NAP on which the Clostridial NAP isoform is based, and can be substituted for the reference Clostridial NAP in any aspect of the present invention.
[0345] Another non-limiting examples of a naturally occurring Clostridial NAP variant is a Clostridial NAP subtype such as, e.g., a Clostridial botulinum serotype A HA-33 subtype, a Clostridial botulinum serotype B HA-33 subtype, a Clostridial botulinum serotype C1 HA-33 subtype, a Clostridial botulinum serotype D HA-33 subtype, a Clostridial botulinum serotype A HA-17 subtype, a Clostridial botulinum serotype B HA-17 subtype, a Clostridial botulinum serotype C1 HA-17 subtype, a Clostridial botulinum serotype D HA-17 subtype, a Clostridial botulinum serotype A NTNH subtype, a Clostridial botulinum serotype B NTNH subtype, a Clostridial botulinum serotype C1 NTNH subtype, a Clostridial botulinum serotype D NTNH subtype, a Clostridial botulinum serotype E NTNH subtype, a Clostridial botulinum serotype F NTNH subtype and a Clostridial botulinum serotype G NTNH subtype. A Clostridial NAP subtype can function in substantially the same manner as the reference Clostridial NAP on which the Clostridial NAP subtype is based, and can be substituted for the reference Clostridial NAP in any aspect of the present invention.
[0346] As used herein, the term "non-naturally occurring Clostridial NAP variant" means any Clostridial NAP produced with the aid of human manipulation, including, without limitation, Clostridial NAPs produced by genetic engineering using random mutagenesis or rational design and Clostridial NAPs produced by chemical synthesis. Non-limiting examples of non-naturally occurring Clostridial NAP variants include, e.g., conservative Clostridial NAP variants, non-conservative Clostridial NAP variants, Clostridial NAP chimeric variants and active Clostridial NAP fragments.
[0347] As used herein, the term "conservative Clostridial NAP variant" means a Clostridial NAP that has at least one amino acid substituted by another amino acid or an amino acid analog that has at least one property similar to that of the original amino acid from the reference Clostridial NAP sequence (see Tables 3-6). Examples of properties include, without limitation, similar size, topography, charge, hydrophobicity, hydrophilicity, lipophilicity, covalent-bonding capacity, hydrogen-bonding capacity, a physicochemical property, of the like, or any combination thereof. A conservative Clostridial NAP variant can function in substantially the same manner as the reference Clostridial NAP on which the conservative Clostridial NAP variant is based, and can be substituted for the reference Clostridial NAP in any aspect of the present invention. A conservative Clostridial NAP variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, ten or more amino acids, 20 or more amino acids, 30 or more amino acids, 40 or more amino acids or 50 or more amino acids from the reference Clostridial NAP on which the conservative Clostridial NAP variant is based. A conservative Clostridial NAP variant can also substitute at least 10 contiguous amino acids, at least 15 contiguous amino acids, at least 20 contiguous amino acids, or at least 25 contiguous amino acids from the reference Clostridial NAP on which the conservative Clostridial NAP variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference Clostridial NAP on which the conservative Clostridial NAP variant is based. Non-limiting examples of a conservative Clostridial NAP variant include, e.g., a conservative Clostridial botulinum serotype A HA-33 variant, a conservative Clostridial botulinum serotype B HA-33 variant, a conservative Clostridial botulinum serotype C1 HA-33 variant, a conservative Clostridial botulinum serotype D HA-33 variant, a conservative Clostridial botulinum serotype A HA-17 variant, a conservative Clostridial botulinum serotype B HA-17 variant, a conservative Clostridial botulinum serotype C1 HA-17 variant, a conservative Clostridial botulinum serotype D HA-17 variant, a conservative Clostridial botulinum serotype A NTNH variant, a conservative Clostridial botulinum serotype B NTNH variant, a conservative Clostridial botulinum serotype C1 NTNH variant, a conservative Clostridial botulinum serotype D NTNH variant, a conservative Clostridial botulinum serotype E NTNH variant, a conservative Clostridial botulinum serotype F NTNH variant and a conservative Clostridial botulinum serotype G NTNH variant.
[0348] As used herein, the term "non-conservative Clostridial NAP variant" means a Clostridial NAP in which 1) at least one amino acid is deleted from the reference Clostridial NAP on which the non-conservative Clostridial NAP variant is based; 2) at least one amino acid added to the reference Clostridial NAP on which the non-conservative Clostridial NAP is based; or 3) at least one amino acid is substituted by another amino acid or an amino acid analog that does not share any property similar to that of the original amino acid from the reference Clostridial NAP sequence (see Tables 3-6). A non-conservative Clostridial NAP variant can function in substantially the same manner as the reference Clostridial NAP on which the non-conservative Clostridial NAP variant is based, and can be substituted for the reference Clostridial NAP in any aspect of the present invention. A non-conservative Clostridial NAP variant can delete one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, and ten or more amino acids from the reference Clostridial NAP on which the non-conservative Clostridial NAP variant is based. A non-conservative Clostridial NAP variant can add one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, and ten or more amino acids to the reference Clostridial NAP on which the non-conservative Clostridial NAP variant is based. A non-conservative Clostridial NAP variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, ten or more amino acids, 20 or more amino acids, 30 or more amino acids, 40 or more amino acids or 50 or more amino acids from the reference Clostridial NAP on which the non-conservative Clostridial NAP variant is based. A non-conservative Clostridial NAP variant can also substitute at least 10 contiguous amino acids, at least 15 contiguous amino acids, at least 20 contiguous amino acids, or at least 25 contiguous amino acids from the reference Clostridial NAP on which the non-conservative Clostridial NAP variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference Clostridial NAP on which the non-conservative Clostridial NAP variant is based. Non-limiting examples of a non-conservative Clostridial NAP variant include, e.g., a non-conservative Clostridial botulinum serotype A HA-33 variant, a non-conservative Clostridial botulinum serotype B HA-33 variant, a non-conservative Clostridial botulinum serotype C1 HA-33 variant, a non-conservative Clostridial botulinum serotype D HA-33 variant, a non-conservative Clostridial botulinum serotype A HA-17 variant, a non-conservative Clostridial botulinum serotype B HA-17 variant, a non-conservative Clostridial botulinum serotype C1 HA-17 variant, a non-conservative Clostridial botulinum serotype D HA-17 variant, a non-conservative Clostridial botulinum serotype A NTNH variant, a non-conservative Clostridial botulinum serotype B NTNH variant, a non-conservative Clostridial botulinum serotype C1 NTNH variant, a non-conservative Clostridial botulinum serotype D NTNH variant, a non-conservative Clostridial botulinum serotype E NTNH variant, a non-conservative Clostridial botulinum serotype F NTNH variant and a non-conservative Clostridial botulinum serotype G NTNH variant.
[0349] As used herein, the term "Clostridial NAP chimeric" means a polypeptide comprising at least a portion of a Clostridial NAP and at least a portion of at least one other polypeptide to form an enhanced targeting domain with at least one property different from the reference Clostridial NAP (see Tables 3-6), with the proviso that this Clostridial NAP chimeric can specifically bind to a Clostridial toxin receptor present in a Clostridial toxin target cell, and thus participate in executing the overall cellular mechanism whereby a Clostridial toxin proteolytically cleaves a substrate.
[0350] As used herein, the term "active Clostridial NAP fragment" means any of a variety of Clostridial NAP fragments comprising the enhanced targeting domain can be useful in aspects of the present invention with the proviso that these NAP fragments can specifically bind to a Clostridial toxin receptor present in a Clostridial toxin target cell, and thus participate in executing the overall cellular mechanism whereby a Clostridial toxin proteolytically cleaves a substrate.
[0351] Thus, in an embodiment, a modified Clostridial toxin disclosed in the present specification comprises an enhanced targeting domain comprising a β-trefoil domain derived from a NAP. In another embodiment, a modified Clostridial toxin disclosed in the present specification comprises an enhanced targeting domain comprising a β-trefoil domain with enhanced binding activity derived from a NAP.
[0352] In another embodiment, a modified Clostridial toxin disclosed in the present specification comprises an enhanced targeting domain comprising a β-trefoil domain derived from a Clostridial HA-33. In an aspect of this embodiment, a β-trefoil domain derived from a Clostridial HA-33 comprises, e.g., a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33, a β-trefoil domain derived from a Clostridial botulinum serotype B HA-33, a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-33 or a β-trefoil domain derived from a Clostridial botulinum serotype D HA-33. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial HA-33 comprises a 1α-fold motif of a 1β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 1β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 1γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 2α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 2β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, or a 2γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33.
[0353] In another embodiment, a modified Clostridial toxin disclosed in the present specification comprises an enhanced targeting domain comprising a β-trefoil domain with enhanced binding activity derived from a Clostridial HA-33. In an aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial HA-33 comprises, e.g., a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 or a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial HA-33 comprises a modified 1α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 1β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 1 γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 2α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 2β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, or a modified 2γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33.
[0354] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 9. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 10-144 or amino acids 151-293 of SEQ ID NO: 9. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises a 1α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 1β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 1γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 2α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 2β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, or a 2γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 9. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9.
[0355] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 9. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 10-144 or amino acids 151-293 of SEQ ID NO: 9. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a modified 1α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 1β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 1γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 2α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 2β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, or a modified 2γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 9. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9.
[0356] In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9, at least 75% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9, at least 80% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9, at least 85% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9, at least 90% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9 or at least 95% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9. In yet other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9, at most 75% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9, at most 80% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9, at most 85% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9, at most 90% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9 or at most 95% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9.
[0357] In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a 11-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9. In yet other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9. In still other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9.
[0358] In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a 11-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9. In yet other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9. In still other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 9.
[0359] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises a 1β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 1β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 2β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 or a 2β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 9. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9.
[0360] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a modified 1β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 1β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 2β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 or a modified 2β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 9. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a modification of amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9.
[0361] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9, at least 75% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9, at least 80% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9, at least 85% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9, at least 90% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9 or at least 95% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9, at most 75% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9, at most 80% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9, at most 85% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9, at most 90% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9 or at most 95% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9.
[0362] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9.
[0363] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 9.
[0364] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 10. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 10-144 or amino acids 151-293 of SEQ ID NO: 10. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises a 1α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 1β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 1γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 2α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 2β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, or a 2γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 10. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10.
[0365] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 10. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 10-144 or amino acids 151-293 of SEQ ID NO: 10. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a modified 1α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 1β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 1γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 2α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 2β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, or a modified 2γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 10. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10.
[0366] In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10, at least 75% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10, at least 80% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10, at least 85% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10, at least 90% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10 or at least 95% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10. In yet other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10, at most 75% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10, at most 80% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10, at most 85% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10, at most 90% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10 or at most 95% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10.
[0367] In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10. In yet other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10. In still other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10.
[0368] In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10. In yet other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10. In still other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 10.
[0369] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises a 1β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 1β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 2β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 or a 2β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 10. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10.
[0370] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a modified 1β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 1β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 2β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 or a modified 2β88/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 10. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a modification of amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10.
[0371] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10, at least 75% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10, at least 80% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10, at least 85% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10, at least 90% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10 or at least 95% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10, at most 75% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10, at most 80% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10, at most 85% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10, at most 90% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10 or at most 95% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10.
[0372] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10.
[0373] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 10.
[0374] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 11. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 10-144 or amino acids 151-293 of SEQ ID NO: 11. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises a 1α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 1β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 1γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 2α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 2β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, or a 2γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 11. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11.
[0375] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 11. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 10-144 or amino acids 151-293 of SEQ ID NO: 11. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a modified 1α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 1β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 1γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 2α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 2β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, or a modified 2γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 11. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11.
[0376] In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11, at least 75% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11, at least 80% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11, at least 85% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11, at least 90% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11 or at least 95% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11. In yet other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11, at most 75% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11, at most 80% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11, at most 85% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11, at most 90% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11 or at most 95% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11.
[0377] In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11. In yet other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11. In still other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11.
[0378] In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11. In yet other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11. In still other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 11.
[0379] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises a 1134/135 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 1138/139 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 2β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 or a 2β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 11. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11.
[0380] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a modified 1β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 1β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 2β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 or a modified 2β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 11. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a modification of amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11.
[0381] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11, at least 75% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11, at least 80% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11, at least 85% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11, at least 90% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11 or at least 95% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11, at most 75% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11, at most 80% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11, at most 85% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11, at most 90% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11 or at most 95% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11.
[0382] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11.
[0383] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 11.
[0384] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 12. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 10-146 or amino acids 153-294 of SEQ ID NO: 12. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises a 1α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 1β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 1γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 2α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 2β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, or a 2γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 12. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12.
[0385] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 12. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 10-146 or amino acids 153-294 of SEQ ID NO: 12. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a modified 1α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 1β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 1γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 2α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 2β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, or a modified 2γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 12. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12.
[0386] In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12, at least 75% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12, at least 80% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12, at least 85% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12, at least 90% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12 or at least 95% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12. In yet other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12, at most 75% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12, at most 80% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12, at most 85% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12, at most 90% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12 or at most 95% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12.
[0387] In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a 11-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12. In yet other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12. In still other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12.
[0388] In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12. In yet other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12. In still other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 202-243, or amino acids 250-294 of SEQ ID NO: 12.
[0389] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises a 1β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 1β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 2β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 or a 2β88/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 12. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12.
[0390] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a modified 1β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 1β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 2β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 or a modified 2β88/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 12. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a modification of amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12.
[0391] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12, at least 75% amino acid identity with amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12, at least 80% amino acid identity with amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12, at least 85% amino acid identity with amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12, at least 90% amino acid identity with amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12 or at least 95% amino acid identity with amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12, at most 75% amino acid identity with amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12, at most 80% amino acid identity with amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12, at most 85% amino acid identity with amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12, at most 90% amino acid identity with amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12 or at most 95% amino acid identity with amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12.
[0392] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12.
[0393] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 57-61, amino acids 103-106, amino acids 198-201, or amino acids 244-249 of SEQ ID NO: 12.
[0394] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 13. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 10-144 or amino acids 151-293 of SEQ ID NO: 13. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises a 1α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 1β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 1γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 2α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 2β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, or a 2γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 13. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 13.
[0395] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 13. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 10-144 or amino acids 151-293 of SEQ ID NO: 13. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a modified 1α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 1β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 1γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 2α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 2β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, or a modified 2γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 13. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-242, or amino acids 249-293 of SEQ ID NO: 13.
[0396] In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13, at least 75% amino acid identity with amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13, at least 80% amino acid identity with amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13, at least 85% amino acid identity with amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13, at least 90% amino acid identity with amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13 or at least 95% amino acid identity with amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13. In yet other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13, at most 75% amino acid identity with amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13, at most 80% amino acid identity with amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13, at most 85% amino acid identity with amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13, at most 90% amino acid identity with amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13 or at most 95% amino acid identity with amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13.
[0397] In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13. In yet other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13. In still other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13.
[0398] In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13. In yet other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13. In still other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 10-55, amino acids 56-102, amino acids 103-144, amino acids 151-197, amino acids 198-245, or amino acids 246-279 of SEQ ID NO: 13.
[0399] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises a 1β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 1β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a 2β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 or a 2β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 13. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-33 comprises amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13.
[0400] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a modified 1β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 1β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33, a modified 2β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 or a modified 2β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-33 of SEQ ID NO: 13. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a modification of amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13.
[0401] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13, at least 75% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13, at least 80% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13, at least 85% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13, at least 90% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13 or at least 95% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13, at most 75% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13, at most 80% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13, at most 85% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13, at most 90% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13 or at most 95% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13.
[0402] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13.
[0403] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 243-248 of SEQ ID NO: 13.
[0404] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype B HA-33 comprises a β-trefoil domain derived from a Clostridial botulinum serotype B HA-33 of SEQ ID NO: 14. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype B HA-33 comprises amino acids 10-144 or amino acids 151-292 of SEQ ID NO: 14. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype B HA-33 comprises a lα-fold motif of a 13-trefoil domain of a Clostridial botulinum serotype B HA-33, a 1β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B HA-33, a 1γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B HA-33, a 2α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B HA-33, a 2β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B HA-33, or a 2γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B HA-33 of SEQ ID NO: 14. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype B HA-33 comprises amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14.
[0405] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 of SEQ ID NO: 14. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises amino acids 10-144 or amino acids 151-292 of SEQ ID NO: 14. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a modified 1α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B HA-33, a modified 1β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B HA-33, a modified 1γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B HA-33, a modified 2α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B HA-33, a modified 2β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B HA-33, or a modified 2γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B HA-33 of SEQ ID NO: 14. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14.
[0406] In other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14, at least 75% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14, at least 80% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14, at least 85% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14, at least 90% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14 or at least 95% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14. In yet other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14, at most 75% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14, at most 80% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14, at most 85% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14, at most 90% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14 or at most 95% amino acid identity with amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14.
[0407] In other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14. In other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14. In yet other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14. In other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14. In still other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14. In other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14.
[0408] In other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14. In other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14. In yet other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14. In other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14. In still other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14. In other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 10-54, amino acids 60-100, amino acids 105-144, amino acids 151-195, amino acids 200-241, or amino acids 248-292 of SEQ ID NO: 14.
[0409] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype B HA-33 comprises a 1β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B HA-33, a 1β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B HA-33, a 2β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B HA-33 or a 2β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B HA-33 of SEQ ID NO: 14. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype B HA-33 comprises amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14.
[0410] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a modified 1β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B HA-33, a modified 1β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B HA-33, a modified 2β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B HA-33 or a modified 2β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B HA-33 of SEQ ID NO: 14. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a modification of amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14.
[0411] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14, at least 75% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14, at least 80% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14, at least 85% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14, at least 90% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14 or at least 95% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14, at most 75% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14, at most 80% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14, at most 85% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14, at most 90% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14 or at most 95% amino acid identity with amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14.
[0412] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14.
[0413] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 55-59, amino acids 101-104, amino acids 196-199, or amino acids 242-247 of SEQ ID NO: 14.
[0414] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 of SEQ ID NO: 15. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15.
[0415] In other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15, at least 75% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15, at least 80% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15, at least 85% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15, at least 90% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15 or at least 95% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15. In yet other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15, at most 75% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15, at most 80% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15, at most 85% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15, at most 90% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15 or at most 95% amino acid identity with amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15.
[0416] In other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15. In other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15. In yet other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15. In other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15. In still other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15. In other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15.
[0417] In other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15. In other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15. In yet other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15. In other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15. In still other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15. In other aspects of this embodiment, a Clostridial botulinum serotype B HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 10-56, amino acids 62-102, amino acids 107-146, amino acids 153-197, amino acids 200-242, or amino acids 249-291 of SEQ ID NO: 15.
[0418] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype B HA-33 comprises a 1β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B HA-33, a 1β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B HA-33, a 2β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B HA-33 or a 2β88/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B HA-33 of SEQ ID NO: 15. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype B HA-33 comprises amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15.
[0419] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a modified 1β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B HA-33, a modified 1β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B HA-33, a modified 2β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B HA-33 or a modified 2β88/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B HA-33 of SEQ ID NO: 15. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a modification of amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15.
[0420] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15, at least 75% amino acid identity with amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15, at least 80% amino acid identity with amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15, at least 85% amino acid identity with amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15, at least 90% amino acid identity with amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15 or at least 95% amino acid identity with amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15, at most 75% amino acid identity with amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15, at most 80% amino acid identity with amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15, at most 85% amino acid identity with amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15, at most 90% amino acid identity with amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15 or at most 95% amino acid identity with amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15.
[0421] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15.
[0422] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 56-61, amino acids 103-106, amino acids 198-201, or amino acids 243-248 of SEQ ID NO: 15.
[0423] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-33 comprises a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-33 of SEQ ID NO: 16. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-33 comprises amino acids 10-141 or amino acids 148-285 of SEQ ID NO: 16. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-33 comprises a la-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, a 1β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, a 1γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, a 2α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype Cl HA-33, a 2β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, or a 2γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33 of SEQ ID NO: 16. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-33 comprises amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16.
[0424] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 of SEQ ID NO: 16. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises amino acids 10-141 or amino acids 148-285 of SEQ ID NO: 16. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a modified 1α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, a modified 1β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, a modified 1γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, a modified 2α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, a modified 2β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, or a modified 2γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33 of SEQ ID NO: 16. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16.
[0425] In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16, at least 75% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16, at least 80% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16, at least 85% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16, at least 90% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16 or at least 95% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16. In yet other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16, at most 75% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16, at most 80% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16, at most 85% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16, at most 90% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16 or at most 95% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16.
[0426] In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16. In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16. In yet other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16. In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16. In still other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16. In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16.
[0427] In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16. In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16. In yet other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16. In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16. In still other aspects of this embodiment, a Clostridial botulinum serotype Cl HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16. In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-234, or amino acids 241-285 of SEQ ID NO: 16.
[0428] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-33 comprises a 1β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, a 1β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, a 2β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33 or a 2β8/β9 hairpin turn of a 13-trefoil domain of a Clostridial botulinum serotype C1 HA-33 of SEQ ID NO: 16. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-33 comprises amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16.
[0429] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33 or a modified 1β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, a modified 1β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, a modified 2β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33 or a modified 2β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33 of SEQ ID NO: 16. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a modification of amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16.
[0430] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16, at least 75% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16, at least 80% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16, at least 85% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16, at least 90% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16 or at least 95% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16, at most 75% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16, at most 80% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16, at most 85% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16, at most 90% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16 or at most 95% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16.
[0431] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16.
[0432] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 235-240 of SEQ ID NO: 16.
[0433] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-33 comprises a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-33 of SEQ ID NO: 17. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-33 comprises amino acids 10-141 or amino acids 148-286 of SEQ ID NO: 17. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-33 comprises a la-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, a 1β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, a 1γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, a 2α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype Cl HA-33, a 2β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, or a 2γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33 of SEQ ID NO: 17. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-33 comprises amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17.
[0434] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 of SEQ ID NO: 17. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises amino acids 10-141 or amino acids 148-286 of SEQ ID NO: 17. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a modified 1α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, a modified 1β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype Cl HA-33, a modified 1γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, a modified 2α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, a modified 2β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, or a modified 2γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33 of SEQ ID NO: 17. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17.
[0435] In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17, at least 75% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17, at least 80% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17, at least 85% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17, at least 90% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17 or at least 95% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17. In yet other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17, at most 75% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17, at most 80% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17, at most 85% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17, at most 90% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17 or at most 95% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17.
[0436] In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a 11-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17. In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17. In yet other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17. In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17. In still other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17. In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17.
[0437] In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17. In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17. In yet other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17. In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17. In still other aspects of this embodiment, a Clostridial botulinum serotype Cl HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17. In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 17.
[0438] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-33 comprises a 1β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, a 1β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, a 2β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33 or a 2β8/β9 hairpin turn of a 13-trefoil domain of a Clostridial botulinum serotype C1 HA-33 of SEQ ID NO: 17. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-33 comprises amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17.
[0439] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a modified 1β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, a modified 1β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33, a modified 2β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33 or a modified 2β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-33 of SEQ ID NO: 17. In another aspect of this embodiment, a R-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a modification of amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17.
[0440] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17, at least 75% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17, at least 80% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17, at least 85% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17, at least 90% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17 or at least 95% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17, at most 75% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17, at most 80% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17, at most 85% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17, at most 90% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17 or at most 95% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17.
[0441] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17.
[0442] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 17.
[0443] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype D HA-33 comprises a β-trefoil domain derived from a Clostridial botulinum serotype D HA-33 of SEQ ID NO: 18. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype D HA-33 comprises amino acids 10-141 or amino acids 148-286 of SEQ ID NO: 18. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype D HA-33 comprises a 1α-fold motif of a 13-trefoil domain of a Clostridial botulinum serotype D HA-33, a 1β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype D HA-33, a 1γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype D HA-33, a 2α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype D HA-33, a 2β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype D HA-33, or a 2γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype D HA-33 of SEQ ID NO: 18. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype D HA-33 comprises amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18.
[0444] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33 comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33 of SEQ ID NO: 18. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33 comprises amino acids 10-141 or amino acids 148-286 of SEQ ID NO: 18. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33 comprises a modified 1α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype D HA-33, a modified 1β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype D HA-33, a modified 1γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype D HA-33, a modified 2α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype D HA-33, a modified 2β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype D HA-33, or a modified 2γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype D HA-33 of SEQ ID NO: 18. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33 comprises amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18.
[0445] In other aspects of this embodiment, a Clostridial botulinum serotype D HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18, at least 75% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18, at least 80% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18, at least 85% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18, at least 90% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18 or at least 95% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18. In yet other aspects of this embodiment, a Clostridial botulinum serotype D HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18, at most 75% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18, at most 80% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18, at most 85% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18, at most 90% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18 or at most 95% amino acid identity with amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18.
[0446] In other aspects of this embodiment, a Clostridial botulinum serotype D HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18. In other aspects of this embodiment, a Clostridial botulinum serotype D HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18. In yet other aspects of this embodiment, a Clostridial botulinum serotype D HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18. In other aspects of this embodiment, a Clostridial botulinum serotype D HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18. In still other aspects of this embodiment, a Clostridial botulinum serotype D HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18. In other aspects of this embodiment, a Clostridial botulinum serotype D HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18.
[0447] In other aspects of this embodiment, a Clostridial botulinum serotype D HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18. In other aspects of this embodiment, a Clostridial botulinum serotype D HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18. In yet other aspects of this embodiment, a Clostridial botulinum serotype D HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18. In other aspects of this embodiment, a Clostridial botulinum serotype D HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18. In still other aspects of this embodiment, a Clostridial botulinum serotype D HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18. In other aspects of this embodiment, a Clostridial botulinum serotype D HA-33 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 10-54, amino acids 60-98, amino acids 103-141, amino acids 148-190, amino acids 195-235, or amino acids 242-286 of SEQ ID NO: 18.
[0448] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype D HA-33 comprises a 1β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype D HA-33, a 1β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype D HA-33, a 2β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype D HA-33 or a 2β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype D HA-33 of SEQ ID NO: 18. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype D HA-33 comprises amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18.
[0449] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33 comprises a modified 1β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype D HA-33, a modified 1β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype D HA-33, a modified 2β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype D HA-33 or a modified 2β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype D HA-33 of SEQ ID NO: 18. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33 comprises a modification of amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18.
[0450] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33 comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18, at least 75% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18, at least 80% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18, at least 85% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18, at least 90% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18 or at least 95% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33 comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18, at most 75% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18, at most 80% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18, at most 85% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18, at most 90% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18 or at most 95% amino acid identity with amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18.
[0451] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18.
[0452] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-33 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 55-59, amino acids 99-102, amino acids 191-194, or amino acids 236-241 of SEQ ID NO: 18.
[0453] In an embodiment, a modified Clostridial toxin disclosed in the present specification comprises an enhanced targeting domain comprising a β-trefoil domain derived from a Clostridial HA-17. In an aspect of this embodiment, a β-trefoil domain derived from a Clostridial HA-17 comprises, e.g., a β-trefoil domain derived from a Clostridial botulinum serotype A HA-17, a β-trefoil domain derived from a Clostridial botulinum serotype B HA-17, a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-17 or a β-trefoil domain derived from a Clostridial botulinum serotype D HA-17. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial HA-17 comprises a α-fold motif of a β-trefoil domain of a Clostridial HA-17, a β-fold motif of a β-trefoil domain of a Clostridial HA-17 or a γ-fold motif of a β-trefoil domain of a Clostridial HA-17.
[0454] In an embodiment, a modified Clostridial toxin disclosed in the present specification comprises an enhanced targeting domain comprising a β-trefoil domain with enhanced binding activity derived from a Clostridial HA-17. In an aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial HA-17 comprises, e.g., a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 or a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial HA-17 comprises a modified α-fold motif of a β-trefoil domain of a Clostridial HA-17, a modified β-fold motif of a β-trefoil domain of a Clostridial HA-17 or a modified γ-fold motif of a β-trefoil domain of a Clostridial HA-17.
[0455] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-17 comprises a β-trefoil domain derived from a Clostridial botulinum serotype A HA-17 of SEQ ID NO: 19. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-17 comprises amino acids 9-146 of SEQ ID NO: 19. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-17 comprises a α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-17, a β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-17 or a γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-17 of SEQ ID NO: 19. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-17 comprises amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19.
[0456] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17 comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17 of SEQ ID NO: 19. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17 comprises amino acids 9-146 of SEQ ID NO: 19. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17 comprises a modified α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-17, a modified β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A HA-17 or a modified γ-fold motif of a 13-trefoil domain of a Clostridial botulinum serotype A HA-17 of SEQ ID NO: 19. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17 comprises amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19.
[0457] In other aspects of this embodiment, a Clostridial botulinum serotype A HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19, at least 75% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19, at least 80% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19, at least 85% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19, at least 90% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19 or at least 95% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19. In yet other aspects of this embodiment, a Clostridial botulinum serotype A HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19, at most 75% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19, at most 80% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19, at most 85% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19, at most 90% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19 or at most 95% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19.
[0458] In other aspects of this embodiment, a Clostridial botulinum serotype A HA-17 comprising a 11-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19. In yet other aspects of this embodiment, a Clostridial botulinum serotype A HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19. In still other aspects of this embodiment, a Clostridial botulinum serotype A HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19.
[0459] In other aspects of this embodiment, a Clostridial botulinum serotype A HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19. In yet other aspects of this embodiment, a Clostridial botulinum serotype A HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19. In still other aspects of this embodiment, a Clostridial botulinum serotype A HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19. In other aspects of this embodiment, a Clostridial botulinum serotype A HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 19.
[0460] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-17 comprises a β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-17 or a β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-17 of SEQ ID NO: 19. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A HA-17 comprises amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19.
[0461] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17 comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-17 or a modified β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A HA-17 of SEQ ID NO: 19. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17 comprises a modification of amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19.
[0462] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17 comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19, at least 75% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19, at least 80% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19, at least 85% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19, at least 90% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19 or at least 95% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17 comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19, at most 75% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19, at most 80% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19, at most 85% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19, at most 90% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19 or at most 95% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19.
[0463] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19.
[0464] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A HA-17 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 19.
[0465] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype B HA-17 comprises a β-trefoil domain derived from a Clostridial botulinum serotype B HA-17 of SEQ ID NO: 20. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype B HA-17 comprises amino acids 9-146 of SEQ ID NO: 20. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype B HA-17 comprises a α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B HA-17, a β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B HA-17 or a γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B HA-17 of SEQ ID NO: 20. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype B HA-17 comprises amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20.
[0466] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17 comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17 of SEQ ID NO: 20. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17 comprises amino acids 9-146 of SEQ ID NO: 20. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17 comprises a modified α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B HA-17, a modified β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B HA-17 or a modified γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B HA-17 of SEQ ID NO: 20. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17 comprises amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20.
[0467] In other aspects of this embodiment, a Clostridial botulinum serotype B HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20, at least 75% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20, at least 80% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20, at least 85% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20, at least 90% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20 or at least 95% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20. In yet other aspects of this embodiment, a Clostridial botulinum serotype B HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20, at most 75% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20, at most 80% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20, at most 85% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20, at most 90% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20 or at most 95% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20.
[0468] In other aspects of this embodiment, a Clostridial botulinum serotype B HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20. In other aspects of this embodiment, a Clostridial botulinum serotype B HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20. In yet other aspects of this embodiment, a Clostridial botulinum serotype B HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20. In other aspects of this embodiment, a Clostridial botulinum serotype B HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20. In still other aspects of this embodiment, a Clostridial botulinum serotype B HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20. In other aspects of this embodiment, a Clostridial botulinum serotype B HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20.
[0469] In other aspects of this embodiment, a Clostridial botulinum serotype B HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20. In other aspects of this embodiment, a Clostridial botulinum serotype B HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20. In yet other aspects of this embodiment, a Clostridial botulinum serotype B HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20. In other aspects of this embodiment, a Clostridial botulinum serotype B HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20. In still other aspects of this embodiment, a Clostridial botulinum serotype B HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20. In other aspects of this embodiment, a Clostridial botulinum serotype B HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 20.
[0470] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype B HA-17 comprises a β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B HA-17 or a β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B HA-17 of SEQ ID NO: 20. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype B HA-17 comprises amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20.
[0471] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17 comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B HA-17 or a modified β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B HA-17 of SEQ ID NO: 20. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17 comprises a modification of amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20.
[0472] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17 comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20, at least 75% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20, at least 80% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20, at least 85% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20, at least 90% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20 or at least 95% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17 comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20, at most 75% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20, at most 80% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20, at most 85% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20, at most 90% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20 or at most 95% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20.
[0473] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20.
[0474] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B HA-17 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 20.
[0475] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-17 comprises a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-17 of SEQ ID NO: 21. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-17 comprises amino acids 9-146 of SEQ ID NO: 21. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-17 comprises a α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-17, a β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-17 or a γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-17 of SEQ ID NO: 21. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-17 comprises amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21.
[0476] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 of SEQ ID NO: 21. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 comprises amino acids 9-146 of SEQ ID NO: 21. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 comprises a modified α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-17, a modified β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-17 or a modified γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-17 of SEQ ID NO: 21. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 comprises amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21.
[0477] In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21, at least 75% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21, at least 80% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21, at least 85% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21, at least 90% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21 or at least 95% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21. In yet other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21, at most 75% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21, at most 80% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21, at most 85% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21, at most 90% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21 or at most 95% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21.
[0478] In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21. In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21. In yet other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21. In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21. In still other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21. In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21.
[0479] In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21. In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21. In yet other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21. In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21. In still other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21. In other aspects of this embodiment, a Clostridial botulinum serotype C1 HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 21.
[0480] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-17 comprises a 8β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-17 or a 8β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-17 of SEQ ID NO: 21. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype C1 HA-17 comprises amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21.
[0481] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 comprises a modified 8β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-17 or a modified β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 HA-17 of SEQ ID NO: 21. In another aspect of this embodiment, a 11-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 comprises a modification of amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21.
[0482] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21, at least 75% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21, at least 80% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21, at least 85% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21, at least 90% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21 or at least 95% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21, at most 75% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21, at most 80% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21, at most 85% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21, at most 90% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21 or at most 95% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21.
[0483] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21.
[0484] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 HA-17 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 21.
[0485] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype D HA-17 comprises a β-trefoil domain derived from a Clostridial botulinum serotype D HA-17 of SEQ ID NO: 22. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype D HA-17 comprises amino acids 9-146 of SEQ ID NO: 22. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype D HA-17 comprises a α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype D HA-17, a β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype D HA-17 or a γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype D HA-17 of SEQ ID NO: 22. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype D HA-17 comprises amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22.
[0486] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17 comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17 of SEQ ID NO: 22. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17 comprises amino acids 9-146 of SEQ ID NO: 22. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17 comprises a modified α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype D HA-17, a modified β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype D HA-17 or a modified γ-fold motif of a 13-trefoil domain of a Clostridial botulinum serotype D HA-17 of SEQ ID NO: 22. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17 comprises amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22.
[0487] In other aspects of this embodiment, a Clostridial botulinum serotype D HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22, at least 75% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22, at least 80% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22, at least 85% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22, at least 90% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22 or at least 95% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22. In yet other aspects of this embodiment, a Clostridial botulinum serotype D HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22, at most 75% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22, at most 80% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22, at most 85% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22, at most 90% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22 or at most 95% amino acid identity with amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22.
[0488] In other aspects of this embodiment, a Clostridial botulinum serotype D HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22. In other aspects of this embodiment, a Clostridial botulinum serotype D HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22. In yet other aspects of this embodiment, a Clostridial botulinum serotype D HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22. In other aspects of this embodiment, a Clostridial botulinum serotype D HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22. In still other aspects of this embodiment, a Clostridial botulinum serotype D HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22. In other aspects of this embodiment, a Clostridial botulinum serotype D HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22.
[0489] In other aspects of this embodiment, a Clostridial botulinum serotype D HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22. In other aspects of this embodiment, a Clostridial botulinum serotype D HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22. In yet other aspects of this embodiment, a Clostridial botulinum serotype D HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22. In other aspects of this embodiment, a Clostridial botulinum serotype D HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22. In still other aspects of this embodiment, a Clostridial botulinum serotype D HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22. In other aspects of this embodiment, a Clostridial botulinum serotype D HA-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 9-50, amino acids 55-91, or amino acids 95-146 of SEQ ID NO: 22.
[0490] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype D HA-17 comprises a β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype D HA-17 or a β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype D HA-17 of SEQ ID NO: 22. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype D HA-17 comprises amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22.
[0491] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17 comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype D HA-17 or a modified β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype D HA-17 of SEQ ID NO: 22. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17 comprises a modification of amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22.
[0492] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17 comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22, at least 75% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22, at least 80% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22, at least 85% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22, at least 90% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22 or at least 95% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17 comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22, at most 75% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22, at most 80% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22, at most 85% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22, at most 90% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22 or at most 95% amino acid identity with amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22.
[0493] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22.
[0494] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D HA-17 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 51-54 or amino acids 92-94 of SEQ ID NO: 22.
[0495] In an embodiment, a modified Clostridial toxin disclosed in the present specification comprises an enhanced targeting domain comprising a β-trefoil domain derived from a Clostridial NTNH. In an aspect of this embodiment, a β-trefoil domain derived from a Clostridial NTNH comprises, e.g., a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH, a β-trefoil domain derived from a Clostridial botulinum serotype B NTNH, a β-trefoil domain derived from a Clostridial botulinum serotype C1 NTNH, a β-trefoil domain derived from a Clostridial botulinum serotype D NTNH, a β-trefoil domain derived from a Clostridial botulinum serotype E NTNH, a β-trefoil domain derived from a Clostridial botulinum serotype F NTNH or a β-trefoil domain derived from a Clostridial botulinum serotype G NTNH. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial NTNH comprises a α-fold motif of a β-trefoil domain of a Clostridial NTNH, a β-fold motif of a β-trefoil domain of a Clostridial NTNH or a γ-fold motif of a β-trefoil domain of a Clostridial NTNH.
[0496] In an embodiment, a modified Clostridial toxin disclosed in the present specification comprises an enhanced targeting domain comprising a β-trefoil domain with enhanced binding activity derived from a Clostridial NTNH. In an aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial NTNH comprises, e.g., a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH or, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial NTNH comprises a modified α-fold motif of a β-trefoil domain of a Clostridial NTNH, a modified β-fold motif of a β-trefoil domain of a Clostridial NTNH or a modified γ-fold motif of a β-trefoil domain of a Clostridial NTNH.
[0497] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH comprises a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH of SEQ ID NO: 23. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH comprises amino acids 1050-1194 of SEQ ID NO: 23. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH comprises a α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A NTNH, a β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A NTNH or a γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A NTNH of SEQ ID NO: 23. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH comprises amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23.
[0498] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH of SEQ ID NO: 23. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises amino acids 1050-1194 of SEQ ID NO: 23. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a modified α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A NTNH, a modified β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A NTNH or a modified γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A NTNH of SEQ ID NO: 23. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23.
[0499] In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23, at least 75% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23, at least 80% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23, at least 85% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23, at least 90% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23 or at least 95% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23. In yet other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23, at most 75% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23, at most 80% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23, at most 85% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23, at most 90% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23 or at most 95% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23.
[0500] In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23. In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23. In yet other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23. In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23. In still other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23. In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23.
[0501] In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23. In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23. In yet other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23. In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23. In still other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23. In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 23.
[0502] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH comprises a β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A NTNH or a β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A NTNH of SEQ ID NO: 23. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH comprises amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23.
[0503] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A NTNH or a modified β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A NTNH of SEQ ID NO: 23. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a modification of amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23.
[0504] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23, at least 75% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23, at least 80% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23, at least 85% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23, at least 90% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23 or at least 95% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23, at most 75% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23, at most 80% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23, at most 85% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23, at most 90% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23 or at most 95% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23.
[0505] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23.
[0506] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 23.
[0507] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH comprises a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH of SEQ ID NO: 24. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH comprises amino acids 1050-1194 of SEQ ID NO: 24. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH comprises a α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A NTNH, a β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A NTNH or a γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A NTNH of SEQ ID NO: 24. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH comprises amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24.
[0508] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH of SEQ ID NO: 24. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises amino acids 1050-1194 of SEQ ID NO: 24. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a modified α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A NTNH, a modified β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A NTNH or a modified γ-fold motif of a 13-trefoil domain of a Clostridial botulinum serotype A NTNH of SEQ ID NO: 24. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24.
[0509] In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24, at least 75% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24, at least 80% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24, at least 85% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24, at least 90% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24 or at least 95% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24. In yet other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24, at most 75% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24, at most 80% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24, at most 85% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24, at most 90% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24 or at most 95% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24.
[0510] In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24. In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24. In yet other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24. In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24. In still other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24. In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24.
[0511] In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24. In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24. In yet other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24. In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24. In still other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24. In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1149-1199 of SEQ ID NO: 24.
[0512] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH comprises a β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A NTNH or a 138/139 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A NTNH of SEQ ID NO: 24. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH comprises amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24.
[0513] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A NTNH or a modified β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A NTNH of SEQ ID NO: 24. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a modification of amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24.
[0514] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24, at least 75% amino acid identity with amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24, at least 80% amino acid identity with amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24, at least 85% amino acid identity with amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24, at least 90% amino acid identity with amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24 or at least 95% amino acid identity with amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24, at most 75% amino acid identity with amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24, at most 80% amino acid identity with amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24, at most 85% amino acid identity with amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24, at most 90% amino acid identity with amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24 or at most 95% amino acid identity with amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24.
[0515] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24.
[0516] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 1098-1110 or amino acids 1140-1148 of SEQ ID NO: 24.
[0517] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH comprises a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH of SEQ ID NO: 25. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH comprises amino acids 1050-1194 of SEQ ID NO: 25. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH comprises a α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A NTNH, a β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A NTNH or a γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A NTNH of SEQ ID NO: 25. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH comprises amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25.
[0518] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH of SEQ ID NO: 25. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises amino acids 1050-1194 of SEQ ID NO: 25. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a modified α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A NTNH, a modified β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype A NTNH or a modified γ-fold motif of a 13-trefoil domain of a Clostridial botulinum serotype A NTNH of SEQ ID NO: 25. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25.
[0519] In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25, at least 75% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25, at least 80% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25, at least 85% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25, at least 90% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25 or at least 95% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25. In yet other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25, at most 75% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25, at most 80% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25, at most 85% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25, at most 90% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25 or at most 95% amino acid identity with amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25.
[0520] In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25. In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25. In yet other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25. In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25. In still other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25. In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25.
[0521] In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25. In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25. In yet other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25. In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25. In still other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25. In other aspects of this embodiment, a Clostridial botulinum serotype A NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1050-1097, amino acids 1111-1138, or amino acids 1149-1194 of SEQ ID NO: 25.
[0522] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH comprises a β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A NTNH or a 138/139 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A NTNH of SEQ ID NO: 25. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype A NTNH comprises amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25.
[0523] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A NTNH or a modified β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype A NTNH of SEQ ID NO: 25. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a modification of amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25.
[0524] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25, at least 75% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25, at least 80% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25, at least 85% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25, at least 90% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25 or at least 95% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25, at most 75% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25, at most 80% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25, at most 85% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25, at most 90% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25 or at most 95% amino acid identity with amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25.
[0525] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25.
[0526] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype A NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 1098-1110 or amino acids 1139-1148 of SEQ ID NO: 25.
[0527] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype B NTNH comprises a β-trefoil domain derived from a Clostridial botulinum serotype B NTNH of SEQ ID NO: 26. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype B NTNH comprises amino acids 1049-1198 of SEQ ID NO: 26. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype B NTNH comprises a α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B NTNH, a β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B NTNH or a γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B NTNH of SEQ ID NO: 26. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype B NTNH comprises amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26.
[0528] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH of SEQ ID NO: 26. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH comprises amino acids 1049-1198 of SEQ ID NO: 26. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH comprises a modified α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B NTNH, a modified β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype B NTNH or a modified γ-fold motif of a 13-trefoil domain of a Clostridial botulinum serotype B NTNH of SEQ ID NO: 26. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH comprises amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26.
[0529] In other aspects of this embodiment, a Clostridial botulinum serotype B NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26, at least 75% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26, at least 80% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26, at least 85% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26, at least 90% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26 or at least 95% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26. In yet other aspects of this embodiment, a Clostridial botulinum serotype B NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26, at most 75% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26, at most 80% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26, at most 85% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26, at most 90% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26 or at most 95% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26.
[0530] In other aspects of this embodiment, a Clostridial botulinum serotype B NTNH comprising a 11-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26. In other aspects of this embodiment, a Clostridial botulinum serotype B NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26. In yet other aspects of this embodiment, a Clostridial botulinum serotype B NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26. In other aspects of this embodiment, a Clostridial botulinum serotype B NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26. In still other aspects of this embodiment, a Clostridial botulinum serotype B NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26. In other aspects of this embodiment, a Clostridial botulinum serotype B NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26.
[0531] In other aspects of this embodiment, a Clostridial botulinum serotype B NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26. In other aspects of this embodiment, a Clostridial botulinum serotype B NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26. In yet other aspects of this embodiment, a Clostridial botulinum serotype B NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26. In other aspects of this embodiment, a Clostridial botulinum serotype B NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26. In still other aspects of this embodiment, a Clostridial botulinum serotype B NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26. In other aspects of this embodiment, a Clostridial botulinum serotype B NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1198 of SEQ ID NO: 26.
[0532] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype B NTNH comprises a β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B NTNH or a 138/139 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B NTNH of SEQ ID NO: 26. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype B NTNH comprises amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26.
[0533] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B NTNH or a modified β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype B NTNH of SEQ ID NO: 26. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH comprises a modification of amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26.
[0534] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26, at least 75% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26, at least 80% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26, at least 85% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26, at least 90% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26 or at least 95% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26, at most 75% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26, at most 80% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26, at most 85% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26, at most 90% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26 or at most 95% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26.
[0535] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26.
[0536] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype B NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 26.
[0537] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype Cl NTNH comprises a β-trefoil domain derived from a Clostridial botulinum serotype C1 NTNH of SEQ ID NO: 27. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype Cl NTNH comprises amino acids 1049-1197 of SEQ ID NO: 27. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype C1 NTNH comprises a α-fold motif of a 13-trefoil domain of a Clostridial botulinum serotype C1 NTNH, a β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 NTNH or a γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 NTNH of SEQ ID NO: 27. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype C1 NTNH comprises amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27.
[0538] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH of SEQ ID NO: 27. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH comprises amino acids 1049-1197 of SEQ ID NO: 27. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH comprises a modified α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 NTNH, a modified β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 NTNH or a modified γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype C1 NTNH of SEQ ID NO: 27. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH comprises amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27.
[0539] In other aspects of this embodiment, a Clostridial botulinum serotype C1 NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27, at least 75% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27, at least 80% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27, at least 85% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27, at least 90% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27 or at least 95% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27. In yet other aspects of this embodiment, a Clostridial botulinum serotype C1 NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27, at most 75% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27, at most 80% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27, at most 85% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27, at most 90% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27 or at most 95% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27.
[0540] In other aspects of this embodiment, a Clostridial botulinum serotype C1 NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27. In other aspects of this embodiment, a Clostridial botulinum serotype C1 NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27. In yet other aspects of this embodiment, a Clostridial botulinum serotype C1 NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27. In other aspects of this embodiment, a Clostridial botulinum serotype C1 NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27. In still other aspects of this embodiment, a Clostridial botulinum serotype C1 NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27. In other aspects of this embodiment, a Clostridial botulinum serotype C1 NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27.
[0541] In other aspects of this embodiment, a Clostridial botulinum serotype C1 NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27. In other aspects of this embodiment, a Clostridial botulinum serotype C1 NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27. In yet other aspects of this embodiment, a Clostridial botulinum serotype C1 NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27. In other aspects of this embodiment, a Clostridial botulinum serotype C1 NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27. In still other aspects of this embodiment, a Clostridial botulinum serotype C1 NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27. In other aspects of this embodiment, a Clostridial botulinum serotype C1 NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 27.
[0542] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype Cl NTNH comprises a β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 NTNH or a β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 NTNH of SEQ ID NO: 27. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype C1 NTNH comprises amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27.
[0543] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 NTNH or a modified β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype C1 NTNH of SEQ ID NO: 27. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH comprises a modification of amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27.
[0544] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27, at least 75% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27, at least 80% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27, at least 85% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27, at least 90% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27 or at least 95% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27, at most 75% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27, at most 80% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27, at most 85% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27, at most 90% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27 or at most 95% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27.
[0545] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27.
[0546] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype C1 NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 27.
[0547] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype D NTNH comprises a β-trefoil domain derived from a Clostridial botulinum serotype D NTNH of SEQ ID NO: 28. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype D NTNH comprises amino acids 1049-1197 of SEQ ID NO: 28. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype D NTNH comprises a α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype D NTNH, a β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype D NTNH or a γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype D NTNH of SEQ ID NO: 28. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype D NTNH comprises amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28.
[0548] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH of SEQ ID NO: 28. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH comprises amino acids 1049-1197 of SEQ ID NO: 28. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH comprises a modified α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype D NTNH, a modified β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype D NTNH or a modified γ-fold motif of a 13-trefoil domain of a Clostridial botulinum serotype D NTNH of SEQ ID NO: 28. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH comprises amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28.
[0549] In other aspects of this embodiment, a Clostridial botulinum serotype D NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28, at least 75% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28, at least 80% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28, at least 85% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28, at least 90% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28 or at least 95% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28. In yet other aspects of this embodiment, a Clostridial botulinum serotype D NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28, at most 75% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28, at most 80% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28, at most 85% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28, at most 90% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28 or at most 95% amino acid identity with amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28.
[0550] In other aspects of this embodiment, a Clostridial botulinum serotype D NTNH comprising a 11-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28. In other aspects of this embodiment, a Clostridial botulinum serotype D NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28. In yet other aspects of this embodiment, a Clostridial botulinum serotype D NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28. In other aspects of this embodiment, a Clostridial botulinum serotype D NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28. In still other aspects of this embodiment, a Clostridial botulinum serotype D NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28. In other aspects of this embodiment, a Clostridial botulinum serotype D NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28.
[0551] In other aspects of this embodiment, a Clostridial botulinum serotype D NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28. In other aspects of this embodiment, a Clostridial botulinum serotype D NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28. In yet other aspects of this embodiment, a Clostridial botulinum serotype D NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28. In other aspects of this embodiment, a Clostridial botulinum serotype D NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28. In still other aspects of this embodiment, a Clostridial botulinum serotype D NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28. In other aspects of this embodiment, a Clostridial botulinum serotype D NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1049-1096, amino acids 1110-1138, or amino acids 1148-1197 of SEQ ID NO: 28.
[0552] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype D NTNH comprises a β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype D NTNH or a β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype D NTNH of SEQ ID NO: 28. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype D NTNH comprises amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28.
[0553] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype D NTNH or a modified β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype D NTNH of SEQ ID NO: 28. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH comprises a modification of amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28.
[0554] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28, at least 75% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28, at least 80% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28, at least 85% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28, at least 90% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28 or at least 95% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28, at most 75% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28, at most 80% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28, at most 85% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28, at most 90% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28 or at most 95% amino acid identity with amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28.
[0555] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28.
[0556] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype D NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 1097-1109 or amino acids 1139-1147 of SEQ ID NO: 28.
[0557] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype E NTNH comprises a β-trefoil domain derived from a Clostridial botulinum serotype E NTNH of SEQ ID NO: 29. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype E NTNH comprises amino acids 1014-1163 of SEQ ID NO: 29. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype E NTNH comprises a α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype E NTNH, a β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype E NTNH or a γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype E NTNH of SEQ ID NO: 29. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype E NTNH comprises amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29.
[0558] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH of SEQ ID NO: 29. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH comprises amino acids 1014-1163 of SEQ ID NO: 29. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH comprises a modified α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype E NTNH, a modified β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype E NTNH or a modified γ-fold motif of a 13-trefoil domain of a Clostridial botulinum serotype E NTNH of SEQ ID NO: 29. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH comprises amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29.
[0559] In other aspects of this embodiment, a Clostridial botulinum serotype E NTNH comprising a 11-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29, at least 75% amino acid identity with amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29, at least 80% amino acid identity with amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29, at least 85% amino acid identity with amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29, at least 90% amino acid identity with amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29 or at least 95% amino acid identity with amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29. In yet other aspects of this embodiment, a Clostridial botulinum serotype E NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29, at most 75% amino acid identity with amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29, at most 80% amino acid identity with amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29, at most 85% amino acid identity with amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29, at most 90% amino acid identity with amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29 or at most 95% amino acid identity with amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29.
[0560] In other aspects of this embodiment, a Clostridial botulinum serotype E NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29. In other aspects of this embodiment, a Clostridial botulinum serotype E NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29. In yet other aspects of this embodiment, a Clostridial botulinum serotype E NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29. In other aspects of this embodiment, a Clostridial botulinum serotype E NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29. In still other aspects of this embodiment, a Clostridial botulinum serotype E NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29. In other aspects of this embodiment, a Clostridial botulinum serotype E NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29.
[0561] In other aspects of this embodiment, a Clostridial botulinum serotype E NTNH comprising a Ii-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29. In other aspects of this embodiment, a Clostridial botulinum serotype E NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29. In yet other aspects of this embodiment, a Clostridial botulinum serotype E NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29. In other aspects of this embodiment, a Clostridial botulinum serotype E NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29. In still other aspects of this embodiment, a Clostridial botulinum serotype E NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29. In other aspects of this embodiment, a Clostridial botulinum serotype E NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1014-1061, amino acids 1075-1103, or amino acids 1114-1163 of SEQ ID NO: 29.
[0562] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype E NTNH comprises a 8β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype E NTNH or a β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype E NTNH of SEQ ID NO: 29. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype E NTNH comprises amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29.
[0563] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH comprises a modified 8β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype E NTNH or a modified 8β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype E NTNH of SEQ ID NO: 29. In another aspect of this embodiment, a R-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH comprises a modification of amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29.
[0564] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29, at least 75% amino acid identity with amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29, at least 80% amino acid identity with amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29, at least 85% amino acid identity with amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29, at least 90% amino acid identity with amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29 or at least 95% amino acid identity with amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29, at most 75% amino acid identity with amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29, at most 80% amino acid identity with amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29, at most 85% amino acid identity with amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29, at most 90% amino acid identity with amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29 or at most 95% amino acid identity with amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29.
[0565] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29.
[0566] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype E NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 1062-1074 or amino acids 1104-1113 of SEQ ID NO: 29.
[0567] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype F NTNH comprises a β-trefoil domain derived from a Clostridial botulinum serotype F NTNH of SEQ ID NO: 30. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype F NTNH comprises amino acids 1016-1160 of SEQ ID NO: 30. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype F NTNH comprises a α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype F NTNH, a β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype F NTNH or a γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype F NTNH of SEQ ID NO: 30. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype F NTNH comprises amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30.
[0568] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH of SEQ ID NO: 30. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises amino acids 1016-1160 of SEQ ID NO: 30. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a modified α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype F NTNH, a modified β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype F NTNH or a modified γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype F NTNH of SEQ ID NO: 30. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30.
[0569] In other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30, at least 75% amino acid identity with amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30, at least 80% amino acid identity with amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30, at least 85% amino acid identity with amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30, at least 90% amino acid identity with amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30 or at least 95% amino acid identity with amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30. In yet other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30, at most 75% amino acid identity with amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30, at most 80% amino acid identity with amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30, at most 85% amino acid identity with amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30, at most 90% amino acid identity with amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30 or at most 95% amino acid identity with amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30.
[0570] In other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30. In other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30. In yet other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30. In other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30. In still other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30. In other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30.
[0571] In other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30. In other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30. In yet other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30. In other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30. In still other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30. In other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1016-1063, amino acids 1077-1104, or amino acids 1115-1160 of SEQ ID NO: 30.
[0572] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype F NTNH comprises a β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype F NTNH or a 138/139 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype F NTNH of SEQ ID NO: 30. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype F NTNH comprises amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30.
[0573] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype F NTNH or a modified β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype F NTNH of SEQ ID NO: 30. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a modification of amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30.
[0574] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30, at least 75% amino acid identity with amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30, at least 80% amino acid identity with amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30, at least 85% amino acid identity with amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30, at least 90% amino acid identity with amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30 or at least 95% amino acid identity with amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30, at most 75% amino acid identity with amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30, at most 80% amino acid identity with amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30, at most 85% amino acid identity with amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30, at most 90% amino acid identity with amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30 or at most 95% amino acid identity with amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30.
[0575] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30.
[0576] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 1064-1076 or amino acids 1105-1114 of SEQ ID NO: 30.
[0577] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype F NTNH comprises a β-trefoil domain derived from a Clostridial botulinum serotype F NTNH of SEQ ID NO: 31. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype F NTNH comprises amino acids 1017-1166 of SEQ ID NO: 31. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype F NTNH comprises a α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype F NTNH, a β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype F NTNH or a γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype F NTNH of SEQ ID NO: 31. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype F NTNH comprises amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31.
[0578] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH of SEQ ID NO: 31. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises amino acids 1017-1166 of SEQ ID NO: 31. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a modified α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype F NTNH, a modified β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype F NTNH or a modified γ-fold motif of a 13-trefoil domain of a Clostridial botulinum serotype F NTNH of SEQ ID NO: 31. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31.
[0579] In other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31, at least 75% amino acid identity with amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31, at least 80% amino acid identity with amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31, at least 85% amino acid identity with amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31, at least 90% amino acid identity with amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31 or at least 95% amino acid identity with amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31. In yet other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31, at most 75% amino acid identity with amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31, at most 80% amino acid identity with amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31, at most 85% amino acid identity with amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31, at most 90% amino acid identity with amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31 or at most 95% amino acid identity with amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31.
[0580] In other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31. In other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31. In yet other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31. In other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31. In still other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31. In other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31.
[0581] In other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31. In other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31. In yet other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31. In other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31. In still other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31. In other aspects of this embodiment, a Clostridial botulinum serotype F NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1017-1064, amino acids 1078-1106, or amino acids 1117-1166 of SEQ ID NO: 31.
[0582] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype F NTNH comprises a β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype F NTNH or a 138/139 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype F NTNH of SEQ ID NO: 31. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype F NTNH comprises amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31.
[0583] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype F NTNH or a modified β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype F NTNH of SEQ ID NO: 31. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a modification of amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31.
[0584] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31, at least 75% amino acid identity with amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31, at least 80% amino acid identity with amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31, at least 85% amino acid identity with amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31, at least 90% amino acid identity with amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31 or at least 95% amino acid identity with amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31, at most 75% amino acid identity with amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31, at most 80% amino acid identity with amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31, at most 85% amino acid identity with amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31, at most 90% amino acid identity with amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31 or at most 95% amino acid identity with amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31.
[0585] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31.
[0586] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype F NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 1065-1077 or amino acids 1107-1116 of SEQ ID NO: 31.
[0587] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype G NTNH comprises a β-trefoil domain derived from a Clostridial botulinum serotype G NTNH of SEQ ID NO: 32. In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype G NTNH comprises amino acids 1050-1199 of SEQ ID NO: 32. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype G NTNH comprises a α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype G NTNH, a β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype G NTNH or a γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype G NTNH of SEQ ID NO: 32. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype G NTNH comprises amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32.
[0588] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH comprises a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH of SEQ ID NO: 32. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH comprises amino acids 1050-1199 of SEQ ID NO: 32. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH comprises a modified α-fold motif of a β-trefoil domain of a Clostridial botulinum serotype G NTNH, a modified β-fold motif of a β-trefoil domain of a Clostridial botulinum serotype G NTNH or a modified γ-fold motif of a β-trefoil domain of a Clostridial botulinum serotype G NTNH of SEQ ID NO: 32. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH comprises amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32.
[0589] In other aspects of this embodiment, a Clostridial botulinum serotype G NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32, at least 75% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32, at least 80% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32, at least 85% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32, at least 90% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32 or at least 95% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32. In yet other aspects of this embodiment, a Clostridial botulinum serotype G NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32, at most 75% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32, at most 80% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32, at most 85% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32, at most 90% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32 or at most 95% amino acid identity with amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32.
[0590] In other aspects of this embodiment, a Clostridial botulinum serotype G NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32. In other aspects of this embodiment, a Clostridial botulinum serotype G NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32. In yet other aspects of this embodiment, a Clostridial botulinum serotype G NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32. In other aspects of this embodiment, a Clostridial botulinum serotype G NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32. In still other aspects of this embodiment, a Clostridial botulinum serotype G NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32. In other aspects of this embodiment, a Clostridial botulinum serotype G NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32.
[0591] In other aspects of this embodiment, a Clostridial botulinum serotype G NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32. In other aspects of this embodiment, a Clostridial botulinum serotype G NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32. In yet other aspects of this embodiment, a Clostridial botulinum serotype G NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32. In other aspects of this embodiment, a Clostridial botulinum serotype G NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32. In still other aspects of this embodiment, a Clostridial botulinum serotype G NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32. In other aspects of this embodiment, a Clostridial botulinum serotype G NTNH comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 1050-1097, amino acids 1111-1139, or amino acids 1150-1199 of SEQ ID NO: 32.
[0592] In another embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype G NTNH comprises a β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype G NTNH or a β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype G NTNH of SEQ ID NO: 32. In another aspect of this embodiment, a β-trefoil domain derived from a Clostridial botulinum serotype G NTNH comprises amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32.
[0593] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype G NTNH or a modified β8/β9 hairpin turn of a β-trefoil domain of a Clostridial botulinum serotype G NTNH of SEQ ID NO: 32. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH comprises a modification of amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32.
[0594] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32, at least 75% amino acid identity with amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32, at least 80% amino acid identity with amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32, at least 85% amino acid identity with amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32, at least 90% amino acid identity with amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32 or at least 95% amino acid identity with amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32, at most 75% amino acid identity with amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32, at most 80% amino acid identity with amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32, at most 85% amino acid identity with amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32, at most 90% amino acid identity with amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32 or at most 95% amino acid identity with amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32.
[0595] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32.
[0596] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a Clostridial botulinum serotype G NTNH comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 1098-1110 or amino acids 1140-1149 of SEQ ID NO: 32.
[0597] Another example of an enhanced targeting domain that increases binding activity for an endogenous Clostridial toxin receptor present on a naturally-occurring Clostridial toxin target cell, includes, without limitation, ligands that bind the same receptors as naturally-occurring Clostridial toxins. Recent studies are revealing components of the endogenous receptors used by a Clostridial toxin during the intoxication process. As a non-limiting example, fibroblast growth factor 3 receptor (FGFR3) serves as a BoNT/A receptor, see, e.g., Ester Fernandez-Salas et al., Botulinum Toxin Screening Assays, PCT Patent Application No. 2005/006421 (Sep., 9, 2005). As another non-limiting example, synaptotagmin I serves as a BoNT/B receptor and as a BoNT/G receptor, see, e.g., Min Dong et al., Synaptotagmins I and II mediate entry of botulinum neurotoxin B into cells, 162(7) J. Cell Biol. 1293-1303 (2003); and Andreas Rummel et al., Synaptotagmins I and II act as nerve cell receptors for botulinum neurotoxin G, 279(29) J. Biol. Chem. 30865-30870 (2004). As yet another non-limiting example, synaptotagmin II serves as a BoNT/B receptor and as a BoNT/G receptor, see, e.g., Min Dong et al., supra, (2003); and Andreas Rummel et al., supra, (2004). The selection of a ligand domain as an enhanced binding region will depend on the Clostridial toxin being modified. As non-limiting examples, ligands that selectively bind to a FGFR3 could be used as an enhanced targeting domain for a modified BoNT/A, whereas ligands that selectively bind a Synaptotagmin I or Synaptotagmin II could be used as an enhanced targeting domain for a modified BoNT/B or a modified BoNT/G.
[0598] In addition to its enhanced targeting activity, replacement of a naturally-occurring targeting domain with an FGF ligand has an added advantage of reducing the likelihood of the modified toxin from eliciting an immunogenic response. Regions found in the HCC targeting domain are bound by neutralizing anti-BoNT/A antibodies, see, e.g., M. Zouhair Atassi et al., Mapping of the Antibody-binding Regions on Botulinum Neurotoxin H-chain Domain 855-1296 with Anti-toxin Antibodies from Three Host Species, 15 J. PROT. CHEM. 691-700, (1996); M. Zouhair Atassi & Behzod Z. Dolimbek, Mapping of the Antibody-binding Profile on Botulinum Neurotoxin A HN-domain (residues 449-859) with Anti-toxin Antibodies from Four Host Species. Antigenic Profile of the Entire H-chain of Botulinum Neurotoxin A, 23(1) PROTEIN J. 39-52, (2004). Therefore, elimination of this targeting domain will reduce the likelihood of an immunogenic response because 1) the Clostridial toxin HCC targeting domain is absent; 2) a human FGF targeting domain will most likely not elicit an immunogenic response in a patient because it is a human polypeptide.
[0599] Fibroblast growth factors (FGF) participate in many developmental, differentiation and growth and repair processes of cells through complex combinatorial signaling pathways. Presently, at least 23 ligands (FGF1-23) are known to signal through a family of five transmembrane tyrosine kinase FGF receptors (FGFR1-5). Affinity of FGFRs for their ligands is highly diverse with different affinities for each family member of growth factors, see, e.g., C. J. Powers et al., Fibroblast growth factors, their receptors and signaling, 7β) Endocr. Relat. Cancer. 165-197 (2000). This diversity is achieved in part by the generation of alternatively spliced variants encoding distinct receptor isoforms, see, e.g., Bernhard Reuss & Oliver von Bohlen and Halbach, Fibroblast growth factors and their receptors in the central nervous system, 313(2) Cell Tissue Res. 139-157 (2003). The protein region that appears to have the highest influence on ligand binding selectivity is a portion of the 1011 domain, for which isoforms encoded by three different splice variants have been identified. These three isoforms, designated IgIIIa, IgIIIb and IgIIIc, have relative binding affinities for different FGFR family members. Alternative splicing in the FGFR ligand binding domain, designated a and b, generates additional receptor isoforms with novel ligand affinities. Isoforms for IgIIIa, IgIIIb and IgIIIc have been identified for both FGFR1 and FGFR2. Thus far, the IgIIIa isoform of FGFR3 and the IgIIIa and IgIIIb isoforms of FGFR4 and FGFR5 have not been reported.
[0600] Currently, several FGFs have been shown to selectively bind FGFR3, such as, e.g., FGF-1, FGF-2, FGF-4, FGF-8, FGF-9, FGF-17 and FGF-18, see, e.g., Hecht et al., 1995; Ornitz et al., 1996; and Xu et al., 2000. Additional studies have revealed that FGF-1 and FGF9 preferentially bind FGFR3IIIb, whereas FGF-1 FGF-2, FGF-4, FGF-8, and FGF9 preferentially bind FGFR3IIIc. Studies have shown that each of these ligands is present in various vertebrate species with a high degree of sequence identity which suggests functional equivalence or similarity. As a non-limiting example, FGF-8 is found in fish, birds and mammals and each of these FGF-8 ligands have over 80% amino acid sequence identity. As another non-limiting example, FGF-18 is found in fish, birds and mammals and each of these FGF-18 ligands have over 70% amino acid sequence identity. Crystallographic studies have revealed that all FGFs are structurally organized into a β-trefoil domain. The amino acid sequences comprising the β-trefoil domains found in various FGF ligands that bind FGFR3 are shown in Table 7.
TABLE-US-00007 TABLE 7 β-trefoil Domains of FGFs Amino Acid Sequence Region of Carbohydrate Binding Moieties β4/β5 β8/β9 Ligand SEQ ID NO: α-fold β-hairpin turn β-fold β-hairpin turn γ-fold FGF-1 33 26-64 65-67 68-105 106-108 109-155 FGF-2 34 29-67 68-70 71-111 112-114 115-155 FGF-4 35 83-121 122-124 125-162 163-165 166-206 FGF-8 36 43-80 81-83 84-123 124-126 127-172 FGF-9 37 63-100 101-103 104-144 145-147 148-196 FGF-17 38 55-91 92-94 95-134 135-137 138-183 FGF-18 39 54-91 92-94 95-134 135-137 138-183
[0601] As used herein, the term "Fibroblast Growth Factor" is synonymous with "FGF" and means a polypeptide with selective binding activity, such as, e.g., a binding affinity or a binding specificity, for a receptor, including endogenous Clostridial toxin receptors such as, e.g., a receptor comprising FGFR3. It is envisioned that both naturally occurring FGFs as well as FGFs with enhanced binding activity can be used to practice aspects of the present invention. As used herein, the term "FGF with enhanced binding activity" means a FGF with enhanced binding activity for an endogenous Clostridial toxin receptor, such as, e.g., a binding affinity or a binding specificity, to a statistically significantly degree relative to an unmodified naturally occurring Clostridial toxin binding domain from a Clostridial toxin. By definition, a FGF with enhanced binding activity has at least one amino acid change from the corresponding region of the disclosed reference sequences (see Table 7) and can be described in percent identity to the corresponding region of that reference sequence.
[0602] Any of a variety of sequence alignment methods can be used to determine percent identity of a modified FGF relative to a naturally-occurring FGF, including, without limitation, global methods, local methods and hybrid methods, such as, e.g., segment approach methods. Protocols to determine percent identity are routine procedures within the scope of one skilled in the art and from the teaching herein.
[0603] Approaches well known to one skilled in the art on how to modify a FGF in order to increase its binding activity for an endogenous Clostridial toxin receptor present on a naturally-occurring Clostridial toxin target cell. As described above, one approach involves identifying amino acids using computational protein design algorithms; changing specifically-identified amino acids using, without limitation, site-directed mutagenesis, oligonucleotide-directed mutagenesis and site-specific mutagenesis; and testing the binding activity of modified Clostridial toxins comprising a modified FGF with enhanced binding activity using, e.g., heterogeneous assays, homogeneous assays and non-separating homogeneous assays. It is further envisioned that the binding activity of a modified Clostridial toxin with enhanced binding activity disclosed in the present specification can be determined by affinity chromatography using immobilized receptors and interfacial optical assays. In another approach described above, a binding activity of a modified FGF for a naturally-occurring Clostridial toxin receptor present on a naturally-occurring Clostridial toxin target cell can be achieved using directed-evolution methods.
[0604] A FGF includes, without limitation, naturally occurring FGF variants, such as, e.g., FGF isoforms and FGF subtypes; non-naturally occurring FGF variants, such as, e.g., conservative FGF variants, non-conservative FGF variants, FGF chimerics, active FGF fragments thereof, or any combination thereof.
[0605] As used herein, the term "FGF variant," whether naturally-occurring or non-naturally-occurring, means a FGF that has at least one amino acid change from the corresponding region of the disclosed reference sequences (see Tables 7) and can be described in percent identity to the corresponding region of that reference sequence. Unless expressly indicated, all FGF variants disclosed in the present specification are capable of executing the cell binding step of the intoxication process.
[0606] It is recognized by those of skill in the art that within each Clostridial bacterium there can be naturally occurring FGF variants that differ somewhat in their amino acid sequence, and also in the nucleic acids encoding these proteins. For example, there are presently at least four FGF-8 variants, FGF-8A, FGF-8A, FGF-8B, FGF-8E and FGF-8F, with specific FGF-8 variants showing various degrees of amino acid divergence when compared to another FGF-8 variant. As another example, there are presently at least two FGF-2 variants, FGF-2-1 and FGF-2-1, with the FGF-2-1 variant showing an amino acid divergence when compared to the FGF-2-2 variant. As used herein, the term "naturally occurring FGF variant" means any FGF produced by a naturally-occurring process, including, without limitation, FGF isoforms produced from alternatively-spliced transcripts, FGF isoforms produced by spontaneous mutation and FGF subtypes. A naturally occurring FGF variant can function in substantially the same manner as the reference FGF on which the naturally occurring FGF variant is based, and can be substituted for the reference FGF in any aspect of the present invention. A naturally occurring FGF variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, ten or more amino acids, 20 or more amino acids, 30 or more amino acids, 40 or more amino acids, 50 or more amino acids or 100 or more amino acids from the reference FGF on which the naturally occurring FGF variant is based. A naturally occurring FGF variant can also substitute at least 10 contiguous amino acids, at least 15 contiguous amino acids, at least 20 contiguous amino acids, or at least 25 contiguous amino acids from the reference FGF on which the naturally occurring FGF variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference FGF on which the naturally occurring FGF variant is based.
[0607] A non-limiting examples of a naturally occurring FGF variant is a FGF isoform such as, e.g., a FGF-1 isoform, a FGF-2 isoform, a FGF-4 isoform, a FGF-8 isoform, a FGF-9 isoform, a FGF-17 isoform and a FGF-18 isoform. A FGF isoform can function in substantially the same manner as the reference FGF on which the FGF isoform is based, and can be substituted for the reference FGF in any aspect of the present invention.
[0608] Another non-limiting examples of a naturally occurring FGF variant is a FGF subtype such as, e.g., a FGF-1 subtype, a FGF-2 subtype, a FGF-4 subtype, a FGF-8 subtype, a FGF-9 subtype, a FGF-17 subtype and a FGF-18 subtype. A FGF subtype can function in substantially the same manner as the reference FGF on which the FGF subtype is based, and can be substituted for the reference FGF in any aspect of the present invention.
[0609] As used herein, the term "non-naturally occurring FGF variant" means any FGF produced with the aid of human manipulation, including, without limitation, FGFs produced by genetic engineering using random mutagenesis or rational design and FGFs produced by chemical synthesis. Non-limiting examples of non-naturally occurring FGF variants include, e.g., conservative FGF variants, non-conservative FGF variants, FGF chimeric variants and active FGF fragments.
[0610] As used herein, the term "conservative FGF variant" means a FGF that has at least one amino acid substituted by another amino acid or an amino acid analog that has at least one property similar to that of the original amino acid from the reference FGF sequence (see Table 7). Examples of properties include, without limitation, similar size, topography, charge, hydrophobicity, hydrophilicity, lipophilicity, covalent-bonding capacity, hydrogen-bonding capacity, a physicochemical property, of the like, or any combination thereof. A conservative FGF variant can function in substantially the same manner as the reference FGF on which the conservative FGF variant is based, and can be substituted for the reference FGF in any aspect of the present invention. A conservative FGF variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, ten or more amino acids, 20 or more amino acids, 30 or more amino acids, 40 or more amino acids or 50 or more amino acids from the reference FGF on which the conservative FGF variant is based. A conservative FGF variant can also substitute at least 10 contiguous amino acids, at least 15 contiguous amino acids, at least 20 contiguous amino acids, or at least 25 contiguous amino acids from the reference FGF on which the conservative FGF variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference FGF on which the conservative FGF variant is based. Non-limiting examples of a conservative FGF variant include, e.g., a conservative FGF-1 variant, a conservative FGF-2 variant, a conservative FGF-4 variant, a conservative FGF-8 variant, a conservative FGF-9 variant, a conservative FGF-17 variant and a conservative FGF-18 variant.
[0611] As used herein, the term "non-conservative FGF variant" means a FGF in which 1) at least one amino acid is deleted from the reference FGF on which the non-conservative FGF variant is based; 2) at least one amino acid added to the reference FGF on which the non-conservative FGF is based; or 3) at least one amino acid is substituted by another amino acid or an amino acid analog that does not share any property similar to that of the original amino acid from the reference FGF sequence (see Table 7). A non-conservative FGF variant can function in substantially the same manner as the reference FGF on which the non-conservative FGF variant is based, and can be substituted for the reference FGF in any aspect of the present invention. A non-conservative FGF variant can delete one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, and ten or more amino acids from the reference FGF on which the non-conservative FGF variant is based. A non-conservative FGF variant can add one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, and ten or more amino acids to the reference FGF on which the non-conservative FGF variant is based. A non-conservative FGF variant may substitute one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, ten or more amino acids, 20 or more amino acids, 30 or more amino acids, 40 or more amino acids or 50 or more amino acids from the reference FGF on which the non-conservative FGF variant is based. A non-conservative FGF variant can also substitute at least 10 contiguous amino acids, at least 15 contiguous amino acids, at least 20 contiguous amino acids, or at least 25 contiguous amino acids from the reference FGF on which the non-conservative FGF variant is based, that possess at least 50% amino acid identity, 65% amino acid identity, 75% amino acid identity, 85% amino acid identity or 95% amino acid identity to the reference FGF on which the non-conservative FGF variant is based. Non-limiting examples of a non-conservative FGF variant include, e.g., a non-conservative FGF-1 variant, a non-conservative FGF-2 variant, a non-conservative FGF-4 variant, a non-conservative FGF-8 variant, a non-conservative FGF-9 variant, a non-conservative FGF-17 variant and a non-conservative FGF-18 variant.
[0612] As used herein, the term "FGF chimeric" means a polypeptide comprising at least a portion of a FGF and at least a portion of at least one other polypeptide to form an enhanced targeting domain with at least one property different from the reference FGF (see Tables 7), with the proviso that this FGF chimeric can specifically bind to an endogenous Clostridial toxin receptor present in a Clostridial toxin target cell, and thus participate in executing the overall cellular mechanism whereby a Clostridial toxin proteolytically cleaves a substrate.
[0613] Thus, in an embodiment, a modified Clostridial toxin disclosed in the present specification comprises an enhanced targeting domain comprising a β-trefoil domain derived from a FGF. In an aspect of this embodiment, a β-trefoil domain derived from a FGF comprises, e.g., a β-trefoil domain derived from a FGF-1, a β-trefoil domain derived from a FGF-2, a β-trefoil domain derived from FGF-4, a β-trefoil domain derived from a FGF-8, a β-trefoil domain derived from a FGF-9, a β-trefoil domain derived from a FGF-17 or a β-trefoil domain derived from a FGF-18. In another aspect of this embodiment, a β-trefoil domain derived from a FGF comprises a α-fold motif of a β-trefoil domain of a FGF, a β-fold motif of a β-trefoil domain of a FGF or a γ-fold motif of a β-trefoil domain of a FGF.
[0614] In an embodiment, a modified Clostridial toxin disclosed in the present specification comprises an enhanced targeting domain comprising a β-trefoil domain with enhanced binding activity derived from a FGF. In an aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF comprises, e.g., a β-trefoil domain with enhanced binding activity derived from a FGF-1, a β-trefoil domain with enhanced binding activity derived from a FGF-2, a β-trefoil domain with enhanced binding activity derived from a FGF-4, a β-trefoil domain with enhanced binding activity derived from a FGF-8, a β-trefoil domain with enhanced binding activity derived from a FGF-9, a β-trefoil domain with enhanced binding activity derived from a FGF-17 or a β-trefoil domain with enhanced binding activity derived from a FGF-18. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF comprises a modified α-fold motif of a β-trefoil domain of a FGF, a modified β-fold motif of a β-trefoil domain of a FGF or a modified γ-fold motif of a β-trefoil domain of a FGF.
[0615] In another embodiment, a β-trefoil domain derived from a FGF-1 comprises a β-trefoil domain derived from a FGF-1 of SEQ ID NO: 33. In another embodiment, a β-trefoil domain derived from a FGF-1 comprises amino acids 26-155 of SEQ ID NO: 33. In another aspect of this embodiment, a β-trefoil domain derived from a FGF-1 comprises a α-fold motif of a β-trefoil domain of a FGF-1, a β-fold motif of a β-trefoil domain of a FGF-1 or a γ-fold motif of a β-trefoil domain of a FGF-1 of SEQ ID NO: 33. In another aspect of this embodiment, a β-trefoil domain derived from a FGF-1 comprises amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33.
[0616] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-1 comprises a β-trefoil domain with enhanced binding activity derived from a FGF-1 of SEQ ID NO: 33. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-1 comprises amino acids 26-155 of SEQ ID NO: 33. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-1 comprises a modified α-fold motif of a β-trefoil domain of a FGF-1, a modified β-fold motif of a β-trefoil domain of a FGF-1 or a modified γ-fold motif of a β-trefoil domain of a FGF-1 of SEQ ID NO: 33. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-1 comprises amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33.
[0617] In other aspects of this embodiment, a FGF-1 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33, at least 75% amino acid identity with amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33, at least 80% amino acid identity with amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33, at least 85% amino acid identity with amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33, at least 90% amino acid identity with amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33 or at least 95% amino acid identity with amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33. In yet other aspects of this embodiment, a FGF-1 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33, at most 75% amino acid identity with amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33, at most 80% amino acid identity with amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33, at most 85% amino acid identity with amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33, at most 90% amino acid identity with amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33 or at most 95% amino acid identity with amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33.
[0618] In other aspects of this embodiment, a FGF-1 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33. In other aspects of this embodiment, a FGF-1 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33. In yet other aspects of this embodiment, a FGF-1 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33. In other aspects of this embodiment, a FGF-1 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33. In still other aspects of this embodiment, a FGF-1 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33. In other aspects of this embodiment, a FGF-1 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33.
[0619] In other aspects of this embodiment, a FGF-1 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33. In other aspects of this embodiment, a FGF-1 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33. In yet other aspects of this embodiment, a FGF-1 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33. In other aspects of this embodiment, a FGF-1 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33. In still other aspects of this embodiment, a FGF-1 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33. In other aspects of this embodiment, a FGF-1 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 26-64, amino acids 68-105, or amino acids 109-155 of SEQ ID NO: 33.
[0620] In another embodiment, a β-trefoil domain derived from a FGF-1 comprises a β4/β5 hairpin turn of a β-trefoil domain of a FGF-1 or a β8/β9 hairpin turn of a β-trefoil domain of a FGF-1 of SEQ ID NO: 33. In another aspect of this embodiment, a β-trefoil domain derived from a FGF-1 comprises amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33.
[0621] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-1 comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a FGF-1 or a modified β8/β9 hairpin turn of a β-trefoil domain of a FGF-1 of SEQ ID NO: 33. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-1 comprises a modification of amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33.
[0622] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-1 comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33, at least 75% amino acid identity with amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33, at least 80% amino acid identity with amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33, at least 85% amino acid identity with amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33, at least 90% amino acid identity with amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33 or at least 95% amino acid identity with amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-1 comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33, at most 75% amino acid identity with amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33, at most 80% amino acid identity with amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33, at most 85% amino acid identity with amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33, at most 90% amino acid identity with amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33 or at most 95% amino acid identity with amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33.
[0623] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-1 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-1 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-1 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-1 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-1 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-1 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33.
[0624] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-1 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-1 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-1 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-1 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-1 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-1 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 65-67 or amino acids 106-108 of SEQ ID NO: 33.
[0625] In another embodiment, a β-trefoil domain derived from a FGF-2 comprises a β-trefoil domain derived from a FGF-2 of SEQ ID NO: 34. In another embodiment, a β-trefoil domain derived from a FGF-2 comprises amino acids 29-155 of SEQ ID NO: 34. In another aspect of this embodiment, a β-trefoil domain derived from a FGF-2 comprises a α-fold motif of a β-trefoil domain of a FGF-2, a β-fold motif of a β-trefoil domain of a FGF-2 or a γ-fold motif of a β-trefoil domain of a FGF-2 of SEQ ID NO: 34. In another aspect of this embodiment, a β-trefoil domain derived from a FGF-2 comprises amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34.
[0626] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-2 comprises a β-trefoil domain with enhanced binding activity derived from a FGF-2 of SEQ ID NO: 34. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-2 comprises amino acids 29-155 of SEQ ID NO: 34. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-2 comprises a modified α-fold motif of a β-trefoil domain of a FGF-2, a modified β-fold motif of a β-trefoil domain of a FGF-2 or a modified γ-fold motif of a β-trefoil domain of a FGF-2 of SEQ ID NO: 34. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-2 comprises amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34.
[0627] In other aspects of this embodiment, a FGF-2 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34, at least 75% amino acid identity with amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34, at least 80% amino acid identity with amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34, at least 85% amino acid identity with amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34, at least 90% amino acid identity with amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34 or at least 95% amino acid identity with amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34. In yet other aspects of this embodiment, a FGF-2 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34, at most 75% amino acid identity with amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34, at most 80% amino acid identity with amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34, at most 85% amino acid identity with amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34, at most 90% amino acid identity with amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34 or at most 95% amino acid identity with amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34.
[0628] In other aspects of this embodiment, a FGF-2 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34. In other aspects of this embodiment, a FGF-2 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34. In yet other aspects of this embodiment, a FGF-2 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34. In other aspects of this embodiment, a FGF-2 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34. In still other aspects of this embodiment, a FGF-2 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34. In other aspects of this embodiment, a FGF-2 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34.
[0629] In other aspects of this embodiment, a FGF-2 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34. In other aspects of this embodiment, a FGF-2 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34. In yet other aspects of this embodiment, a FGF-2 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34. In other aspects of this embodiment, a FGF-2 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34. In still other aspects of this embodiment, a FGF-2 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34. In other aspects of this embodiment, a FGF-2 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 29-67, amino acids 71-111, or amino acids 115-155 of SEQ ID NO: 34.
[0630] In another embodiment, a β-trefoil domain derived from a FGF-2 comprises a β4/β5 hairpin turn of a β-trefoil domain of a FGF-2 or a β8/β9 hairpin turn of a β-trefoil domain of a FGF-2 of SEQ ID NO: 34. In another aspect of this embodiment, a β-trefoil domain derived from a FGF-2 comprises amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34.
[0631] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-2 comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a FGF-2 or a modified β8/β9 hairpin turn of a β-trefoil domain of a FGF-2 of SEQ ID NO: 34. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-2 comprises a modification of amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34.
[0632] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-2 comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34, at least 75% amino acid identity with amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34, at least 80% amino acid identity with amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34, at least 85% amino acid identity with amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34, at least 90% amino acid identity with amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34 or at least 95% amino acid identity with amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-2 comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34, at most 75% amino acid identity with amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34, at most 80% amino acid identity with amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34, at most 85% amino acid identity with amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34, at most 90% amino acid identity with amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34 or at most 95% amino acid identity with amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34.
[0633] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-2 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-2 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-2 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-2 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-2 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-2 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34.
[0634] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-2 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-2 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-2 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-2 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-2 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-2 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 68-70 or amino acids 112-114 of SEQ ID NO: 34.
[0635] In another embodiment, a β-trefoil domain derived from a FGF-4 comprises a β-trefoil domain derived from a FGF-4 of SEQ ID NO: 35. In another embodiment, a β-trefoil domain derived from a FGF-4 comprises amino acids 83-206 of SEQ ID NO: 35. In another aspect of this embodiment, a β-trefoil domain derived from a FGF-4 comprises a α-fold motif of a β-trefoil domain of a FGF-4, a β-fold motif of a β-trefoil domain of a FGF-4 or a γ-fold motif of a β-trefoil domain of a FGF-4 of SEQ ID NO: 35. In another aspect of this embodiment, a β-trefoil domain derived from a FGF-4 comprises amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35.
[0636] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-4 comprises a β-trefoil domain with enhanced binding activity derived from a FGF-4 of SEQ ID NO: 35. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-4 comprises amino acids 83-206 of SEQ ID NO: 35. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-4 comprises a modified α-fold motif of a β-trefoil domain of a FGF-4, a modified β-fold motif of a β-trefoil domain of a FGF-4 or a modified γ-fold motif of a β-trefoil domain of a FGF-4 of SEQ ID NO: 35. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-4 comprises amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35.
[0637] In other aspects of this embodiment, a FGF-4 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35, at least 75% amino acid identity with amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35, at least 80% amino acid identity with amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35, at least 85% amino acid identity with amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35, at least 90% amino acid identity with amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35 or at least 95% amino acid identity with amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35. In yet other aspects of this embodiment, a FGF-4 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35, at most 75% amino acid identity with amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35, at most 80% amino acid identity with amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35, at most 85% amino acid identity with amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35, at most 90% amino acid identity with amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35 or at most 95% amino acid identity with amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35.
[0638] In other aspects of this embodiment, a FGF-4 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35. In other aspects of this embodiment, a FGF-4 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35. In yet other aspects of this embodiment, a FGF-4 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35. In other aspects of this embodiment, a FGF-4 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35. In still other aspects of this embodiment, a FGF-4 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35. In other aspects of this embodiment, a FGF-4 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35.
[0639] In other aspects of this embodiment, a FGF-4 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35. In other aspects of this embodiment, a FGF-4 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35. In yet other aspects of this embodiment, a FGF-4 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35. In other aspects of this embodiment, a FGF-4 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35. In still other aspects of this embodiment, a FGF-4 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35. In other aspects of this embodiment, a FGF-4 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 83-121, amino acids 125-162, or amino acids 166-206 of SEQ ID NO: 35.
[0640] In another embodiment, a β-trefoil domain derived from a FGF-4 comprises a β4/β5 hairpin turn of a β-trefoil domain of a FGF-4 or a β8/β9 hairpin turn of a β-trefoil domain of a FGF-4 of SEQ ID NO: 35. In another aspect of this embodiment, a β-trefoil domain derived from a FGF-4 comprises amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35.
[0641] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-4 comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a FGF-4 or a modified β8/β9 hairpin turn of a β-trefoil domain of a FGF-4 of SEQ ID NO: 35. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-4 comprises a modification of amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35.
[0642] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-4 comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35, at least 75% amino acid identity with amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35, at least 80% amino acid identity with amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35, at least 85% amino acid identity with amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35, at least 90% amino acid identity with amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35 or at least 95% amino acid identity with amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-4 comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35, at most 75% amino acid identity with amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35, at most 80% amino acid identity with amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35, at most 85% amino acid identity with amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35, at most 90% amino acid identity with amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35 or at most 95% amino acid identity with amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35.
[0643] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-4 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-4 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-4 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-4 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-4 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-4 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35.
[0644] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-4 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-4 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-4 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-4 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-4 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-4 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 122-124 or amino acids 163-165 of SEQ ID NO: 35.
[0645] In another embodiment, a β-trefoil domain derived from a FGF-8 comprises a β-trefoil domain derived from a FGF-8 of SEQ ID NO: 36. In another embodiment, a β-trefoil domain derived from a FGF-8 comprises amino acids 43-172 of SEQ ID NO: 36. In another aspect of this embodiment, a β-trefoil domain derived from a FGF-8 comprises a α-fold motif of a β-trefoil domain of a FGF-8, a β-fold motif of a β-trefoil domain of a FGF-8 or a γ-fold motif of a β-trefoil domain of a FGF-8 of SEQ ID NO: 36. In another aspect of this embodiment, a β-trefoil domain derived from a FGF-8 comprises amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36.
[0646] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-8 comprises a β-trefoil domain with enhanced binding activity derived from a FGF-8 of SEQ ID NO: 36. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-8 comprises amino acids 43-172 of SEQ ID NO: 36. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-8 comprises a modified α-fold motif of a β-trefoil domain of a FGF-8, a modified β-fold motif of a β-trefoil domain of a FGF-8 or a modified γ-fold motif of a β-trefoil domain of a FGF-8 of SEQ ID NO: 36. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-8 comprises amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36.
[0647] In other aspects of this embodiment, a FGF-8 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36, at least 75% amino acid identity with amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36, at least 80% amino acid identity with amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36, at least 85% amino acid identity with amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36, at least 90% amino acid identity with amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36 or at least 95% amino acid identity with amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36. In yet other aspects of this embodiment, a FGF-8 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36, at most 75% amino acid identity with amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36, at most 80% amino acid identity with amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36, at most 85% amino acid identity with amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36, at most 90% amino acid identity with amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36 or at most 95% amino acid identity with amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36.
[0648] In other aspects of this embodiment, a FGF-8 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36. In other aspects of this embodiment, a FGF-8 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36. In yet other aspects of this embodiment, a FGF-8 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36. In other aspects of this embodiment, a FGF-8 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36. In still other aspects of this embodiment, a FGF-8 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36. In other aspects of this embodiment, a FGF-8 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36.
[0649] In other aspects of this embodiment, a FGF-8 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36. In other aspects of this embodiment, a FGF-8 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36. In yet other aspects of this embodiment, a FGF-8 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36. In other aspects of this embodiment, a FGF-8 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36. In still other aspects of this embodiment, a FGF-8 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36. In other aspects of this embodiment, a FGF-8 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 43-80, amino acids 84-123, or amino acids 127-172 of SEQ ID NO: 36.
[0650] In another embodiment, a β-trefoil domain derived from a FGF-8 comprises a β4/β5 hairpin turn of a β-trefoil domain of a FGF-8 or a β8/β9 hairpin turn of a β-trefoil domain of a FGF-8 of SEQ ID NO: 36. In another aspect of this embodiment, a β-trefoil domain derived from a FGF-8 comprises amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36.
[0651] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-8 comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a FGF-8 or a modified β8/β9 hairpin turn of a β-trefoil domain of a FGF-8 of SEQ ID NO: 36. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-8 comprises a modification of amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36.
[0652] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-8 comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36, at least 75% amino acid identity with amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36, at least 80% amino acid identity with amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36, at least 85% amino acid identity with amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36, at least 90% amino acid identity with amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36 or at least 95% amino acid identity with amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-8 comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36, at most 75% amino acid identity with amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36, at most 80% amino acid identity with amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36, at most 85% amino acid identity with amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36, at most 90% amino acid identity with amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36 or at most 95% amino acid identity with amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36.
[0653] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-8 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-8 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-8 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-8 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-8 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-8 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36.
[0654] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-8 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-8 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-8 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-8 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-8 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-8 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 81-83 or amino acids 124-126 of SEQ ID NO: 36.
[0655] In another embodiment, a β-trefoil domain derived from a FGF-9 comprises a β-trefoil domain derived from a FGF-9 of SEQ ID NO: 37. In another embodiment, a β-trefoil domain derived from a FGF-9 comprises amino acids 63-196 of SEQ ID NO: 37. In another aspect of this embodiment, a β-trefoil domain derived from a FGF-9 comprises a α-fold motif of a β-trefoil domain of a FGF-9, a β-fold motif of a β-trefoil domain of a FGF-9 or a γ-fold motif of a β-trefoil domain of a FGF-9 of SEQ ID NO: 37. In another aspect of this embodiment, a β-trefoil domain derived from a FGF-9 comprises amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37.
[0656] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-9 comprises a β-trefoil domain with enhanced binding activity derived from a FGF-9 of SEQ ID NO: 37. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-9 comprises amino acids 63-196 of SEQ ID NO: 37. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-9 comprises a modified α-fold motif of a β-trefoil domain of a FGF-9, a modified β-fold motif of a β-trefoil domain of a FGF-9 or a modified γ-fold motif of a β-trefoil domain of a FGF-9 of SEQ ID NO: 37. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-9 comprises amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37.
[0657] In other aspects of this embodiment, a FGF-9 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37, at least 75% amino acid identity with amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37, at least 80% amino acid identity with amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37, at least 85% amino acid identity with amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37, at least 90% amino acid identity with amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37 or at least 95% amino acid identity with amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37. In yet other aspects of this embodiment, a FGF-9 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37, at most 75% amino acid identity with amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37, at most 80% amino acid identity with amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37, at most 85% amino acid identity with amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37, at most 90% amino acid identity with amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37 or at most 95% amino acid identity with amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37.
[0658] In other aspects of this embodiment, a FGF-9 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37. In other aspects of this embodiment, a FGF-9 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37. In yet other aspects of this embodiment, a FGF-9 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37. In other aspects of this embodiment, a FGF-9 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37. In still other aspects of this embodiment, a FGF-9 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37. In other aspects of this embodiment, a FGF-9 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37.
[0659] In other aspects of this embodiment, a FGF-9 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37. In other aspects of this embodiment, a FGF-9 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37. In yet other aspects of this embodiment, a FGF-9 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37. In other aspects of this embodiment, a FGF-9 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37. In still other aspects of this embodiment, a FGF-9 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37. In other aspects of this embodiment, a FGF-9 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 63-100, amino acids 104-144, or amino acids 148-196 of SEQ ID NO: 37.
[0660] In another embodiment, a β-trefoil domain derived from a FGF-9 comprises a β4/β5 hairpin turn of a β-trefoil domain of a FGF-9 or a β8/β9 hairpin turn of a β-trefoil domain of a FGF-9 of SEQ ID NO: 37. In another aspect of this embodiment, a β-trefoil domain derived from a FGF-9 comprises amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37.
[0661] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-9 comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a FGF-9 or a modified β8/β9 hairpin turn of a β-trefoil domain of a FGF-9 of SEQ ID NO: 37. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-9 comprises a modification of amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37.
[0662] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-9 comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37, at least 75% amino acid identity with amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37, at least 80% amino acid identity with amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37, at least 85% amino acid identity with amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37, at least 90% amino acid identity with amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37 or at least 95% amino acid identity with amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-9 comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37, at most 75% amino acid identity with amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37, at most 80% amino acid identity with amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37, at most 85% amino acid identity with amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37, at most 90% amino acid identity with amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37 or at most 95% amino acid identity with amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37.
[0663] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-9 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-9 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-9 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-9 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-9 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-9 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37.
[0664] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-9 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-9 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-9 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-9 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-9 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-9 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 101-103 or amino acids 145-147 of SEQ ID NO: 37.
[0665] In another embodiment, a β-trefoil domain derived from a FGF-17 comprises a β-trefoil domain derived from a FGF-17 of SEQ ID NO: 38. In another embodiment, a β-trefoil domain derived from a FGF-17 comprises amino acids 55-183 of SEQ ID NO: 38. In another aspect of this embodiment, a β-trefoil domain derived from a FGF-17 comprises a α-fold motif of a β-trefoil domain of a FGF-17, a β-fold motif of a β-trefoil domain of a FGF-17 or a γ-fold motif of a β-trefoil domain of a FGF-17 of SEQ ID NO: 38. In another aspect of this embodiment, a β-trefoil domain derived from a FGF-17 comprises amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38.
[0666] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-17 comprises a β-trefoil domain with enhanced binding activity derived from a FGF-17 of SEQ ID NO: 38. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-17 comprises amino acids 55-183 of SEQ ID NO: 38. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-17 comprises a modified α-fold motif of a β-trefoil domain of a FGF-17, a modified β-fold motif of a β-trefoil domain of a FGF-17 or a modified γ-fold motif of a β-trefoil domain of a FGF-17 of SEQ ID NO: 38. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-17 comprises amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38.
[0667] In other aspects of this embodiment, a FGF-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38, at least 75% amino acid identity with amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38, at least 80% amino acid identity with amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38, at least 85% amino acid identity with amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38, at least 90% amino acid identity with amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38 or at least 95% amino acid identity with amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38. In yet other aspects of this embodiment, a FGF-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38, at most 75% amino acid identity with amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38, at most 80% amino acid identity with amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38, at most 85% amino acid identity with amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38, at most 90% amino acid identity with amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38 or at most 95% amino acid identity with amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38.
[0668] In other aspects of this embodiment, a FGF-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38. In other aspects of this embodiment, a FGF-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38. In yet other aspects of this embodiment, a FGF-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38. In other aspects of this embodiment, a FGF-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38. In still other aspects of this embodiment, a FGF-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38. In other aspects of this embodiment, a FGF-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38.
[0669] In other aspects of this embodiment, a FGF-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38. In other aspects of this embodiment, a FGF-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38. In yet other aspects of this embodiment, a FGF-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38. In other aspects of this embodiment, a FGF-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38. In still other aspects of this embodiment, a FGF-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38. In other aspects of this embodiment, a FGF-17 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 55-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 38.
[0670] In another embodiment, a β-trefoil domain derived from a FGF-17 comprises a β4/β5 hairpin turn of a β-trefoil domain of a FGF-17 or a β8/β9 hairpin turn of a β-trefoil domain of a FGF-17 of SEQ ID NO: 38. In another aspect of this embodiment, a β-trefoil domain derived from a FGF-17 comprises amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38.
[0671] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-17 comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a FGF-17 or a modified β8/β9 hairpin turn of a β-trefoil domain of a FGF-17 of SEQ ID NO: 38. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-17 comprises a modification of amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38.
[0672] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-17 comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38, at least 75% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38, at least 80% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38, at least 85% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38, at least 90% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38 or at least 95% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-17 comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38, at most 75% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38, at most 80% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38, at most 85% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38, at most 90% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38 or at most 95% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38.
[0673] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-17 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-17 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-17 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-17 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-17 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-17 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38.
[0674] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-17 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-17 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-17 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-17 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-17 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-17 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 38.
[0675] In another embodiment, a β-trefoil domain derived from a FGF-18 comprises a β-trefoil domain derived from a FGF-18 of SEQ ID NO: 39. In another embodiment, a β-trefoil domain derived from a FGF-18 comprises amino acids 54-183 of SEQ ID NO: 39. In another aspect of this embodiment, a β-trefoil domain derived from a FGF-18 comprises a α-fold motif of a β-trefoil domain of a FGF-18, a β-fold motif of a β-trefoil domain of a FGF-18 or a γ-fold motif of a β-trefoil domain of a FGF-18 of SEQ ID NO: 39. In another aspect of this embodiment, a β-trefoil domain derived from a FGF-18 comprises amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39.
[0676] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-18 comprises a β-trefoil domain with enhanced binding activity derived from a FGF-18 of SEQ ID NO: 39. In another embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-18 comprises amino acids 54-183 of SEQ ID NO: 39. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-18 comprises a modified α-fold motif of a β-trefoil domain of a FGF-18, a modified β-fold motif of a β-trefoil domain of a FGF-18 or a modified γ-fold motif of a β-trefoil domain of a FGF-18 of SEQ ID NO: 39. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-18 comprises amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39.
[0677] In other aspects of this embodiment, a FGF-18 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39, at least 75% amino acid identity with amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39, at least 80% amino acid identity with amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39, at least 85% amino acid identity with amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39, at least 90% amino acid identity with amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39 or at least 95% amino acid identity with amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39. In yet other aspects of this embodiment, a FGF-18 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39, at most 75% amino acid identity with amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39, at most 80% amino acid identity with amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39, at most 85% amino acid identity with amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39, at most 90% amino acid identity with amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39 or at most 95% amino acid identity with amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39.
[0678] In other aspects of this embodiment, a FGF-18 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39. In other aspects of this embodiment, a FGF-18 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid substitutions relative to amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39. In yet other aspects of this embodiment, a FGF-18 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39. In other aspects of this embodiment, a FGF-18 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid deletions relative to amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39. In still other aspects of this embodiment, a FGF-18 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39. In other aspects of this embodiment, a FGF-18 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 non-contiguous amino acid additions relative to amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39.
[0679] In other aspects of this embodiment, a FGF-18 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39. In other aspects of this embodiment, a FGF-18 comprising a 11-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid substitutions relative to amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39. In yet other aspects of this embodiment, a FGF-18 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39. In other aspects of this embodiment, a FGF-18 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid deletions relative to amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39. In still other aspects of this embodiment, a FGF-18 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at most one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39. In other aspects of this embodiment, a FGF-18 comprising a β-trefoil domain with enhanced binding activity comprises a polypeptide having, e.g., at least one, two, three, four, five, six, seven, eight, nine, 10 or 20 contiguous amino acid additions relative to amino acids 54-91, amino acids 95-134, or amino acids 138-183 of SEQ ID NO: 39.
[0680] In another embodiment, a β-trefoil domain derived from a FGF-18 comprises a β4/β5 hairpin turn of a β-trefoil domain of a FGF-18 or a β8/β9 hairpin turn of a β-trefoil domain of a FGF-18 of SEQ ID NO: 39. In another aspect of this embodiment, a β-trefoil domain derived from a FGF-18 comprises amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39.
[0681] In another embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-18 comprises a modified β4/β5 hairpin turn of a β-trefoil domain of a FGF-18 or a modified β8/β9 hairpin turn of a β-trefoil domain of a FGF-18 of SEQ ID NO: 39. In another aspect of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-18 comprises a modification of amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39.
[0682] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-18 comprises a polypeptide having, e.g., at least 70% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39, at least 75% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39, at least 80% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39, at least 85% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39, at least 90% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39 or at least 95% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-18 comprises a polypeptide having, e.g., at most 70% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39, at most 75% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39, at most 80% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39, at most 85% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39, at most 90% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39 or at most 95% amino acid identity with amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39.
[0683] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-18 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid substitutions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-18 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid substitutions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39. In other aspects of this embodiment, a non-contiguous amino acid substitution of any amino acid from amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39 can be replaced with glycine. In other aspects of this embodiment, a non-contiguous amino acid substitution of any hydrophobic amino acid from amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-18 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid deletions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-18 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid deletions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-18 comprises a polypeptide having, e.g., at most one, two, three or four non-contiguous amino acid additions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-18 comprises a polypeptide having, e.g., at least one, two, three or four non-contiguous amino acid additions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39.
[0684] In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-18 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid substitutions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-18 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid substitutions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39. In other aspects of this embodiment, contiguous amino acid substitutions of amino acids from amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39 can be replaced with glycine. In other aspects of this embodiment, contiguous amino acid substitutions of hydrophobic amino acids from amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39 can be replaced with phenylalanine. In yet other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-18 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid deletions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-18 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid deletions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39. In still other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-18 comprises a polypeptide having, e.g., at most one, two, three or four contiguous amino acid additions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39. In other aspects of this embodiment, a β-trefoil domain with enhanced binding activity derived from a FGF-18 comprises a polypeptide having, e.g., at least one, two, three or four contiguous amino acid additions relative to amino acids 92-94 or amino acids 135-137 of SEQ ID NO: 39.
[0685] Because of the modular nature of the β-trefoil domain, it is envisioned that any combination of α-folds, β-folds, γ-folds, β4/β5 β-hairpin turns, β8/β9 β-hairpin turns, or any combination thereof from a β-trefoil domain of a Clostridial toxin binding domain, a β-trefoil domain of a modified Clostridial toxin binding domain, a β-trefoil domain of a NAP or a β-trefoil domain, a β-trefoil domain of a modified NAP, a β-trefoil domain of an FGF ligand, a β-trefoil domain of a modified FGF ligand, or any combination thereof, can be used to practice aspect of the present invention. As a non-limiting example, a modified Clostridial toxin disclosed in the present specification can comprise an enhanced targeting domain comprising a α-fold from a BoNT/A binding domain, a β-fold from a FGF-18 and a 2γ-fold from a Clostridial botulinum serotype A HA-33. As another non-limiting example, a modified Clostridial toxin disclosed in the present specification can comprise an enhanced targeting domain comprising a α-fold from a Clostridial botulinum serotype A HA-17, a β-fold from a Clostridial botulinum serotype E NTNH and a γ-fold from a modified BoNT/C1 binding domain with enhanced binding activity.
[0686] In another aspect of the invention, a modified Clostridial toxin with enhanced binding activity comprises, in part, a protease cleavage site is located within a di-chain loop region. As used herein, the term "di-chain loop region" means the amino acid sequence of a Clostridial toxin containing a protease cleavage site used to convert the single-chain form of a Clostridial toxin into the di-chain form. Non-limiting examples of a Clostridial toxin di-chain loop region, include, a di-chain loop region of BoNT/A comprising amino acids 430-454 of SEQ ID NO: 1; a di-chain loop region of BoNT/B comprising amino acids 437-446 of SEQ ID NO: 2; a di-chain loop region of BoNT/C1 comprising amino acids 437-453 of SEQ ID NO: 3; a di-chain loop region of BoNT/D comprising amino acids 437-450 of SEQ ID NO: 4; a di-chain loop region of BoNT/E comprising amino acids 412-426 of SEQ ID NO: 5; a di-chain loop region of BoNT/F comprising amino acids 429-445 of SEQ ID NO: 6; a di-chain loop region of BoNT/G comprising amino acids 436-450 of SEQ ID NO: 7; and a di-chain loop region of TeNT comprising amino acids 439-467 of SEQ ID NO: 8 (Table 8).
TABLE-US-00008 TABLE 8 Di-chain Loop Region of Clostridial Toxins SEQ Di-chain Loop Region Containing ID Light Chain the Naturally-occurring Heavy Chain Toxin NO: Region Protease Cleavage Site Region BoNT/A 1 NMNFTKLKNFTGLFEFYKLL CVRGIITSKTKSLDKGYNK*----ALNDLC IKVNNWDL BoNT/B 2 KQAYEEISKEHLAVYKIQM CKSVK*-------------------APGIC IDVDNEDL BoNT/C1 3 PALRKVNPENMLYLFTKF CHKAIDGRSLYNK*------------TLDC RELLVKNTDL BoNT/D 4 PALQKLSSESVVDLFTKV CLRLTKNSR*---------------DDSTC IKVKNNRL BoNT/E 5 IITPITGRGLVKKIIRF CKNIVSVKGIR*--------------KSIC IEINNGEL BoNT/F 6 IIDSIPDKGLVEKIVKF CKSVIPRKGTK*------------APPRLC IRVNNSEL BoNT/G 7 KEAYEEISLEHLVIYRIAM CKPVMYKNTGK*--------------SEQC IIVNNEDL TeNT 8 TNAFRNVDGSGLVSKLIGL CKKIIPPTNIRENLYNRTA*SLTDLGGELC IKIKNEDL The amino acid sequence displayed are as follows: BoNT/A, residues 325-462 of SEQ ID No: 1; BoNT/B, residues 332-454 of SEQ ID No: 2; BoNT/C1, residues 334-463 of SEQ ID No: 3; BoNT/D, residues 334-458 of SEQ ID No: 4; BoNT/E, residues 311-434 of SEQ ID No: 5; BoNT/F, residues 328-453 of SEQ ID No: 6; BoNT/G, residues 331-458 of SEQ ID No: 7; and TeNT, residues 334-474 of SEQ ID No: 8. An asterisks (*) indicates a peptide bond that is cleaved by a Clostridial toxin protease.
[0687] In is envisioned that any and all protease cleavage sites can be used to convert the single-chain polypeptide form of a Clostridial toxin into the di-chain form, including, without limitation, endogenous di-chain loop protease cleavage sites and exogenous protease cleavage sites. The location and kind of protease cleavage site may be critical because certain targeting domains require a free amino-terminal or carboxyl-terminal amino acid. For example, when a targeting domain is placed between two other domains, e.g., see FIG. 5, a criteria for selection of a protease cleavage site could be whether the protease that cleaves its site leaves a flush cut, exposing the free amino-terminal or carboxyl-terminal of the altered targeting domain necessary for selective binding of the targeting domain to its receptor. The selection and placement of a protease cleavage site is well known in the art.
[0688] As used herein, the term "endogenous di-chain loop protease cleavage site" is synonymous with a "naturally occurring di-chain loop protease cleavage site" and means a naturally occurring protease cleavage site found within the di-chain loop region of a naturally occurring Clostridial toxin and includes, without limitation, naturally occurring Clostridial toxin di-chain loop protease cleavage site variants, such as, e.g., Clostridial toxin di-chain loop protease cleavage site isoforms and Clostridial toxin di-chain loop protease cleavage site subtypes. Non-limiting examples of an endogenous protease cleavage site, include, e.g., a BoNT/A di-chain loop protease cleavage site, a BoNT/B di-chain loop protease cleavage site, a BoNT/C1 di-chain loop protease cleavage site, a BoNT/D di-chain loop protease cleavage site, a BoNT/E di-chain loop protease cleavage site, a BoNT/F di-chain loop protease cleavage site, a BoNT/G di-chain loop protease cleavage site and a TeNT di-chain loop protease cleavage site.
[0689] As mentioned above, Clostridial toxins are translated as a single-chain polypeptide of approximately 150 kDa that is subsequently cleaved by proteolytic scission within a disulfide loop by a naturally-occurring protease. This posttranslational processing yields a di-chain molecule comprising an approximately 50 kDa light chain (LC) and an approximately 100 kDa heavy chain (HC) held together by a single disulphide bond and noncovalent interactions. While the identity of the protease is currently unknown, the di-chain loop protease cleavage site for many Clostridial toxins has been proposed. In BoNTs, cleavage at K448-A449 converts the single polypeptide form of BoNT/A into the di-chain form; cleavage at K441-A442 converts the single polypeptide form of BoNT/B into the di-chain form; cleavage at K449-T450 converts the single polypeptide form of BoNT/C1 into the di-chain form; cleavage at R445-D446 converts the single polypeptide form of BoNT/D into the di-chain form; cleavage at R422-K423 converts the single polypeptide form of BoNT/E into the di-chain form; cleavage at K439-A440 converts the single polypeptide form of BoNT/F into the di-chain form; and cleavage at K446-5447 converts the single polypeptide form of BoNT/G into the di-chain form. Proteolytic cleavage of the single polypeptide form of TeNT at A457-5458 results in the di-chain form. Such a di-chain loop protease cleavage site is operably-linked in-frame to a modified Clostridial toxin as a fusion protein.
[0690] However, it should also be noted that additional cleavage sites within the di-chain loop also appear to be cleaved resulting in the generation of a small peptide fragment being lost. As a non-limiting example, BoNT/A single-chain polypeptide cleave ultimately results in the loss of a ten amino acid fragment within the di-chain loop. Thus, in BoNTs, cleavage at 5441-L442 converts the single polypeptide form of BoNT/A into the di-chain form; cleavage at G444-I445 converts the single polypeptide form of BoNT/B into the di-chain form; cleavage at S445-L446 converts the single polypeptide form of BoNT/C1 into the di-chain form; cleavage at K442-N443 converts the single polypeptide form of BoNT/D into the di-chain form; cleavage at K419-G420 converts the single polypeptide form of BoNT/E into the di-chain form; cleavage at K423-5424 converts the single polypeptide form of BoNT/E into the di-chain form; cleavage at K436-G437 converts the single polypeptide form of BoNT/F into the di-chain form; cleavage at T444-G445 converts the single polypeptide form of BoNT/G into the di-chain form; and cleavage at E448-Q449 converts the single polypeptide form of BoNT/G into the di-chain form.
[0691] Thus, in an embodiment, a protease cleavage site comprising an endogenous Clostridial toxin di-chain loop protease cleavage site is used to convert the single-chain toxin into the di-chain form. In aspects of this embodiment, conversion into the di-chain form by proteolytic cleavage occurs from a site comprising, e.g., a BoNT/A di-chain loop protease cleavage site, a BoNT/B di-chain loop protease cleavage site, a BoNT/C1 di-chain loop protease cleavage site, a BoNT/D di-chain loop protease cleavage site, a BoNT/E di-chain loop protease cleavage site, a BoNT/F di-chain loop protease cleavage site, a BoNT/G di-chain loop protease cleavage site or a TeNT di-chain loop protease cleavage site.
[0692] In other aspects of this embodiment, conversion into the di-chain form by proteolytic cleavage occurs from a site comprising, e.g., a di-chain loop region of BoNT/A comprising amino acids 430-454 of SEQ ID NO: 1; a di-chain loop region of BoNT/B comprising amino acids 437-446 of SEQ ID NO: 2; a di-chain loop region of BoNT/C1 comprising amino acids 437-453 of SEQ ID NO: 3; a di-chain loop region of BoNT/D comprising amino acids 437-450 of SEQ ID NO: 4; a di-chain loop region of BoNT/E comprising amino acids 412-426 of SEQ ID NO: 5; a di-chain loop region of BoNT/F comprising amino acids 429-445 of SEQ ID NO: 6; a di-chain loop region of BoNT/G comprising amino acids 436-450 of SEQ ID NO: 7; or a di-chain loop region of TeNT comprising amino acids 439-467 of SEQ ID NO: 8.
[0693] It is also envisioned that an exogenous protease cleavage site can be used to convert the single-chain polypeptide form of a modified Clostridial toxin disclosed in the present specification into the di-chain form. As used herein, the term "exogenous protease cleavage site" is synonymous with a "non-naturally occurring protease cleavage site" and means a protease cleavage site that is not normally present in a di-chain loop region from a naturally occurring Clostridial toxin. Non-limiting examples of exogenous protease cleavage sites include, e.g., an enterokinase cleavage site (Table 9); a Thrombin cleavage site (Table 9); a Factor Xa cleavage site (Table 9); a human rhinovirus 3C protease cleavage site (Table 9); a tobacco etch virus (TEV) protease cleavage site (Table 9); a dipeptidyl aminopeptidase cleavage site; a small ubiquitin-like modifier (SUMO)/ubiquitin-like protein-1 (ULP-1) protease cleavage site, such as, e.g., MADSEVNQEAKPEVKPEVKPETH INLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGK EMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG (SEQ ID. NO: 57); and a Clostridial toxin substrate cleavage site.
TABLE-US-00009 TABLE 9 Exogenous Protease Cleavage Sites Protease Cleavage Non-limiting SEQ ID Site Consensus Sequence Examples NO: Bovine enterokinase DDDDK* DDDDK* 40 Tobacco Etch Virus E P5 P4YP2Q*(G/S), ENLYFQ*G 41 (TEV) where P2, P4 and P5 can be any ENLYFQ*S 42 amino acid ENIYTQ*G 43 ENIYTQ*S 44 ENIYLQ*G 45 ENIYLQ*S 46 ENVYFQ*G 47 ENVYSQ*S 48 ENVYSQ*G 49 ENVYSQ*S 50 Human Rhinovirus 3C P5P4LFQ*GP EALFQ*GP 51 where P4 is G, A, V, L, I, M, EVLFQ*GP 52 S or T and P5 can any amino ELLFQ*GP 53 acid, with D or E preferred. DALFQ*GP 54 DVLFQ*GP 55 DLLFQ*GP 56 SUMO/ULP-1 Tertiary structure polypeptide-G* 57 Thrombin P3P2(R/K)*P1', GVR*G 58 where P3 is any amino acid and SAR*G 59 P2 or P1 is G with the other SLR*G 60 position being any amino acid DGR*I 61 QGK*I 62 Thrombin P4P3P(R/K)*P1'P2' LVPR*GS 63 where P1' and P2' can be any LVPK*GS 64 amino acid except for acidic FIPR*TF 65 amino acids like D or E; and VLPR*SF 66 P3 and P4 are hydrophobic IVPR*SF 67 amino acids like F, L, I, Y, IVPR*GY 68 W, V, M, P, C or A VVPR*GV 69 VLPR*LI 70 VMPR*SL 71 MFPR*SL 72 Coagulation Factor I(E/D)GR* IDGR* 73 Xa IEGR* 74 An asterisks (*) indicates the peptide bond that is cleaved by the indicated protease.
[0694] As mentioned above, a Clostridial toxin is converted from a single polypeptide form into a di-chain molecule by proteolytic cleavage. While the naturally-occurring protease is currently not known, cleavage occurs within the di-chain loop region between the two cysteine residues that form the disulfide bridge (see Table 8). Replacement of an endogenous protease cleavage site with an exogenous protease cleavage site will enable cleavage of a modified Clostridial toxin disclosed in the present specification when expressed in an organism that does not produce the naturally-occurring protease used to cleave the di-chain loop region of a toxin. Similarly, an addition of an exogenous protease cleavage site in the di-chain loop region will also enable cleavage of a modified Clostridial toxin disclosed in the present specification when expressed in an organism that does not produce the naturally-occurring protease used to cleave the di-chain loop region of a toxin.
[0695] It is envisioned that an exogenous protease cleavage site of any and all lengths can be useful in aspects of the present invention with the proviso that the exogenous protease cleavage site is capable of being cleaved by its respective protease. Thus, in aspects of this embodiment, an exogenous protease cleavage site can be, e.g., at least 6 amino acids in length, at least 7 amino acids in length, at least 8 amino acids in length, at least 9 amino acids in length, at least 10 amino acids in length, at least 15 amino acids in length, at least 20 amino acids in length, at least 25 amino acids in length, at least 30 amino acids in length, at least 40 amino acids in length, at least 50 amino acids in length or at least 60 amino acids in length. In other aspects of this embodiment, an exogenous protease cleavage site can be, e.g., at most 6 amino acids in length, at most 7 amino acids in length, at most 8 amino acids in length, at most 9 amino acids in length, at most 10 amino acids in length, at most 15 amino acids in length, at most 20 amino acids in length, at most 25 amino acids in length, at most 30 amino acids in length, at most 40 amino acids in length, at most 50 amino acids in length or at most 60 amino acids in length.
[0696] In aspects of this embodiment, a di-chain loop region can be modified to substitute a naturally-occurring protease cleavage site for an exogenous protease cleavage site. In this type of modification, the naturally-occurring protease cleavage site is made inoperable and thus can not be cleaved by its protease. Only the exogenous protease cleavage site can be cleaved by its corresponding exogenous protease. In this type of modification, the exogenous protease site is operably-linked in-frame to a modified Clostridial toxin as a fusion protein and the site can be cleaved by its respective exogenous protease. As a non-limiting example, a single-chain modified BoNT/A comprising an exogenous protease cleavage site in the di-chain loop region can be cleaved by its respective exogenous protease to produce the di-chain form of the toxin.
[0697] In other aspects of this embodiment, a di-chain loop region can be modified to include an exogenous protease cleavage site in addition to the naturally-occurring protease cleavage site. In this type of modification, both cleavage sites are operably-linked in-frame to a modified Clostridial toxin as a fusion protein and both sites can be cleaved by their respective proteases. As a non-limiting example, a single-chain modified BoNT/A that comprises a di-chain loop containing both the naturally-occurring BoNT/A di-chain loop protease cleavage site and an exogenous protease cleavage site can be cleaved by either the naturally occurring di-chain loop protease or by the appropriate exogenous protease to produce the di-chain form of the toxin.
[0698] A naturally-occurring protease cleavage site can be made inoperable by altering at least the two amino acids flanking the peptide bond cleaved by the naturally-occurring di-chain loop protease. More extensive alterations can be made, with the proviso that the two cysteine residues of the di-chain loop region remain intact and can still form the disulfide bridge. Non-limiting examples of an amino acid alteration include deletion of an amino acid or replacement of the original amino acid with a different amino acid. Thus, in one embodiment, a naturally-occurring protease cleavage site is made inoperable by altering the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease. In other aspects of this embodiment, a naturally-occurring protease cleavage site is made inoperable by altering, e.g., at least three amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at least four amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at least five amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at least six amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at least seven amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at least eight amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at least nine amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at least ten amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at least 15 amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; or at least 20 amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease.
[0699] In still other aspects of this embodiment, a naturally-occurring di-chain protease cleavage site is made inoperable by altering, e.g., at most three amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at most four amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at most five amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at most six amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at most seven amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at most eight amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at most nine amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at most ten amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; at most 15 amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease; or at most 20 amino acids including the two amino acids flanking the peptide bond cleaved by a naturally-occurring protease.
[0700] In an embodiment, an exogenous protease cleavage site is located within the di-chain loop of a modified Clostridial toxin. In aspects of this embodiment, a modified Clostridial toxin comprises an exogenous protease cleavage site comprises, e.g., a bovine enterokinase protease cleavage site, a Tobacco Etch Virus protease cleavage site, a Human Rhinovirus 3C protease cleavage site, a SUMO/ULP-1 protease cleavage site, a Thrombin protease cleavage site or a Factor Xa protease cleavage site. In other aspects of this embodiment, an exogenous protease cleavage site is located within the di-chain loop of, e.g., a modified BoNT/A, a modified BoNT/B, a modified BoNT/C1, a modified BoNT/D, a modified BoNT/E, a modified BoNT/F, a modified BoNT/G or a modified TeNT.
[0701] In an aspect of this embodiment, an exogenous protease cleavage site can be, e.g., a bovine enterokinase cleavage site is located within the di-chain loop of a modified Clostridial toxin. In other aspects of the embodiment, an exogenous protease cleavage site can be, e.g., a bovine enterokinase protease cleavage site located within the di-chain loop of a modified Clostridial toxin comprises SEQ ID NO: 40. Is still other aspects of this embodiment, a bovine enterokinase protease cleavage site is located within the di-chain loop of, e.g., a modified BoNT/A, a modified BoNT/B, a modified BoNT/C1, a modified BoNT/D, a modified BoNT/E, a modified BoNT/F, a modified BoNT/G or a modified TeNT.
[0702] In another aspect of this embodiment, an exogenous protease cleavage site can be, e.g., a Tobacco Etch Virus protease cleavage site is located within the di-chain loop of a modified Clostridial toxin. In other aspects of the embodiment, an exogenous protease cleavage site can be, e.g., a Tobacco Etch Virus protease cleavage site located within the di-chain loop of a modified Clostridial toxin comprises SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49 or SEQ ID NO: 50. Is still other aspects of this embodiment, a Tobacco Etch Virus protease cleavage site is located within the di-chain loop of, e.g., a modified BoNT/A, a modified BoNT/B, a modified BoNT/C1, a modified BoNT/D, a modified BoNT/E, a modified BoNT/F, a modified BoNT/G or a modified TeNT.
[0703] In still another aspect of this embodiment, an exogenous protease cleavage site can be, e.g., a Human Rhinovirus 3C protease cleavage site is located within the di-chain loop of a modified Clostridial toxin. In other aspects of the embodiment, an exogenous protease cleavage site can be, e.g., a Human Rhinovirus 3C protease cleavage site located within the di-chain loop of a modified Clostridial toxin comprises SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55 or SEQ ID NO: 56. Is still other aspects of this embodiment, a Human Rhinovirus 3C protease cleavage site is located within the di-chain loop of, e.g., a modified BoNT/A, a modified BoNT/B, a modified BoNT/C1, a modified BoNT/D, a modified BoNT/E, a modified BoNT/F, a modified BoNT/G or a modified TeNT.
[0704] In yet another aspect of this embodiment, an exogenous protease cleavage site can be, e.g., a SUMO/ULP-1 protease cleavage site is located within the di-chain loop of a modified Clostridial toxin. In other aspects of the embodiment, an exogenous protease cleavage site can be, e.g., a SUMO/ULP-1 protease cleavage site located within the di-chain loop of a modified Clostridial toxin comprises SEQ ID NO: 57. Is still other aspects of this embodiment, a SUMO/ULP-1 protease cleavage site is located within the di-chain loop of, e.g., a modified BoNT/A, a modified BoNT/B, a modified BoNT/C1, a modified BoNT/D, a modified BoNT/E, a modified BoNT/F, a modified BoNT/G or a modified TeNT.
[0705] In a further aspect of this embodiment, an exogenous protease cleavage site can be, e.g., a Thrombin protease cleavage site is located within the di-chain loop of a modified Clostridial toxin. In other aspects of the embodiment, an exogenous protease cleavage site can be, e.g., a Thrombin protease cleavage site located within the di-chain loop of a modified Clostridial toxin comprises SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, SEQ ID NO: 70, SEQ ID NO: 71 or SEQ ID NO: 72. Is still other aspects of this embodiment, a Thrombin protease cleavage site is located within the di-chain loop of, e.g., a modified BoNT/A, a modified BoNT/B, a modified BoNT/C1, a modified BoNT/D, a modified BoNT/E, a modified BoNT/F, a modified BoNT/G or a modified TeNT.
[0706] In another aspect of this embodiment, an exogenous protease cleavage site can be, e.g., a Coagulation Factor Xa protease cleavage site is located within the di-chain loop of a modified Clostridial toxin. In other aspects of the embodiment, an exogenous protease cleavage site can be, e.g., a Coagulation Factor Xa protease cleavage site located within the di-chain loop of a modified Clostridial toxin comprises SEQ ID NO: 73 or SEQ ID NO: 74. Is still other aspects of this embodiment, a Coagulation Factor Xa protease cleavage site is located within the di-chain loop of, e.g., a modified BoNT/A, a modified BoNT/B, a modified BoNT/C1, a modified BoNT/D, a modified BoNT/E, a modified BoNT/F, a modified BoNT/G or a modified TeNT.
[0707] In another embodiment, an exogenous protease site comprises a Clostridial toxin substrate cleavage site. As used herein, the term "Clostridial toxin substrate cleavage site" means a scissile bond together with adjacent or non-adjacent recognition elements, or both, sufficient for detectable proteolysis at the scissile bond by a Clostridial toxin under conditions suitable for Clostridial toxin protease activity. By definition, a Clostridial toxin substrate cleavage site is susceptible to cleavage by at least one Clostridial toxin under conditions suitable for Clostridial toxin protease activity. Non-limiting examples of Clostridial toxin substrate cleavage site are disclosed in, e.g., Steward, L. E. et al., Self-Activating Clostridial Toxins, U.S. Patent Application 60/718,616 (Sep., 19, 2005).
[0708] It is understood that a modified Clostridial toxin disclosed in the present specification can optionally include one or more additional components. As a non-limiting example of an optional component, a modified Clostridial toxin can further comprise a flexible region comprising a flexible spacer. Non-limiting examples of a flexible spacer include, e.g., a G-spacer GGGGS (SEQ ID NO: 75) or an A-spacer EAAAK (SEQ ID NO: 76). A flexible region comprising flexible spacers can be used to adjust the length of a polypeptide region in order to optimize a characteristic, attribute or property of a polypeptide. Such a flexible region is operably-linked in-frame to the modified Clostridial toxin as a fusion protein. As a non-limiting example, a polypeptide region comprising one or more flexible spacers in tandem can be use to better expose a protease cleavage site thereby facilitating cleavage of that site by a protease. As another non-limiting example, a polypeptide region comprising one or more flexible spacers in tandem can be use to better present an enhanced targeting domain, thereby facilitating the binding of that enhanced targeting domain to its receptor.
[0709] Thus, in an embodiment, a modified Clostridial toxin disclosed in the present specification can further comprise a flexible region comprising a flexible spacer. In another embodiment, a modified Clostridial toxin disclosed in the present specification can further comprise flexible region comprising a plurality of flexible spacers in tandem. In aspects of this embodiment, a flexible region can comprise in tandem, e.g., at least 1 G-spacer, at least 2 G-spacers, at least 3 G-spacers, at least 4 G-spacers or at least 5 G-spacers. In other aspects of this embodiment, a flexible region can comprise in tandem, e.g., at most 1 G-spacer, at most 2 G-spacers, at most 3 G-spacers, at most 4 G-spacers or at most 5 G-spacers. In still other aspects of this embodiment, a flexible region can comprise in tandem, e.g., at least 1 A-spacer, at least 2 A-spacers, at least 3 A-spacers, at least 4 A-spacers or at least 5 A-spacers. In still other aspects of this embodiment, a flexible region can comprise in tandem, e.g., at most 1 A-spacer, at most 2 A-spacers, at most 3 A-spacers, at most 4 A-spacers or at most 5 A-spacers. In another aspect of this embodiment, a modified Clostridial toxin can comprise a flexible region comprising one or more copies of the same flexible spacers, one or more copies of different flexible-spacer regions, or any combination thereof.
[0710] In aspects of this embodiment, a modified Clostridial toxin comprising a flexible spacer can be, e.g., a modified BoNT/A, a modified BoNT/B, a modified BoNT/C1, a modified BoNT/D, a modified BoNT/E, a modified BoNT/F, a modified BoNT/G or a modified TeNT.
[0711] It is envisioned that a modified Clostridial toxin disclosed in the present specification can comprise a flexible spacer in any and all locations with the proviso that modified Clostridial toxin is capable of performing the intoxication process. In aspects of this embodiment, a flexible spacer is positioned between, e.g., an enzymatic domain and a translocation domain, an enzymatic domain and an enhanced targeting domain, an enzymatic domain and a protease cleavage site. In other aspects of this embodiment, a G-spacer is positioned between, e.g., an enzymatic domain and a translocation domain, an enzymatic domain and an enhanced targeting domain, an enzymatic domain and a protease cleavage site. In other aspects of this embodiment, a A-spacer is positioned between, e.g., an enzymatic domain and a translocation domain, an enzymatic domain and an enhanced targeting domain, an enzymatic domain and a protease cleavage site.
[0712] In other aspects of this embodiment, a flexible spacer is positioned between, e.g., an enhanced targeting domain and a translocation domain, an enhanced targeting domain and an enzymatic domain, an enhanced targeting domain and a protease cleavage site. In other aspects of this embodiment, a G-spacer is positioned between, e.g., an enhanced targeting domain and a translocation domain, an enhanced targeting domain and an enzymatic domain, an enhanced targeting domain and a protease cleavage site. In other aspects of this embodiment, a A-spacer is positioned between, e.g., an enhanced targeting domain and a translocation domain, an enhanced targeting domain and an enzymatic domain, an enhanced targeting domain and a protease cleavage site.
[0713] In yet other aspects of this embodiment, a flexible spacer is positioned between, e.g., a translocation domain and an enzymatic domain, an translocation domain and an enhanced targeting domain, an translocation domain and a protease cleavage site. In other aspects of this embodiment, a G-spacer is positioned between, e.g., a translocation domain and an enzymatic domain, an translocation domain and an enhanced targeting domain, an translocation domain and a protease cleavage site. In other aspects of this embodiment, a A-spacer is positioned between, e.g., a translocation domain and an enzymatic domain, an translocation domain and an enhanced targeting domain, a translocation domain and a protease cleavage site.
[0714] As another non-limiting example of an optional component, a modified Clostridial toxin can further comprise an epitope-binding region. An epitope-binding region can be used in a wide variety of procedures involving, e.g., protein purification and protein visualization. Such an epitope-binding region is operably-linked in-frame to a modified Clostridial toxin as a fusion protein. Non-limiting examples of an epitope-binding region include, e.g., FLAG, Express® (SEQ ID NO: 77), human Influenza virus hemagluttinin (HA) (SEQ ID NO: 78), human p62c-Myc protein (c-MYC) (SEQ ID NO: 79), Vesicular Stomatitis Virus Glycoprotein (VSV-G) (SEQ ID NO: 80), Substance P (SEQ ID NO: 81), glycoprotein-D precursor of Herpes simplex virus (HSV) (SEQ ID NO: 82), V5 (SEQ ID NO: 83), AU1 (SEQ ID NO: 84) and AU5 (SEQ ID NO: 85); affinity-binding, such as. e.g., polyhistidine (HIS) (SEQ ID NO: 86), streptavidin binding peptide (strep), and biotin or a biotinylation sequence; peptide-binding regions, such as. e.g., the glutathione binding domain of glutathione-S-transferase, the calmodulin binding domain of the calmodulin binding protein, and the maltose binding domain of the maltose binding protein. Non-limiting examples of specific protocols for selecting, making and using an appropriate binding peptide are described in, e.g., Epitope Tagging, pp. 17.90-17.93 (Sambrook and Russell, eds., Molecular Cloning A Laboratory Manual, Vol. 3, 3rd ed. 2001); Antibodies: A Laboratory Manual (Edward Harlow & David Lane, eds., Cold Spring Harbor Laboratory Press, 2nd ed. 1998); and Using Antibodies: A Laboratory Manual: Portable Protocol No. I (Edward Harlow & David Lane, Cold Spring Harbor Laboratory Press, 1998). In addition, non-limiting examples of binding peptides as well as well-characterized reagents, conditions and protocols are readily available from commercial vendors that include, without limitation, BD Biosciences-Clontech, Palo Alto, Calif.; BD Biosciences Pharmingen, San Diego, Calif.; Invitrogen, Inc, Carlsbad, Calif.; QIAGEN, Inc., Valencia, Calif.; and Stratagene, La Jolla, Calif. These protocols are routine procedures well within the scope of one skilled in the art and from the teaching herein.
[0715] Thus, in an embodiment, a modified Clostridial toxin disclosed in the present specification can further comprise an epitope-binding region. In another embodiment, a modified Clostridial toxin disclosed in the present specification can further comprises a plurality of epitope-binding regions. In aspects of this embodiment, a modified Clostridial toxin can comprise, e.g., at least 1 epitope-binding region, at least 2 epitope-binding regions, at least 3 epitope-binding regions, at least 4 epitope-binding regions or at least 5 epitope-binding regions. In other aspects of this embodiment, a modified Clostridial toxin can comprise, e.g., at most 1 epitope-binding region, at most 2 epitope-binding regions, at most 3 epitope-binding regions, at most 4 epitope-binding regions or at most 5 epitope-binding regions. In another aspect of this embodiment, a modified Clostridial toxin can comprise one or more copies of the same epitope-binding region, one or more copies of different epitope-binding regions, or any combination thereof.
[0716] The location of an epitope-binding region can be in various positions, including, without limitation, at the amino terminus of a modified Clostridial toxin, within a modified Clostridial toxin, or at the carboxyl terminus of a modified Clostridial toxin. Thus, in an embodiment, an epitope-binding region is located at the amino-terminus of a modified Clostridial toxin. In such a location, a start methionine should be placed in front of the epitope-binding region. In addition, it is known in the art that when adding a polypeptide that is operationally-linked to the amino terminus of another polypeptide comprising the start methionine that the original methionine residue can be deleted. This is due to the fact that the added polypeptide will contain a new start methionine and that the original start methionine may reduce optimal expression of the fusion protein. In aspects of this embodiment, an epitope-binding region located at the amino-terminus of a modified Clostridial toxin disclosed in the present specification can be, e.g., a FLAG, Express® epitope-binding region, a human Influenza virus hemagluttinin (HA) epitope-binding region, a human p62c-Myc protein (c-MYC) epitope-binding region, a Vesicular Stomatitis Virus Glycoprotein (VSV-G) epitope-binding region, a Substance P epitope-binding region, a glycoprotein-D precursor of Herpes simplex virus (HSV) epitope-binding region, a V5 epitope-binding region, a AU1 epitope-binding region, a AU5 epitope-binding region, a polyhistidine epitope-binding region, a streptavidin binding peptide epitope-binding region, a biotin epitope-binding region, a biotinylation epitope-binding region, a glutathione binding domain of glutathione-S-transferase, a calmodulin binding domain of the calmodulin binding protein or a maltose binding domain of the maltose binding protein.
[0717] In another embodiment, an epitope-binding region is located at the carboxyl-terminus of a modified Clostridial toxin. In aspects of this embodiment, an epitope-binding region located at the carboxyl-terminus of a modified Clostridial toxin disclosed in the present specification can be, e.g., a FLAG, Express® epitope-binding region, a human Influenza virus hemagluttinin (HA) epitope-binding region, a human p62c-Myc protein (c-MYC) epitope-binding region, a Vesicular Stomatitis Virus Glycoprotein (VSV-G) epitope-binding region, a Substance P epitope-binding region, a glycoprotein-D precursor of Herpes simplex virus (HSV) epitope-binding region, a V5 epitope-binding region, a AU1 epitope-binding region, a AU5 epitope-binding region, a polyhistidine epitope-binding region, a streptavidin binding peptide epitope-binding region, a biotin epitope-binding region, a biotinylation epitope-binding region, a glutathione binding domain of glutathione-S-transferase, a calmodulin binding domain of the calmodulin binding protein or a maltose binding domain of the maltose binding protein.
[0718] It is envisioned that a modified Clostridial toxin disclosed in the present specification can comprise an enhance targeting domain in any and all locations with the proviso that modified Clostridial toxin is capable of performing the intoxication process. Non-limiting examples include, locating an enhance targeting domain at the amino terminus of a modified Clostridial toxin (see FIG. 4); locating an enhance targeting domain between a Clostridial toxin enzymatic domain and a Clostridial toxin translocation domain of a modified Clostridial toxin (see FIG. 5); and locating an enhance targeting domain at the carboxyl terminus of a modified Clostridial toxin (see FIG. 6). The enzymatic domain of naturally-occurring Clostridial toxins contains the native start methionine. Thus, in domain organizations where the enzymatic domain is not in the amino-terminal location an amino acid sequence comprising the start methionine should be placed in front of the amino-terminal domain. Likewise, where the enhanced targeting domain is in the amino-terminal position, an amino acid sequence comprising a start methionine and a protease cleavage site may be operably-linked in situations in which the enhanced targeting domain requires a free amino terminus, see, e.g., Shengwen Li et al., Degradable Clostridial Toxins, International Patent Application Publication WO 2006/026780 (Mar. 9, 2006). In addition, it is known in the art that when adding a polypeptide that is operably-linked to the amino terminus of another polypeptide comprising the start methionine that the original methionine residue can be deleted.
[0719] Thus, in an embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a Clostridial toxin enzymatic domain, a Clostridial toxin translocation domain, a Clostridial toxin translocation facilitating domain and an enhanced targeting domain. In an aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a Clostridial toxin enzymatic domain, a protease cleavage site, a Clostridial toxin translocation domain, a Clostridial toxin translocation facilitating domain and an enhanced targeting domain. In another aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a Clostridial toxin enzymatic domain, an endogenous protease cleavage site, a Clostridial toxin translocation domain, a Clostridial toxin translocation facilitating domain and an enhanced targeting domain. In another aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a Clostridial toxin enzymatic domain, an exogenous protease cleavage site, a Clostridial toxin translocation domain, a Clostridial toxin translocation facilitating domain and an enhanced targeting domain.
[0720] In another embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a Clostridial toxin enzymatic domain, an enhanced targeting domain, a Clostridial toxin translocation domain and a Clostridial toxin translocation facilitating domain. In an aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a Clostridial toxin enzymatic domain, a protease cleavage site, an enhanced targeting domain, a Clostridial toxin translocation domain and a Clostridial toxin translocation facilitating domain. In another aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a Clostridial toxin enzymatic domain, an endogenous protease cleavage site, an enhanced targeting domain, a Clostridial toxin translocation domain and a Clostridial toxin translocation facilitating domain. In another aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a Clostridial toxin enzymatic domain, an exogenous protease cleavage site, an enhanced targeting domain, a Clostridial toxin translocation domain and a Clostridial toxin translocation facilitating domain.
[0721] In another embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising an enhanced targeting domain, a Clostridial toxin translocation domain, a Clostridial toxin translocation facilitating domain and a Clostridial toxin enzymatic domain. In an aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising an enhanced targeting domain, a Clostridial toxin translocation domain, a Clostridial toxin translocation facilitating domain, a protease cleavage site and a Clostridial toxin enzymatic domain. In another aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising an enhanced targeting domain, a Clostridial toxin translocation domain, a Clostridial toxin translocation facilitating domain, an endogenous protease cleavage site and a Clostridial toxin enzymatic domain. In another aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising an enhanced targeting domain, a Clostridial toxin translocation domain, a Clostridial toxin translocation facilitating domain, an exogenous protease cleavage site and a Clostridial toxin enzymatic domain.
[0722] In another embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising an enhanced targeting domain, a Clostridial toxin enzymatic domain, a Clostridial toxin translocation domain and a Clostridial toxin translocation facilitating domain. In an aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising an enhanced targeting domain, a Clostridial toxin enzymatic domain, a protease cleavage site, a Clostridial toxin translocation domain and a Clostridial toxin translocation facilitating domain. In another aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising an enhanced targeting domain, a Clostridial toxin enzymatic domain, an endogenous protease cleavage site, a Clostridial toxin translocation domain and a Clostridial toxin translocation facilitating domain. In another aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising an enhanced targeting domain, a Clostridial toxin enzymatic domain, an exogenous protease cleavage site, a Clostridial toxin translocation domain and a Clostridial toxin translocation facilitating domain.
[0723] In another embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a Clostridial toxin translocation domain, a Clostridial toxin translocation facilitating domain, a Clostridial toxin enzymatic domain and an enhanced targeting domain. In an aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a Clostridial toxin translocation domain, a Clostridial toxin translocation facilitating domain, a protease cleavage site, a Clostridial toxin enzymatic domain and an enhanced targeting domain. In another aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a Clostridial toxin translocation domain, a Clostridial toxin translocation facilitating domain, an endogenous protease cleavage site, a Clostridial toxin enzymatic domain and an enhanced targeting domain. In another aspect of this embodiment, a modified Clostridial toxin can comprise an amino to carboxyl single polypeptide linear order comprising a Clostridial toxin translocation domain, a Clostridial toxin translocation facilitating domain, an exogenous protease cleavage site, a Clostridial toxin enzymatic domain and an enhanced targeting domain.
[0724] Aspects of the present invention provide, in part modified Clostridial toxins. Non-limiting examples of Clostridial toxin modifications disclosed in the present specification include, e.g., addition of an enhanced targeting domain, addition of a protease cleavage site, rearrangement of the enzymatic, translocation and binding domains and addition of a spacer region. It is understood that all such modifications do not substantially affect the ability of a modified Clostridial toxin to intoxicate a cell. As used herein, the term "do not substantially affect" means a modified Clostridial toxin can still execute the overall cellular mechanism whereby a Clostridial toxin enters a neuron and inhibits neurotransmitter release and encompasses the binding of a Clostridial toxin to a low or high affinity receptor complex, the internalization of the toxin/receptor complex, the translocation of the Clostridial toxin light chain into the cytoplasm and the enzymatic modification of a Clostridial toxin substrate. In aspects of this embodiment, the modified Clostridial toxin is, e.g., at least 10% as toxic as a naturally-occurring Clostridial toxin, at least 20% as toxic as a naturally-occurring Clostridial toxin, at least 30% as toxic as a naturally-occurring Clostridial toxin, at least 40% as toxic as a naturally-occurring Clostridial toxin, at least 50% as toxic as a naturally-occurring Clostridial toxin, at least 60% as toxic as a naturally-occurring Clostridial toxin, at least 70% as toxic as a naturally-occurring Clostridial toxin, at least 80% as toxic as a naturally-occurring Clostridial toxin, at least 90% as toxic as a naturally-occurring Clostridial toxin or at least 95% as toxic as a naturally-occurring Clostridial toxin. In aspects of this embodiment, the modified Clostridial toxin is, e.g., at most 10% as toxic as a naturally-occurring Clostridial toxin, at most 20% as toxic as a naturally-occurring Clostridial toxin, at most 30% as toxic as a naturally-occurring Clostridial toxin, at most 40% as toxic as a naturally-occurring Clostridial toxin, at most 50% as toxic as a naturally-occurring Clostridial toxin, at most 60% as toxic as a naturally-occurring Clostridial toxin, at most 70% as toxic as a naturally-occurring Clostridial toxin, at most 80% as toxic as a naturally-occurring Clostridial toxin, at most 90% as toxic as a naturally-occurring Clostridial toxin or at most 95% as toxic as a naturally-occurring Clostridial toxin.
[0725] Another aspect of the present invention provides polynucleotide molecules encoding modified Clostridial toxins disclosed in the present specification. It is envisioned that any and all modified Clostridial toxin disclosed in the present specification can be encoded by a polynucleotide molecule.
[0726] Aspects of the present invention provide, in part polynucleotide molecules. As used herein, the term "polynucleotide molecule" is synonymous with "nucleic acid molecule" and means a polymeric form of nucleotides, such as, e.g., ribonucleotides and deoxyribonucleotides, of any length. It is envisioned that any and all polynucleotide molecules that can encode a modified Clostridial toxin disclosed in the present specification can be useful, including, without limitation naturally-occurring and non-naturally-occurring DNA molecules and naturally-occurring and non-naturally-occurring RNA molecules. Non-limiting examples of naturally-occurring and non-naturally-occurring DNA molecules include single-stranded DNA molecules, double-stranded DNA molecules, genomic DNA molecules, cDNA molecules, vector constructs, such as, e.g., plasmid constructs, phagmid constructs, bacteriophage constructs, retroviral constructs and artificial chromosome constructs. Non-limiting examples of naturally-occurring and non-naturally-occurring RNA molecules include single-stranded RNA, double stranded RNA and mRNA.
[0727] Thus, in an embodiment, a polynucleotide molecule encodes a modified Clostridial toxin disclosed in the present specification.
[0728] In another embodiment, a polynucleotide molecule encodes, in part, a modified Clostridial toxin comprising a Clostridial toxin enzymatic domain disclosed in the present specification. In an aspect of this embodiment, a polynucleotide molecule encoding a modified Clostridial toxin enzymatic domain comprises a naturally occurring Clostridial toxin enzymatic domain variant, such as, e.g., a Clostridial toxin enzymatic domain isoform or a Clostridial toxin enzymatic domain subtype. In another aspect of this embodiment, a polynucleotide molecule encoding a Clostridial toxin enzymatic domain comprises a non-naturally occurring Clostridial toxin enzymatic domain variant, such as, e.g., a conservative Clostridial toxin enzymatic domain variant, a non-conservative Clostridial toxin enzymatic domain variant or an active Clostridial toxin enzymatic domain fragment, or any combination thereof. In other aspects of this embodiment, a polynucleotide molecule encoding a Clostridial toxin enzymatic domain comprises a BoNT/A enzymatic domain, a BoNT/B enzymatic domain, a BoNT/C1 enzymatic domain, a BoNT/D enzymatic domain, a BoNT/E enzymatic domain, a BoNT/F enzymatic domain, a BoNT/G enzymatic domain, a TeNT enzymatic domain, or active fragment thereof.
[0729] In another embodiment, a polynucleotide molecule encodes, in part, a modified Clostridial toxin comprising a Clostridial toxin translocation domain disclosed in the present specification. In an aspect of this embodiment, a polynucleotide molecule encoding a modified Clostridial toxin translocation domain comprises a naturally occurring Clostridial toxin translocation domain variant, such as, e.g., a Clostridial toxin translocation domain isoform or a Clostridial toxin translocation domain subtype. In another aspect of this embodiment, a polynucleotide molecule encoding a Clostridial toxin translocation domain comprises a non-naturally occurring Clostridial toxin translocation domain variant, such as, e.g., a conservative Clostridial toxin translocation domain variant, a non-conservative Clostridial toxin translocation domain variant or an active Clostridial toxin translocation domain fragment, or any combination thereof. In other aspects of this embodiment, a polynucleotide molecule encoding a Clostridial toxin translocation domain comprises a BoNT/A translocation domain, a BoNT/B translocation domain, a BoNT/C1 translocation domain, a BoNT/D translocation domain, a BoNT/E translocation domain, a BoNT/F translocation domain, a BoNT/G translocation domain, a TeNT translocation domain, or active fragment thereof.
[0730] In another embodiment, a polynucleotide molecule encodes, in part, a modified Clostridial toxin comprising a translocation facilitating domain disclosed in the present specification. In an aspect of this embodiment, a polynucleotide molecule encoding a translocation facilitating domain comprises a naturally occurring Clostridial toxin translocation facilitating domain variant, such as, e.g., a Clostridial toxin translocation facilitating domain isoform or a Clostridial toxin translocation facilitating domain subtype. In another aspect of this embodiment, a polynucleotide molecule encoding a translocation facilitating domain comprises a non-naturally occurring Clostridial toxin translocation facilitating domain variant, such as, e.g., a conservative Clostridial toxin translocation facilitating domain variant, a non-conservative Clostridial toxin translocation facilitating domain variant or an active Clostridial toxin translocation facilitating domain fragment, or any combination thereof. In other aspects of this embodiment, a polynucleotide molecule encoding a Clostridial toxin translocation facilitating domain comprises a BoNT/A translocation facilitating domain, a BoNT/B translocation facilitating domain, a BoNT/C1 translocation facilitating domain, a BoNT/D translocation facilitating domain, a BoNT/E translocation facilitating domain, a BoNT/F translocation facilitating domain, a BoNT/G translocation facilitating domain, a TeNT translocation facilitating domain, or active fragment thereof. In yet another aspect of this embodiment, a polynucleotide molecule encoding a translocation domain comprises a naturally occurring enveloped virus fusogenic peptide domain variant, such as, e.g., an enveloped virus fusogenic peptide domain isoform or an enveloped virus fusogenic peptide domain subtype. In another aspect of this embodiment, a polynucleotide molecule encoding a translocation domain comprises a non-naturally occurring enveloped virus fusogenic peptide domain variant, such as, e.g., a conservative enveloped virus fusogenic peptide domain variant, a non-conservative enveloped virus fusogenic peptide domain variant or an active enveloped virus fusogenic peptide domain fragment, or any combination thereof. In other aspects of this embodiment, a polynucleotide molecule encoding an enveloped virus fusogenic peptide domain comprisesan influenzavirus fusogenic peptide domain, an alphavirus fusogenic peptide domain, a vesiculovirus fusogenic peptide domain, a respirovirus fusogenic peptide domain, a morbillivirus fusogenic peptide domain, an avulavirus fusogenic peptide domain, a henipavirus fusogenic peptide domain, a metapneumovirus fusogenic peptide domain, a foamy virus fusogenic peptide domain, or active fragment thereof.
[0731] In another embodiment, a polynucleotide molecule encodes, in part, a modified Clostridial toxin comprising an enhanced targeting domain disclosed in the present specification. In an aspect of this embodiment, a polynucleotide molecule encoding an enhanced targeting domain comprises a modified Clostridial toxin targeting domain with enhanced binding activity disclosed in the present specification. In an aspect of this embodiment, a polynucleotide molecule encoding a modified Clostridial toxin targeting domain with enhanced binding activity comprises a non-naturally occurring Clostridial toxin targeting domain variant with enhanced binding activity, such as, e.g., a conservative Clostridial toxin targeting domain variant with enhanced binding activity, a non-conservative Clostridial toxin targeting domain variant with enhanced binding activity or an active Clostridial toxin targeting domain fragment with enhanced binding activity, or any combination thereof. In other aspects of this embodiment, a polynucleotide molecule encoding a Clostridial toxin targeting domain with enhanced binding activity comprises a BoNT/A targeting domain with enhanced binding activity, a BoNT/B targeting domain with enhanced binding activity, a BoNT/C1 targeting domain with enhanced binding activity, a BoNT/D targeting domain with enhanced binding activity, a BoNT/E targeting domain with enhanced binding activity, a BoNT/F targeting domain with enhanced binding activity, a BoNT/G targeting domain with enhanced binding activity, a TeNT targeting domain with enhanced binding activity, or active fragment thereof.
[0732] In an aspect of this embodiment, an enhanced targeting domain comprises a Clostridial NAP disclosed in the present specification. In an aspect of this embodiment, a polynucleotide molecule encoding a Clostridial NAP comprises a naturally occurring Clostridial NAP variant, such as, e.g., a Clostridial NAP isoform or a Clostridial NAP subtype. In an aspect of this embodiment, a polynucleotide molecule encoding a NAP comprises a non-naturally occurring Clostridial NAP variant, such as, e.g., a conservative Clostridial NAP variant, a non-conservative Clostridial NAP variant or an active Clostridial NAP fragment, or any combination thereof. In other aspects of this embodiment, a polynucleotide molecule encoding a Clostridial NAP comprises a Clostridial botulinum serotype A HA-33, a Clostridial botulinum serotype B HA-33, a Clostridial botulinum serotype C1 HA-33, a Clostridial botulinum serotype D HA-33, a Clostridial botulinum serotype A HA-17, a Clostridial botulinum serotype B HA-17, a Clostridial botulinum serotype C1 HA-17, a Clostridial botulinum serotype D HA-17, a Clostridial botulinum serotype A NTNH, a Clostridial botulinum serotype B NTNH, a Clostridial botulinum serotype C1 NTNH, a Clostridial botulinum serotype D NTNH, a Clostridial botulinum serotype E NTNH, a Clostridial botulinum serotype F NTNH and a Clostridial botulinum serotype G NTNH.
[0733] In an aspect of this embodiment, an enhanced targeting domain comprises a Clostridial NAP with enhanced binding activity disclosed in the present specification. In an aspect of this embodiment, a polynucleotide molecule encoding a NAP with enhanced binding activity comprises a non-naturally occurring Clostridial NAP variant with enhanced binding activity, such as, e.g., a conservative Clostridial NAP variant with enhanced binding activity, a non-conservative Clostridial NAP variant with enhanced binding activity or an active Clostridial NAP fragment with enhanced binding activity, or any combination thereof. In other aspects of this embodiment, a polynucleotide molecule encoding a Clostridial NAP comprises a Clostridial botulinum serotype A HA-33 with enhanced binding activity, a Clostridial botulinum serotype B HA-33 with enhanced binding activity, a Clostridial botulinum serotype C1 HA-33 with enhanced binding activity, a Clostridial botulinum serotype D HA-33 with enhanced binding activity, a Clostridial botulinum serotype A HA-17 with enhanced binding activity, a Clostridial botulinum serotype B HA-17 with enhanced binding activity, a Clostridial botulinum serotype C1 HA-17 with enhanced binding activity, a Clostridial botulinum serotype D HA-17 with enhanced binding activity, a Clostridial botulinum serotype A NTNH with enhanced binding activity, a Clostridial botulinum serotype B NTNH with enhanced binding activity, a Clostridial botulinum serotype C1 NTNH with enhanced binding activity, a Clostridial botulinum serotype D NTNH with enhanced binding activity, a Clostridial botulinum serotype E NTNH with enhanced binding activity, a Clostridial botulinum serotype F NTNH with enhanced binding activity and a Clostridial botulinum serotype G NTNH with enhanced binding activity.
[0734] In an aspect of this embodiment, an enhanced targeting domain comprises a FGF disclosed in the present specification. In an aspect of this embodiment, a polynucleotide molecule encoding a FGF comprises a naturally occurring FGF variant, such as, e.g., a FGF isoform or a FGF subtype. In an aspect of this embodiment, a polynucleotide molecule encoding a FGF comprises a non-naturally occurring FGF variant, such as, e.g., a conservative FGF variant, a non-conservative FGF variant or an active FGF fragment, or any combination thereof. In other aspects of this embodiment, a polynucleotide molecule encoding a FGF comprises a FGF-1, a FGF-2, a FGF-4, a FGF-8, a FGF-9, a FGF-17 and a FGF-18.
[0735] In an aspect of this embodiment, an enhanced targeting domain comprises a FGF with enhanced binding activity disclosed in the present specification. In an aspect of this embodiment, a polynucleotide molecule encoding a FGF with enhanced binding activity comprises a non-naturally occurring FGF variant with enhanced binding activity, such as, e.g., a conservative FGF variant with enhanced binding activity, a non-conservative FGF variant with enhanced binding activity or an active FGF fragment with enhanced binding activity, or any combination thereof. In other aspects of this embodiment, a polynucleotide molecule encoding a FGF with enhanced binding activity comprises a FGF-1 with enhanced binding activity, a FGF-2 with enhanced binding activity, a FGF-4 with enhanced binding activity, a FGF-8 with enhanced binding activity, a FGF-9 with enhanced binding activity, a FGF-17 with enhanced binding activity and a FGF-18 with enhanced binding activity.
[0736] In another embodiment, a polynucleotide molecule encodes, in part, a modified Clostridial toxin comprising a protease cleavage site disclosed in the present specification. In an aspect of this embodiment, a polynucleotide molecule encoding a protease cleavage site comprises an endogenous Clostridial toxin protease site. In aspects of this embodiment, a polynucleotide molecule encoding an endogenous Clostridial toxin protease site can be, e.g., a BoNT/A di-chain loop protease cleavage site, a BoNT/B di-chain loop protease cleavage site, a BoNT/C1 di-chain loop protease cleavage site, a BoNT/D di-chain loop protease cleavage site, a BoNT/E di-chain loop protease cleavage site, a BoNT/F di-chain loop protease cleavage site, a BoNT/G di-chain loop protease cleavage site or a TeNT di-chain loop protease cleavage site. In another aspect of this embodiment, a polynucleotide molecule encoding a protease cleavage site comprises an exogenous Clostridial toxin protease site. In aspects of this embodiment, a polynucleotide molecule encoding an exogenous Clostridial toxin protease site can be, e.g., a bovine enterokinase protease cleavage site, a Tobacco Etch Virus protease cleavage site, a Human Rhinovirus 3C protease cleavage site, a SUMO/ULP-1 protease cleavage site, a Thrombin protease cleavage site, a Coagulation Factor Xa protease cleavage site or a Clostridial toxin substrate cleavage site, such as, e.g., a BoNT/A substrate cleavage site, a BoNT/B substrate cleavage site, a BoNT/C1 substrate cleavage site, a BoNT/D substrate cleavage site, a BoNT/E substrate cleavage site, a BoNT/F substrate cleavage site, a BoNT/G substrate cleavage site or a TeNT substrate cleavage site.
[0737] In another embodiment, a polynucleotide molecule encodes, in part, a modified Clostridial toxin comprising a flexible spacer disclosed in the present specification. In an aspect of this embodiment, a polynucleotide molecule encoding a flexible spacer can comprise a G-spacer, a A-spacer or any combination thereof.
[0738] In another embodiment, a polynucleotide molecule encodes, in part, a modified Clostridial toxin comprising an epitope-binding region disclosed in the present specification. In an aspect of this embodiment, a polynucleotide molecule encoding an epitope-binding region can comprise a FLAG, Express®, a human Influenza virus hemagluttinin (HA), a human p62c-Myc protein (c-MYC), a Vesicular Stomatitis Virus Glycoprotein (VSV-G), a Substance P, a glycoprotein-D precursor of Herpes simplex virus (HSV), a V5, a AU1, a AU5 (SEQ ID NO: 85), a polyhistidine (HIS), or any combination thereof.
[0739] Well-established molecular biology techniques that may be necessary to make a polynucleotide molecule encoding a modified Clostridial toxin disclosed in the present specification including, but not limited to, procedures involving polymerase chain reaction (PCR) amplification, restriction enzyme reactions, agarose gel electrophoresis, nucleic acid ligation, bacterial transformation, nucleic acid purification, nucleic acid sequencing and recombination-based techniques are routine procedures well within the scope of one skilled in the art and from the teaching herein. Non-limiting examples of specific protocols necessary to make a polynucleotide molecule encoding a modified Clostridial toxin are described in e.g., MOLECULAR CLONING A LABORATORY MANUAL, supra, (2001); and CURRENT PROTOCOLS IN MOLECULAR BIOLOGY (Frederick M. Ausubel et al., eds. John Wiley & Sons, 2004). Additionally, a variety of commercially available products useful for making a polynucleotide molecule encoding a modified Clostridial toxin are widely available. These protocols are routine procedures well within the scope of one skilled in the art and from the teaching herein.
[0740] Another aspect of the present invention provides a method of producing a modified Clostridial toxin disclosed in the present specification, such method comprising the step of expressing a polynucleotide molecule encoding a modified Clostridial toxin in a cell. Another aspect of the present invention provides a method of producing a modified Clostridial toxin disclosed in the present specification, such method comprising the steps of introducing an expression construct comprising a polynucleotide molecule encoding a modified Clostridial toxin into a cell and expressing the expression construct in the cell.
[0741] The methods disclosed in the present specification include, in part, a modified Clostridial toxin. It is envisioned that any and all modified Clostridial toxins disclosed in the present specification can be produced using the methods disclosed in the present specification. It is also envisioned that any and all polynucleotide molecules encoding a modified Clostridial toxins disclosed in the present specification can be useful in producing a modified Clostridial toxins disclosed in the present specification using the methods disclosed in the present specification.
[0742] The methods disclosed in the present specification include, in part, an expression construct. An expression construct comprises a polynucleotide molecule disclosed in the present specification operably-linked to an expression vector useful for expressing the polynucleotide molecule in a cell or cell-free extract. A wide variety of expression vectors can be employed for expressing a polynucleotide molecule encoding a modified Clostridial toxin, including, without limitation, a viral expression vector; a prokaryotic expression vector; eukaryotic expression vectors, such as, e.g., a yeast expression vector, an insect expression vector and a mammalian expression vector; and a cell-free extract expression vector. It is further understood that expression vectors useful to practice aspects of these methods may include those which express a modified Clostridial toxin under control of a constitutive, tissue-specific, cell-specific or inducible promoter element, enhancer element or both. Non-limiting examples of expression vectors, along with well-established reagents and conditions for making and using an expression construct from such expression vectors are readily available from commercial vendors that include, without limitation, BD Biosciences-Clontech, Palo Alto, Calif.; BD Biosciences Pharmingen, San Diego, Calif.; Invitrogen, Inc, Carlsbad, Calif.; EMD Biosciences-Novagen, Madison, Wis.; QIAGEN, Inc., Valencia, Calif.; and Stratagene, La Jolla, Calif. The selection, making and use of an appropriate expression vector are routine procedures well within the scope of one skilled in the art and from the teachings herein.
[0743] Thus, aspects of this embodiment include, without limitation, a viral expression vector operably-linked to a polynucleotide molecule encoding a modified Clostridial toxin; a prokaryotic expression vector operably-linked to a polynucleotide molecule encoding a modified Clostridial toxin; a yeast expression vector operably-linked to a polynucleotide molecule encoding a modified Clostridial toxin; an insect expression vector operably-linked to a polynucleotide molecule encoding a modified Clostridial toxin; and a mammalian expression vector operably-linked to a polynucleotide molecule encoding a modified Clostridial toxin. Other aspects of this embodiment include, without limitation, expression constructs suitable for expressing a modified Clostridial toxin disclosed in the present specification using a cell-free extract comprising a cell-free extract expression vector operably linked to a polynucleotide molecule encoding a modified Clostridial toxin. Other aspects of this embodiment include, without limitation, expression constructs comprising polynucleotide molecules comprising any one of SEQ ID NO: 109 through SEQ ID NO: 132 and SEQ ID NO: 136 through SEQ ID NO: 159. Other aspects of this embodiment include, without limitation, expression constructs comprising polynucleotide molecules encoding a modified Clostridial toxin comprising any one of SEQ ID NO: 85 through SEQ ID NO: 108.
[0744] The methods disclosed in the present specification include, in part, a cell. It is envisioned that any and all cells can be used. Thus, aspects of this embodiment include, without limitation, prokaryotic cells including, without limitation, strains of aerobic, microaerophilic, capnophilic, facultative, anaerobic, gram-negative and gram-positive bacterial cells such as those derived from, e.g., Escherichia coli, Bacillus subtilis, Bacillus lichenifonnis, Bacteroides fragilis, Clostridia perfringens, Clostridia difficile, Caulobacter crescentus, Lactococcus lactis, Methylobacterium extorquens, Neisseria meningirulls, Neisseria meningitidis, Pseudomonas fluorescens and Salmonella typhimurium; and eukaryotic cells including, without limitation, yeast strains, such as, e.g., those derived from Pichia pastoris, Pichia methanolica, Pichia angusta, Schizosaccharomyces pombe, Saccharomyces cerevisiae and Yarrowia lipolytica; insect cells and cell lines derived from insects, such as, e.g., those derived from Spodoptera frugiperda, Trichoplusia ni, Drosophila melanogaster and Manduca sexta; and mammalian cells and cell lines derived from mammalian cells, such as, e.g., those derived from mouse, rat, hamster, porcine, bovine, equine, primate and human. Cell lines may be obtained from the American Type Culture Collection, European Collection of Cell Cultures and the German Collection of Microorganisms and Cell Cultures. Non-limiting examples of specific protocols for selecting, making and using an appropriate cell line are described in e.g., INSECT CELL CULTURE ENGINEERING (Mattheus F. A. Goosen et al. eds., Marcel Dekker, 1993); INSECT CELL CULTURES: FUNDAMENTAL AND APPLIED ASPECTS (J. M. Vlak et al. eds., Kluwer Academic Publishers, 1996); Maureen A. Harrison & Ian F. Rae, GENERAL TECHNIQUES OF CELL CULTURE (Cambridge University Press, 1997); CELL AND TISSUE CULTURE: LABORATORY PROCEDURES (Alan Doyle et al eds., John Wiley and Sons, 1998); R. Ian Freshney, CULTURE OF ANIMAL CELLS: A MANUAL OF BASIC TECHNIQUE (Wiley-Liss, 4th ed. 2000); ANIMAL CELL CULTURE: A PRACTICAL APPROACH (John R. W. Masters ed., Oxford University Press, 3rd ed. 2000); MOLECULAR CLONING A LABORATORY MANUAL, supra, (2001); BASIC CELL CULTURE: A PRACTICAL APPROACH (John M. Davis, Oxford Press, 2nd ed. 2002); and CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, supra, (2004). These protocols are routine procedures within the scope of one skilled in the art and from the teaching herein.
[0745] The methods disclosed in the present specification include, in part, introducing into a cell a polynucleotide molecule. A polynucleotide molecule introduced into a cell can be transiently or stably maintained by that cell. Stably-maintained polynucleotide molecules may be extra-chromosomal and replicate autonomously, or they may be integrated into the chromosomal material of the cell and replicate non-autonomously. It is envisioned that any and all methods for introducing a polynucleotide molecule disclosed in the present specification into a cell can be used. Methods useful for introducing a nucleic acid molecule into a cell include, without limitation, chemical-mediated transfection such as, e.g., calcium phosphate-mediated, diethyl-aminoethyl (DEAE) dextran-mediated, lipid-mediated, polyethyleneimine (PEI)-mediated, polylysine-mediated and polybrene-mediated; physical-mediated transfection, such as, e.g., biolistic particle delivery, microinjection, protoplast fusion and electroporation; and viral-mediated transfection, such as, e.g., retroviral-mediated transfection, see, e.g., Introducing Cloned Genes into Cultured Mammalian Cells, pp. 16.1-16.62 (Sambrook & Russell, eds., Molecular Cloning A Laboratory Manual, Vol. 3, 3rd ed. 2001). One skilled in the art understands that selection of a specific method to introduce an expression construct into a cell will depend, in part, on whether the cell will transiently contain an expression construct or whether the cell will stably contain an expression construct. These protocols are routine procedures within the scope of one skilled in the art and from the teaching herein.
[0746] In an aspect of this embodiment, a chemical-mediated method, termed transfection, is used to introduce a polynucleotide molecule encoding a modified Clostridial toxin into a cell. In chemical-mediated methods of transfection the chemical reagent forms a complex with the nucleic acid that facilitates its uptake into the cells. Such chemical reagents include, without limitation, calcium phosphate-mediated, see, e.g., Martin Jordan & Florian Worm, Transfection of adherent and suspended cells by calcium phosphate, 33(2) Methods 136-143 (2004); diethyl-aminoethyl (DEAE) dextran-mediated, lipid-mediated, cationic polymer-mediated like polyethyleneimine (PEI)-mediated and polylysine-mediated and polybrene-mediated, see, e.g., Chun Zhang et al., Polyethylenimine strategies for plasmid delivery to brain-derived cells, 33(2) Methods 144-150 (2004). Such chemical-mediated delivery systems can be prepared by standard methods and are commercially available, see, e.g., CellPhect Transfection Kit (Amersham Biosciences, Piscataway, N.J.); Mammalian Transfection Kit, Calcium phosphate and DEAE Dextran, (Stratagene, Inc., La Jolla, Calif.); Lipofectamine® Transfection Reagent (Invitrogen, Inc., Carlsbad, Calif.); ExGen 500 Transfection kit (Fermentas, Inc., Hanover, Md.), and SuperFect and Effectene Transfection Kits (Qiagen, Inc., Valencia, Calif.).
[0747] In another aspect of this embodiment, a physical-mediated method is used to introduce a polynucleotide molecule encoding a modified Clostridial toxin into a cell. Physical techniques include, without limitation, electroporation, biolistic and microinjection. Biolistics and microinjection techniques perforate the cell wall in order to introduce the nucleic acid molecule into the cell, see, e.g., Jeike E. Biewenga et al., Plasmid-mediated gene transfer in neurons using the biolistics technique, 71(1) J. Neurosci. Methods. 67-75 (1997); and John O'Brien & Sarah C. R. Lummis, Biolistic and diolistic transfection: using the gene gun to deliver DNA and lipophilic dyes into mammalian cells, 33(2) Methods 121-125 (2004). Electroporation, also termed electropermeabilization, uses brief, high-voltage, electrical pulses to create transient pores in the membrane through which the nucleic acid molecules enter and can be used effectively for stable and transient transfections of all cell types, see, e.g., M. Golzio et al., In vitro and in vivo electric field-mediated permeabilization, gene transfer, and expression, 33(2) Methods 126-135 (2004); and Oliver Greschet al., New non-viral method for gene transfer into primary cells, 33(2) Methods 151-163 (2004).
[0748] In another aspect of this embodiment, a viral-mediated method, termed transduction, is used to introduce a polynucleotide molecule encoding a modified Clostridial toxin into a cell. In viral-mediated methods of transient transduction, the process by which viral particles infect and replicate in a host cell has been manipulated in order to use this mechanism to introduce a nucleic acid molecule into the cell. Viral-mediated methods have been developed from a wide variety of viruses including, without limitation, retroviruses, adenoviruses, adeno-associated viruses, herpes simplex viruses, picornaviruses, alphaviruses and baculoviruses, see, e.g., Armin Blesch, Lentiviral and MLV based retroviral vectors for ex vivo and in vivo gene transfer, 33(2) Methods 164-172 (2004); and Maurizio Federico, From lentiviruses to lentivirus vectors, 229 Methods Mol. Biol. 3-15 (2003); E. M. Poeschla, Non-primate lentiviral vectors, 5(5) Curr. Opin. Mol. Ther. 529-540 (2003); Karim Benihoud et al, Adenovirus vectors for gene delivery, 10(5) Curr. Opin. Biotechnol. 440-447 (1999); H. Bueler, Adeno-associated viral vectors for gene transfer and gene therapy, 380(6) Biol. Chem. 613-622 (1999); Chooi M. Lai et al., Adenovirus and adeno-associated virus vectors, 21(12) DNA Cell Biol. 895-913 (2002); Edward A. Burton et al., Gene delivery using herpes simplex virus vectors, 21(12) DNA Cell Biol. 915-936 (2002); Paola Grandi et al., Targeting HSV amplicon vectors, 33(2) Methods 179-186 (2004); Ilya Frolov et al., Alphavirus-based expression vectors: strategies and applications, 93(21) Proc. Natl. Acad. Sci. U.S.A. 11371-11377 (1996); Markus U. Ehrengruber, Alphaviral gene transfer in neurobiology, 59(1) Brain Res. Bull. 13-22 (2002); Thomas A. Kost & J. Patrick Condreay, Recombinant baculoviruses as mammalian cell gene-delivery vectors, 20(4) Trends Biotechnol. 173-180 (2002); and A. Huser & C. Hofmann, Baculovirus vectors: novel mammalian cell gene-delivery vehicles and their applications, 3(1) Am. J. Pharmacogenomics 53-63 (2003).
[0749] Adenoviruses, which are non-enveloped, double-stranded DNA viruses, are often selected for mammalian cell transduction because adenoviruses handle relatively large polynucleotide molecules of about 36 kb, are produced at high titer, and can efficiently infect a wide variety of both dividing and non-dividing cells, see, e.g., Wim T. J. M. C. Hermens et al., Transient gene transfer to neurons and glia: analysis of adenoviral vector performance in the CNS and PNS, 71(1) J. Neurosci. Methods 85-98 (1997); and Hiroyuki Mizuguchi et al., Approaches for generating recombinant adenovirus vectors, 52β) Adv. Drug Deliv. Rev. 165-176 (2001). Transduction using adenoviral-based system do not support prolonged protein expression because the nucleic acid molecule is carried from an episome in the cell nucleus, rather than being integrated into the host cell chromosome. Adenoviral vector systems and specific protocols for how to use such vectors are disclosed in, e.g., ViraPower® Adenoviral Expression System (Invitrogen, Inc., Carlsbad, Calif.) and ViraPower® Adenoviral Expression System Instruction Manual 25-0543 version A, Invitrogen, Inc., (Jul. 15, 2002); and AdEasy® Adenoviral Vector System (Stratagene, Inc., La Jolla, Calif.) and AdEasy® Adenoviral Vector System Instruction Manual 064004f, Stratagene, Inc.
[0750] Nucleic acid molecule delivery can also use single-stranded RNA retroviruses, such as, e.g., oncoretroviruses and lentiviruses. Retroviral-mediated transduction often produce transduction efficiencies close to 100%, can easily control the proviral copy number by varying the multiplicity of infection (MOI), and can be used to either transiently or stably transduce cells, see, e.g., Tiziana Tonini et al., Transient production of retroviral- and lentiviral-based vectors for the transduction of Mammalian cells, 285 Methods Mol. Biol. 141-148 (2004); Armin Blesch, Lentiviral and MLV based retroviral vectors for ex vivo and in vivo gene transfer, 33(2) Methods 164-172 (2004); Felix Recillas-Targa, Gene transfer and expression in mammalian cell lines and transgenic animals, 267 Methods Mol. Biol. 417-433 (2004); and Roland Wolkowicz et al., Lentiviral vectors for the delivery of DNA into mammalian cells, 246 Methods Mol. Biol. 391-411 (2004). Retroviral particles consist of an RNA genome packaged in a protein capsid, surrounded by a lipid envelope. The retrovirus infects a host cell by injecting its RNA into the cytoplasm along with the reverse transcriptase enzyme. The RNA template is then reverse transcribed into a linear, double stranded cDNA that replicates itself by integrating into the host cell genome. Viral particles are spread both vertically (from parent cell to daughter cells via the provirus) as well as horizontally (from cell to cell via virions). This replication strategy enables long-term persistent expression since the nucleic acid molecules of interest are stably integrated into a chromosome of the host cell, thereby enabling long-term expression of the protein. For instance, animal studies have shown that lentiviral vectors injected into a variety of tissues produced sustained protein expression for more than 1 year, see, e.g., Luigi Naldini et al., In vivo gene delivery and stable transduction of non-dividing cells by a lentiviral vector, 272(5259) Science 263-267 (1996). The Oncoretroviruses-derived vector systems, such as, e.g., Moloney murine leukemia virus (MoMLV), are widely used and infect many different non-dividing cells. Lentiviruses can also infect many different cell types, including dividing and non-dividing cells and possess complex envelope proteins, which allows for highly specific cellular targeting.
[0751] Retroviral vectors and specific protocols for how to use such vectors are disclosed in, e.g., U.S. patent Nos. Manfred Gossen & Hermann Bujard, Tight control of gene expression in eukaryotic cells by tetracycline-responsive promoters, U.S. Pat. No. 5,464,758 (Nov. 7, 1995) and Hermann Bujard & Manfred Gossen, Methods for regulating gene expression, U.S. Pat. No. 5,814,618 (Sep. 29, 1998) David S. Hogness, Polynucleotides encoding insect steroid hormone receptor polypeptides and cells transformed with same, U.S. Pat. No. 5,514,578 (May 7, 1996) and David S. Hogness, Polynucleotide encoding insect ecdysone receptor, U.S. Pat. No. 6,245,531 (Jun. 12, 2001); Elisabetta Vegeto et al., Progesterone receptor having C. terminal hormone binding domain truncations, U.S. Pat. No. 5,364,791 (Nov. 15, 1994), Elisabetta Vegeto et al., Mutated steroid hormone receptors, methods for their use and molecular switch for gene therapy, U.S. Pat. No. 5,874,534 (Feb. 23, 1999) and Elisabetta Vegeto et al., Mutated steroid hormone receptors, methods for their use and molecular switch for gene therapy, U.S. Pat. No. 5,935,934 (Aug. 10, 1999). Furthermore, such viral delivery systems can be prepared by standard methods and are commercially available, see, e.g., BD® Tet-Off and Tet-On Gene Expression Systems (BD Biosciences-Clonetech, Palo Alto, Calif.) and BD® Tet-Off and Tet-On Gene Expression Systems User Manual, PT3001-1, BD Biosciences Clonetech, (Mar. 14, 2003), GeneSwitch® System (Invitrogen, Inc., Carlsbad, Calif.) and GeneSwitch® System A Mifepristone-Regulated Expression System for Mammalian Cells version D, 25-0313, Invitrogen, Inc., (Nov. 4, 2002); ViraPower® Lentiviral Expression System (Invitrogen, Inc., Carlsbad, Calif.) and ViraPower® Lentiviral Expression System Instruction Manual 25-0501 version E, Invitrogen, Inc., (Dec. 8, 2003); and Complete Control® Retroviral Inducible Mammalian Expression System (Stratagene, La Jolla, Calif.) and Complete Control® Retroviral Inducible Mammalian Expression System Instruction Manual, 064005e.
[0752] The methods disclosed in the present specification include, in part, expressing a modified Clostridial toxin from a polynucleotide molecule. It is envisioned that any of a variety of expression systems may be useful for expressing a modified Clostridial toxin from a polynucleotide molecule disclosed in the present specification, including, without limitation, cell-based systems and cell-free expression systems. Cell-based systems include, without limitation, viral expression systems, prokaryotic expression systems, yeast expression systems, baculoviral expression systems, insect expression systems and mammalian expression systems. Cell-free systems include, without limitation, wheat germ extracts, rabbit reticulocyte extracts and E. coli extracts and generally are equivalent to the method disclosed herein. Expression of a polynucleotide molecule using an expression system can include any of a variety of characteristics including, without limitation, inducible expression, non-inducible expression, constitutive expression, viral-mediated expression, stably-integrated expression, and transient expression. Expression systems that include well-characterized vectors, reagents, conditions and cells are well-established and are readily available from commercial vendors that include, without limitation, Ambion, Inc. Austin, Tex.; BD Biosciences-Clontech, Palo Alto, Calif.; BD Biosciences Pharmingen, San Diego, Calif.; Invitrogen, Inc, Carlsbad, Calif.; QIAGEN, Inc., Valencia, Calif.; Roche Applied Science, Indianapolis, Ind.; and Stratagene, La Jolla, Calif. Non-limiting examples on the selection and use of appropriate heterologous expression systems are described in e.g., PROTEIN EXPRESSION. A PRACTICAL APPROACH (S. J. Higgins and B. David Hames eds., Oxford University Press, 1999); Joseph M. Fernandez & James P. Hoeffler, GENE EXPRESSION SYSTEMS. USING NATURE FOR THE ART OF EXPRESSION (Academic Press, 1999); and Meena Rai & Harish Padh, Expression Systems for Production of Heterologous Proteins, 80(9) CURRENT SCIENCE 1121-1128, (2001). These protocols are routine procedures well within the scope of one skilled in the art and from the teaching herein.
[0753] A variety of cell-based expression procedures are useful for expressing a modified Clostridial toxin encoded by polynucleotide molecule disclosed in the present specification. Examples included, without limitation, viral expression systems, prokaryotic expression systems, yeast expression systems, baculoviral expression systems, insect expression systems and mammalian expression systems. Viral expression systems include, without limitation, the ViraPower® Lentiviral (Invitrogen, Inc., Carlsbad, Calif.), the Adenoviral Expression Systems (Invitrogen, Inc., Carlsbad, Calif.), the AdEasy® XL Adenoviral Vector System (Stratagene, La Jolla, Calif.) and the ViraPort® Retroviral Gene Expression System (Stratagene, La Jolla, Calif.). Non-limiting examples of prokaryotic expression systems include the Champion® pET Expression System (EMD Biosciences-Novagen, Madison, Wis.), the TriEx® Bacterial Expression System (EMD Biosciences-Novagen, Madison, Wis.), the QIAexpress® Expression System (QIAGEN, Inc.), and the Affinity® Protein Expression and Purification System (Stratagene, La Jolla, Calif.). Yeast expression systems include, without limitation, the EasySelect® Pichia Expression Kit (Invitrogen, Inc., Carlsbad, Calif.), the YES-Echo® Expression Vector Kits (Invitrogen, Inc., Carlsbad, Calif.) and the SpECTRA® S. pombe Expression System (Invitrogen, Inc., Carlsbad, Calif.). Non-limiting examples of baculoviral expression systems include the BaculoDirect® (Invitrogen, Inc., Carlsbad, Calif.), the BactoBac® (Invitrogen, Inc., Carlsbad, Calif.), and the BD BaculoGold® (BD Biosciences-Pharmigen, San Diego, Calif.). Insect expression systems include, without limitation, the Drosophila Expression System (DES®) (Invitrogen, Inc., Carlsbad, Calif.), InsectSelect® System (Invitrogen, Inc., Carlsbad, Calif.) and InsectDirect® System (EMD Biosciences-Novagen, Madison, Wis.). Non-limiting examples of mammalian expression systems include the T-REx® (Tetracycline-Regulated Expression) System (Invitrogen, Inc., Carlsbad, Calif.), the Flp-In® T-REx® System (Invitrogen, Inc., Carlsbad, Calif.), the pcDNA® system (Invitrogen, Inc., Carlsbad, Calif.), the pSecTag2 system (Invitrogen, Inc., Carlsbad, Calif.), the Exchanger® System, InterPlay® Mammalian TAP System (Stratagene, La Jolla, Calif.), Complete Control® Inducible Mammalian Expression System (Stratagene, La Jolla, Calif.) and LacSwitch® II Inducible Mammalian Expression System (Stratagene, La Jolla, Calif.).
[0754] Another procedure of expressing a modified Clostridial toxin encoded by polynucleotide molecule disclosed in the present specification employs a cell-free expression system such as, without limitation, prokaryotic extracts and eukaryotic extracts. Non-limiting examples of prokaryotic cell extracts include the RTS 100 E. coli HY Kit (Roche Applied Science, Indianapolis, Ind.), the ActivePro In Vitro Translation Kit (Ambion, Inc., Austin, Tex.), the EcoPro® System (EMD Biosciences-Novagen, Madison, Wis.) and the Expressway® Plus Expression System (Invitrogen, Inc., Carlsbad, Calif.). Eukaryotic cell extract include, without limitation, the RTS 100 Wheat Germ CECF Kit (Roche Applied Science, Indianapolis, Ind.), the TnT® Coupled Wheat Germ Extract Systems (Promega Corp., Madison, Wis.), the Wheat Germ IVT® Kit (Ambion, Inc., Austin, Tex.), the Retic Lysate IVT® Kit (Ambion, Inc., Austin, Tex.), the PROTEINscript® II System (Ambion, Inc., Austin, Tex.) and the TnT® Coupled Reticulocyte Lysate Systems (Promega Corp., Madison, Wis.).
[0755] Aspects of the present invention can also be described as follows:
[0756] 1. A modified Clostridial toxin comprising:
[0757] a) a Clostridial toxin enzymatic domain capable of executing an enzymatic target modification step of a Clostridial toxin intoxication process;
[0758] b) a Clostridial toxin translocation domain capable of executing a translocation step of a Clostridial toxin intoxication process;
[0759] c) a translocation facilitating domain capable of facilitating a translocation step of a Clostridial toxin intoxication process;
[0760] d) an enhanced targeting domain comprising a modified Clostridial HCC targeting domain capable of executing a cell binding step of a Clostridial toxin intoxication process; and
[0761] e) a protease cleavage site;
[0762] wherein cleavage of the protease cleavage site converts the single-chain form of the modified Clostridial toxin into the di-chain form; and
[0763] wherein the modified Clostridial HCC targeting domain exhibits enhanced binding activity for an endogenous Clostridial toxin receptor relative to the binding activity of a naturally-occurring Clostridial HCC targeting domain from which the modified Clostridial HCC targeting domain is derived.
[0764] 2. The modified Clostridial toxin according to 1, wherein the modified Clostridial toxin comprises, in a linear amino-to-carboxyl single polypeptide order, the Clostridial toxin enzymatic domain, the protease cleavage site, the Clostridial toxin translocation domain, the translocation facilitating domain and the enhanced targeting domain.
[0765] 3. The modified Clostridial toxin according to 1, wherein the modified Clostridial toxin comprises, in a linear amino-to-carboxyl single polypeptide order, the Clostridial toxin enzymatic domain, the protease cleavage site, the enhanced targeting domain, the Clostridial toxin translocation domain and the translocation facilitating domain.
[0766] 4. The modified Clostridial toxin according to 1, wherein the modified Clostridial toxin comprises, in a linear amino-to-carboxyl single polypeptide order, the enhanced targeting domain, the Clostridial toxin translocation domain, the translocation facilitating domain, the protease cleavage site and the Clostridial toxin enzymatic domain.
[0767] 5. The modified Clostridial toxin according to 1, wherein the modified Clostridial toxin comprises, in a linear amino-to-carboxyl single polypeptide order, the enhanced targeting domain, the Clostridial toxin enzymatic domain, the protease cleavage site, the Clostridial toxin translocation domain and the translocation facilitating domain.
[0768] 6. The modified Clostridial toxin according to 1, wherein the modified Clostridial toxin comprises, in a linear amino-to-carboxyl single polypeptide order, the Clostridial toxin translocation domain, the translocation facilitating domain, the protease cleavage site, the Clostridial toxin enzymatic domain and the enhanced targeting domain.
[0769] 7. The modified Clostridial toxin according to 1, wherein the modified Clostridial toxin comprises, in a linear amino-to-carboxyl single polypeptide order, the Clostridial toxin translocation domain, the translocation facilitating domain, the protease cleavage site, the enhanced targeting domain and the Clostridial toxin enzymatic domain.
[0770] 8. The modified Clostridial toxin according to 1, wherein the Clostridial toxin enzymatic domain is selected from the group consisting of a BoNT/A enzymatic domain, a BoNT/B enzymatic domain, a BoNT/C1 enzymatic domain, a BoNT/D enzymatic domain, a BoNT/E enzymatic domain, a BoNT/F enzymatic domain, a BoNT/G enzymatic domain and a TeNT enzymatic domain.
[0771] 9. The modified Clostridial toxin according to 1, wherein the Clostridial toxin translocation domain is selected from the group consisting of a BoNT/A translocation domain, a BoNT/B translocation domain, a BoNT/C1 translocation domain, a BoNT/D translocation domain, a BoNT/E translocation domain, a BoNT/F translocation domain, a BoNT/G translocation domain and a TeNT translocation domain.
[0772] 10. The modified Clostridial toxin according to 1, wherein the translocation facilitating domain is a Clostridial toxin translocation facilitating domain.
[0773] 11. The modified Clostridial toxin according to 10, wherein the Clostridial toxin translocation facilitating domain is selected from the group consisting of a BoNT/A translocation facilitating domain, a BoNT/B translocation facilitating domain, a BoNT/C1 translocation facilitating domain, a BoNT/D translocation domain, a BoNT/E translocation facilitating domain, a BoNT/F translocation facilitating domain, a BoNT/G translocation facilitating domain and a TeNT translocation facilitating domain.
[0774] 12. The modified Clostridial toxin according to 10, wherein the Clostridial toxin translocation facilitating domain comprises an amino acid sequence selected from the group consisting of amino acids 874-1110 of SEQ ID NO: 1, amino acids 861-1097 of SEQ ID NO: 2, amino acids 869-1111 of SEQ ID NO: 3, amino acids 865-1098 of SEQ ID NO: 4, amino acids 848-1085 of SEQ ID NO: 5, amino acids 867-1105 of SEQ ID NO: 6, amino acids 866-1105 of SEQ ID NO: 7 and amino acid 882-1127 of SEQ ID NO: 8.
[0775] 13. The modified Clostridial toxin according to 1, wherein the translocation facilitating domain is an enveloped virus fusogenic peptide domain.
[0776] 14. The modified Clostridial toxin according to 13, wherein the enveloped virus fusogenic peptide domain is selected from the group consisting of an influenzavirus fusogenic peptide domain, an alphavirus fusogenic peptide domain, a vesiculovirus fusogenic peptide domain, a respirovirus fusogenic peptide domain, a morbillivirus fusogenic peptide domain, an avulavirus fusogenic peptide domain, a henipavirus fusogenic peptide domain, a metapneumovirus fusogenic peptide domain and a foamy virus fusogenic peptide domain.
[0777] 15. The modified Clostridial toxin according to 14, wherein the influenzavirus fusogenic peptide domain is selected from the group consisting of SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 and SEQ ID NO: 91.
[0778] 16. The modified Clostridial toxin according to 14, wherein the alphavirus fusogenic peptide domain is selected from the group consisting of SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 and SEQ ID NO: 118.
[0779] 17. The modified Clostridial toxin according to 14, wherein the vesiculovirus fusogenic peptide domain is selected from the group consisting of SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 and SEQ ID NO: 129.
[0780] 18. The modified Clostridial toxin according to 14, wherein the respirovirus fusogenic peptide domain is selected from the group consisting of SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 and SEQ ID NO: 136.
[0781] 19. The modified Clostridial toxin according to 14, wherein the morbillivirus fusogenic peptide domain is selected from the group consisting of SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 and SEQ ID NO: 146.
[0782] 20. The modified Clostridial toxin according to 14, wherein the avulavirus fusogenic peptide domain is selected from the group consisting of SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 and SEQ ID NO: 159.
[0783] 21. The modified Clostridial toxin according to 14, wherein the henipavirus fusogenic peptide domain is selected from the group consisting of SEQ ID NO: 160 and SEQ ID NO: 161.
[0784] 22. The modified Clostridial toxin according to 14, wherein the metapneumovirus fusogenic peptide domain is SEQ ID NO: 162.
[0785] 23. The modified Clostridial toxin according to 1, wherein the modified Clostridial toxin HCC targeting domain is selected from the group consisting of a modified BoNT/A HCC targeting domain, a modified BoNT/B HCC targeting domain, a modified BoNT/C1 HCC targeting domain, a modified BoNT/D HCC targeting domain, a modified BoNT/E HCC targeting domain, a modified BoNT/F HCC targeting domain, a modified BoNT/G HCC targeting domain and a modified TeNT HCC targeting domain.
[0786] 24. The modified Clostridial toxin according to 23, wherein the modified BoNT/A HCC targeting domain comprises an amino acid substitution at a position selected from the group consisting of Trp 1101, Gly 1102, Leu 1105, Tyr 1111, Tyr 1112, Gly 1158, Ile 1163, Asp 1179, Glu 1203, Phe 1252, Ser 1264, Trp 1266, Tyr 1267, Gln 1270, Gly 1279 and Trp 1282 of SEQ ID NO: 1, and any combination thereof;
[0787] wherein the amino acid substitution enhances the binding activity of the modified BoNT/A HCC targeting domain for a BoNT/A receptor.
[0788] 25. The modified Clostridial toxin according to 23, wherein the modified BoNT/B HCC targeting domain comprises an amino acid substitution at a position selected from the group consisting of Trp 1088, Gly 1089, Leu 1092, Tyr 1098, Tyr 1099, Gly 1142, Ile 1147, Asp 1165, Glu 1191, Ile 1240, Ser 1260, Trp 1262, Tyr 1263, Glu 1266, Gly 1277 and Trp 1280 of SEQ ID NO: 2, and any combination thereof;
[0789] wherein the amino acid substitution enhances the binding activity of the modified BoNT/B HCC targeting domain for a BoNT/B receptor.
[0790] 26. The modified Clostridial toxin according to 23, wherein the modified BoNT/C1 HCC targeting domain comprises an amino acid substitution at a position selected from the group consisting of Trp 1102, Gly 1103, Leu 1106, Tyr 1112, Tyr 1113, Gly 1145, Ile 1150, Asp 1166, Glu 1196, Ile 1247, Gly 1256, Trp 1258, Tyr 1259, H is 1261, Gly 1281 and Trp 1284 of SEQ ID NO: 3, and any combination thereof;
[0791] wherein the amino acid substitution enhances the binding activity of the modified BoNT/C1 HCC targeting domain for a BoNT/C1 receptor.
[0792] 27. The modified Clostridial toxin according to 23, wherein the modified BoNT/D HCC targeting domain comprises an amino acid substitution at a position selected from the group consisting of Trp 1089, Gly 1090, Leu 1093, Tyr 1099, Tyr 1100, Gly 1132, Ile 1137, Asp 1153, Asn 1186, Lys 1236, Trp 1238, Arg 1239, Phe 1242, Ser 1262 and Trp 1265 of SEQ ID NO: 4, and any combination thereof;
[0793] wherein the amino acid substitution enhances the binding activity of the modified BoNT/D HCC targeting domain for a BoNT/D receptor.
[0794] 28. The modified Clostridial toxin according to 23, wherein the modified BoNT/E HCC targeting domain comprises an amino acid substitution at a position selected from the group consisting of Trp 1076, Gly 1077, Leu 1080, Tyr 1086, Tyr 1087, Gly 1124, Ile 1129, Asp 1146, Glu 1172, Phe 1213, Ser 1221, Trp 1223, Tyr 1224, H is 1227, Gly 1236 and Trp 1239 of SEQ ID NO: 5, and any combination thereof;
[0795] wherein the amino acid substitution enhances the binding activity of the modified BoNT/E HCC targeting domain for a BoNT/E receptor.
[0796] 29. The modified Clostridial toxin according to 23, wherein the modified BoNT/F HCC targeting domain comprises an amino acid substitution at a position selected from the group consisting of Trp 1096, Gly 1097, Leu 1100, Tyr 1106, Tyr 1107, Gly 1147, Ile 1152, Asp 1171, Glu 1195, Phe 1237, Ser 1245, Trp 1247, Tyr 1248, Asn 1251, Gly 1260 and Trp 1263 of SEQ ID NO: 6, and any combination thereof;
[0797] wherein the amino acid substitution enhances the binding activity of the modified BoNT/F HCC targeting domain for a BoNT/F receptor.
[0798] 30. The modified Clostridial toxin according to 23, wherein the modified BoNT/G HCC targeting domain comprises an amino acid substitution at a position selected from the group consisting of Trp 1096, Gly 1097, Leu 1100, Tyr 1106, Tyr 1107, Gly 1148, Ile 1153, Asp 1172, Gln 1198, Ile 1245, Ser 1266, Trp 1268, Tyr 1269, Arg 1272, Gly 1283 and Trp 1285 of SEQ ID NO: 7, and any combination thereof;
[0799] wherein the amino acid substitution enhances the binding activity of the modified BoNT/G HCC targeting domain for a BoNT/G receptor.
[0800] 31. The modified Clostridial toxin according to 23, wherein the modified TeNT HCC targeting domain comprises an amino acid substitution at a position selected from the group consisting of Trp 1118, Gly 1119, Leu 1122, Tyr 1128, Tyr 1129, Gly 1172, Ile 1177, Asp 1194, Asp 1222, Thr 1270, Ser 1287, Trp 1289, Tyr 1290, H is 1293, Gly 1300 and Trp 1303 of SEQ ID NO: 8, and any combination thereof;
[0801] wherein the amino acid substitution enhances the binding activity of the modified TeNT HCC targeting domain for a TeNT receptor.
[0802] 32. The modified Clostridial toxin according to 1, wherein the modified Clostridial toxin HCC targeting domain comprises at least one amino acid substitution in a β-trefoil domain.
[0803] 33. The modified Clostridial toxin according to 31, wherein the amino acid substitution is located within an α-fold, a β-fold or a γ-fold of the β-trefoil domain.
[0804] 34. The modified Clostridial toxin according to 31, wherein the amino acid substitution is located within a β4/β5 β-hairpin turn or a β8/β9 β-hairpin turn of the β-trefoil domain.
[0805] 35. The modified Clostridial toxin according to 33, wherein the amino acid substitution is a glycine or a phenylalanine.
[0806] 36. The modified Clostridial toxin according to 1, wherein the modified Clostridial toxin HCC targeting domain comprises a substitution of a Clostridial toxin HCC targeting domain α-fold for an α-fold selected from the group consisting of a Clostridial botulinum serotype A HA-33 1α-fold, a Clostridial botulinum serotype B HA-33 1α-fold, a Clostridial botulinum serotype C1 HA-33 1α-fold, a Clostridial botulinum serotype D HA-33 1α-fold, a Clostridial botulinum serotype A HA-33 2α-fold, a Clostridial botulinum serotype B HA-33 2α-fold, a Clostridial botulinum serotype C1 HA-33 2α-fold, a Clostridial botulinum serotype D HA-33 2α-fold, a Clostridial botulinum serotype A HA-17 α-fold, a Clostridial botulinum serotype B HA-17 α-fold, a Clostridial botulinum serotype C1 HA-17 α-fold, a Clostridial botulinum serotype D HA-17 α-fold, a Clostridial botulinum serotype A NTNH
α-fold, a Clostridial botulinum serotype B NTNH α-fold, a Clostridial botulinum serotype C1 NTNH α-fold, a Clostridial botulinum serotype D NTNH α-fold, a Clostridial botulinum serotype E NTNH α-fold, a Clostridial botulinum serotype F NTNH α-fold, a Clostridial botulinum serotype G NTNH α-fold, a FGF-1α-fold, a FGF-2 α-fold, a FGF-4 α-fold, a FGF-8 α-fold, a FGF-9 α-fold, a FGF-17 α-fold and a FGF-18 α-fold.
[0807] 37. The modified Clostridial toxin according to 1, wherein the modified Clostridial toxin HCC targeting domain comprises a substitution of a Clostridial toxin HCC targeting domain β-fold for a β-fold selected from the group consisting of a Clostridial botulinum serotype A HA-33 1β-fold, a Clostridial botulinum serotype B HA-33 1β-fold, a Clostridial botulinum serotype C1 HA-33 1β-fold, a Clostridial botulinum serotype D HA-33 1β-fold, a Clostridial botulinum serotype A HA-33 2β-fold, a Clostridial botulinum serotype B HA-33 2β-fold, a Clostridial botulinum serotype C1 HA-33 2β-fold, a Clostridial botulinum serotype D HA-33 2β-fold, a Clostridial botulinum serotype A HA-17 1β-fold, a Clostridial botulinum serotype B HA-17 1β-fold, a Clostridial botulinum serotype C1 HA-17 1β-fold, a Clostridial botulinum serotype D HA-17 1β-fold, a Clostridial botulinum serotype A NTNH β-fold, a Clostridial botulinum serotype B NTNH β-fold, a Clostridial botulinum serotype C1 NTNH β-fold, a Clostridial botulinum serotype D NTNH β-fold, a Clostridial botulinum serotype E NTNH β-fold, a Clostridial botulinum serotype F NTNH β-fold, a Clostridial botulinum serotype G NTNH β-fold, a FGF-1 β-fold, a FGF-2 fold, a FGF-4 β-fold, a FGF-8 β-fold, a FGF-9 β-fold, a FGF-17 β-fold and a FGF-18 β-fold.
[0808] 38. The modified Clostridial toxin according to 1, wherein the modified Clostridial toxin HCC targeting domain comprises a substitution of a Clostridial toxin HCC targeting domain γ-fold for a γ-fold selected from the group consisting of a Clostridial botulinum serotype A HA-33 1γ-fold, a Clostridial botulinum serotype B HA-33 1γ-fold, a Clostridial botulinum serotype C1 HA-33 1γ-fold, a Clostridial botulinum serotype D HA-33 1γ-fold, a Clostridial botulinum serotype A HA-33 2γ-fold, a Clostridial botulinum serotype B HA-33 2γ-fold, a Clostridial botulinum serotype C1 HA-33 2γ-fold, a Clostridial botulinum serotype D HA-33 2γ-fold, a Clostridial botulinum serotype A HA-17 γ-fold, a Clostridial botulinum serotype B HA-17 γ-fold, a Clostridial botulinum serotype C1 HA-17 γ-fold, a Clostridial botulinum serotype D HA-17 γ-fold, a Clostridial botulinum serotype A NTNH γ-fold, a Clostridial botulinum serotype B NTNH γ-fold, a Clostridial botulinum serotype C1 NTNH γ-fold, a Clostridial botulinum serotype D NTNH γ-fold, a Clostridial botulinum serotype E NTNH γ-fold, a Clostridial botulinum serotype F NTNH γ-fold, a Clostridial botulinum serotype G NTNH γ-fold, a FGF-1 γ-fold, a FGF-2 γ-fold, a FGF-4 γ-fold, a FGF-8 γ-fold, a FGF-9 γ-fold, a FGF-17 γ-fold and a FGF-18 γ-fold.
[0809] 39. The modified Clostridial toxin according to 1, wherein the modified Clostridial toxin HCC targeting domain comprises a substitution of a Clostridial toxin HCC targeting domain β4/β5 β-hairpin turn for a β4/β5 β-hairpin turn selected from the group consisting of a Clostridial botulinum serotype A HA-33 β4/β5 β-hairpin turn, a Clostridial botulinum serotype B HA-33 1β4/β5 β-hairpin turn, a Clostridial botulinum serotype C1 HA-33 1β4/β5 β-hairpin turn, a Clostridial botulinum serotype D HA-33 1β4/β5 β-hairpin turn, a Clostridial botulinum serotype A HA-33 2β4/β5 β-hairpin turn, a Clostridial botulinum serotype B HA-33 2β4/β5 β-hairpin turn, a Clostridial botulinum serotype C1 HA-33 2β4/β5 β-hairpin turn, a Clostridial botulinum serotype D HA-33 2β4/β5 β-hairpin turn, a Clostridial botulinum serotype A HA-17 β4/β5 β-hairpin turn, a Clostridial botulinum serotype B HA-17 β4/β5 β-hairpin turn, a Clostridial botulinum serotype C1 HA-17 β4/β5 β-hairpin turn, a Clostridial botulinum serotype D HA-17 β4/β5 β-hairpin turn, a Clostridial botulinum serotype A NTNH β4/β5 β-hairpin turn, a Clostridial botulinum serotype B NTNH 134435β-hairpin turn, a Clostridial botulinum serotype C1 NTNH β4/β5 β-hairpin turn, a Clostridial botulinum serotype D NTNH β4/β5 β-hairpin turn, a Clostridial botulinum serotype E NTNH β4/β5 β-hairpin turn, a Clostridial botulinum serotype F NTNH β4/β5 β-hairpin turn, a Clostridial botulinum serotype G NTNH 134435β-hairpin turn, a FGF-1 β4/β5 β-hairpin turn, a FGF-2 β4/β5 β-hairpin turn, a FGF-4 β4/β5 β-hairpin turn, a FGF-8 β4/β5 β-hairpin turn, a FGF-9 β4/β5 β-hairpin turn, a FGF-17 β4/β5 β-hairpin turn and a FGF-18 β4/β5 β-hairpin turn.
[0810] 40. The modified Clostridial toxin according to 1, wherein the modified Clostridial toxin HCC targeting domain comprises a substitution of a Clostridial toxin HCC targeting domain β8/β9 β-hairpin turn for a β8/β9 β-hairpin turn selected from the group consisting of a Clostridial botulinum serotype A HA-33 β8/β9 β-hairpin turn, a Clostridial botulinum serotype B HA-33 1β8/β9 β-hairpin turn, a Clostridial botulinum serotype C1 HA-33 1β8/β9 β-hairpin turn, a Clostridial botulinum serotype D HA-33 1β8/β9 β-hairpin turn, a Clostridial botulinum serotype A HA-33 2β8/β9 β-hairpin turn, a Clostridial botulinum serotype B HA-33 2β8/β9 β-hairpin turn, a Clostridial botulinum serotype C1 HA-33 2β8/β9 β-hairpin turn, a Clostridial botulinum serotype D HA-33 2β8/β9 β-hairpin turn, a Clostridial botulinum serotype A HA-17 β8/β9 β-hairpin turn, a Clostridial botulinum serotype B HA-17 β8/β9 β-hairpin turn, a Clostridial botulinum serotype C1 HA-17 β8/β9 β-hairpin turn, a Clostridial botulinum serotype D HA-17 β8/β9 β-hairpin turn, a Clostridial botulinum serotype A NTNH β8/β9 β-hairpin turn, a Clostridial botulinum serotype B NTNH β8/β9 β-hairpin turn, a Clostridial botulinum serotype C1 NTNH β8/β9 β-hairpin turn, a Clostridial botulinum serotype D NTNH β8/β9 β-hairpin turn, a Clostridial botulinum serotype E NTNH β8/β9 β-hairpin turn, a Clostridial botulinum serotype F NTNH β8/β9 β-hairpin turn, a Clostridial botulinum serotype G NTNH β8/β9 β-hairpin turn, a FGF-1 β8/β9 β-hairpin turn, a FGF-2 β8/β9 β-hairpin turn, a FGF-4 β8/β9 β-hairpin turn, a FGF-8 β8/β9 β-hairpin turn, a FGF-9 β8/β9 β-hairpin turn, a FGF-17 β8/β9 β-hairpin turn and a FGF-18 β8/β9 β-hairpin turn.
[0811] 41. The modified Clostridial toxin according to 1, wherein the protease cleavage site is an endogenous Clostridial toxin di-chain loop protease cleavage site or an exogenous cleavage site.
[0812] 42. The modified Clostridial toxin according to 41, wherein the endogenous Clostridial toxin di-chain loop protease cleavage site is selected from the group consisting of a BoNT/A di-chain loop protease cleavage site, a BoNT/B di-chain loop protease cleavage site, a BoNT/C1 di-chain loop protease cleavage site, a BoNT/D di-chain loop protease cleavage site, a BoNT/E di-chain loop protease cleavage site, a BoNT/F di-chain loop protease cleavage site, a BoNT/G di-chain loop protease cleavage site and a TeNT di-chain loop protease cleavage site.
[0813] 43. The modified Clostridial toxin according to 41, wherein the exogenous protease cleavage site is selected from the group consisting of an enterokinase cleavage site, a Thrombin cleavage site, a Factor Xa cleavage site, a human rhinovirus 3C protease cleavage site, a tobacco etch virus protease cleavage site, a dipeptidyl aminopeptidase cleavage site, a small ubiquitin-like modifier (SUMO)/ubiquitin-like protein-1 (ULP-1) protease cleavage site, and a Clostridial toxin substrate cleavage site.
[0814] 44. The modified Clostridial toxin according to 43, wherein the Clostridial toxin substrate cleavage site is selected from the group consisting of a BoNT/A substrate cleavage site, a BoNT/B substrate cleavage site, a BoNT/C1 substrate cleavage site, a BoNT/D substrate cleavage site, a BoNT/E substrate cleavage site, a BoNT/F substrate cleavage site, a BoNT/G substrate cleavage site and a TeNT substrate cleavage site.
[0815] 45. A modified Clostridial toxin comprising:
[0816] a) a Clostridial toxin enzymatic domain capable of executing an enzymatic target modification step of a Clostridial toxin intoxication process;
[0817] b) a Clostridial toxin translocation domain capable of executing a translocation step of a Clostridial toxin intoxication process;
[0818] c) a translocation facilitating domain capable of facilitating a translocation step of a Clostridial toxin intoxication process;
[0819] d) an enhanced targeting domain comprising a Clostridial non-toxin associated protein β-trefoil domain capable of executing a cell binding step of a Clostridial toxin intoxication process; and
[0820] e) a protease cleavage site
[0821] wherein cleavage of the protease cleavage site converts the single-chain form of the modified Clostridial toxin into the di-chain form.
[0822] 46. The modified Clostridial toxin according to 45, wherein the modified Clostridial toxin comprises, in a linear amino-to-carboxyl single polypeptide order, the Clostridial toxin enzymatic domain, the protease cleavage site, the Clostridial toxin translocation domain, the translocation facilitating domain and the enhanced targeting domain.
[0823] 47. The modified Clostridial toxin according to 45, wherein the modified Clostridial toxin comprises, in a linear amino-to-carboxyl single polypeptide order, the Clostridial toxin enzymatic domain, the protease cleavage site, the enhanced targeting domain, the Clostridial toxin translocation domain and the translocation facilitating domain.
[0824] 48. The modified Clostridial toxin according to 45, wherein the modified Clostridial toxin comprises, in a linear amino-to-carboxyl single polypeptide order, the enhanced targeting domain, the Clostridial toxin translocation domain, the translocation facilitating domain, the protease cleavage site and the Clostridial toxin enzymatic domain.
[0825] 49. The modified Clostridial toxin according to 45, wherein the modified Clostridial toxin comprises, in a linear amino-to-carboxyl single polypeptide order, the enhanced targeting domain, the Clostridial toxin enzymatic domain, the protease cleavage site, the Clostridial toxin translocation domain and the translocation facilitating domain.
[0826] 50. The modified Clostridial toxin according to 45, wherein the modified Clostridial toxin comprises, in a linear amino-to-carboxyl single polypeptide order, the Clostridial toxin translocation domain, the translocation facilitating domain, the protease cleavage site, the Clostridial toxin enzymatic domain and the enhanced targeting domain.
[0827] 51. The modified Clostridial toxin according to 45, wherein the modified Clostridial toxin comprises, in a linear amino-to-carboxyl single polypeptide order, the Clostridial toxin translocation domain, the translocation facilitating domain, the protease cleavage site, the enhanced targeting domain and the Clostridial toxin enzymatic domain.
[0828] 52. The modified Clostridial toxin according to 45, wherein the Clostridial toxin enzymatic domain is selected from the group consisting of a BoNT/A enzymatic domain, a BoNT/B enzymatic domain, a BoNT/C1 enzymatic domain, a BoNT/D enzymatic domain, a BoNT/E enzymatic domain, a BoNT/F enzymatic domain, a BoNT/G enzymatic domain and a TeNT enzymatic domain.
[0829] 53. The modified Clostridial toxin according to 45, wherein the Clostridial toxin translocation domain is selected from the group consisting of a BoNT/A translocation domain, a BoNT/B translocation domain, a BoNT/C1 translocation domain, a BoNT/D translocation domain, a BoNT/E translocation domain, a BoNT/F translocation domain, a BoNT/G translocation domain and a TeNT translocation domain.
[0830] 54. The modified Clostridial toxin according to 45, wherein the translocation facilitating domain is a Clostridial toxin translocation facilitating domain.
[0831] 55. The modified Clostridial toxin according to 54, wherein the Clostridial toxin translocation facilitating domain is selected from the group consisting of a BoNT/A translocation facilitating domain, a BoNT/B translocation facilitating domain, a BoNT/C1 translocation facilitating domain, a BoNT/D translocation domain, a BoNT/E translocation facilitating domain, a BoNT/F translocation facilitating domain, a BoNT/G translocation facilitating domain and a TeNT translocation facilitating domain.
[0832] 56. The modified Clostridial toxin according to 54, wherein the Clostridial toxin translocation facilitating domain comprises an amino acid sequence selected from the group consisting of amino acids 874-1110 of SEQ ID NO: 1, amino acids 861-1097 of SEQ ID NO: 2, amino acids 869-1111 of SEQ ID NO: 3, amino acids 865-1098 of SEQ ID NO: 4, amino acids 848-1085 of SEQ ID NO: 5, amino acids 867-1105 of SEQ ID NO: 6, amino acids 866-1105 of SEQ ID NO: 7 and amino acid 882-1127 of SEQ ID NO: 8.
[0833] 57. The modified Clostridial toxin according to 45, wherein the translocation facilitating domain is an enveloped virus fusogenic peptide domain.
[0834] 58. The modified Clostridial toxin according to 57, wherein the enveloped virus fusogenic peptide domain is selected from the group consisting of an influenzavirus fusogenic peptide domain, an alphavirus fusogenic peptide domain, a vesiculovirus fusogenic peptide domain, a respirovirus fusogenic peptide domain, a morbillivirus fusogenic peptide domain, an avulavirus fusogenic peptide domain, a henipavirus fusogenic peptide domain, a metapneumovirus fusogenic peptide domain and a foamy virus fusogenic peptide domain.
[0835] 59. The modified Clostridial toxin according to 58, wherein the influenzavirus fusogenic peptide domain is selected from the group consisting of SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 and SEQ ID NO: 91.
[0836] 60. The modified Clostridial toxin according to 58, wherein the alphavirus fusogenic peptide domain is selected from the group consisting of SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 and SEQ ID NO: 118.
[0837] 61. The modified Clostridial toxin according to 58, wherein the vesiculovirus fusogenic peptide domain is selected from the group consisting of SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 and SEQ ID NO: 129.
[0838] 62. The modified Clostridial toxin according to 58, wherein the respirovirus fusogenic peptide domain is selected from the group consisting of SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 and SEQ ID NO: 136.
[0839] 63. The modified Clostridial toxin according to 58, wherein the morbillivirus fusogenic peptide domain is selected from the group consisting of SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 and SEQ ID NO: 146.
[0840] 64. The modified Clostridial toxin according to 58, wherein the avulavirus fusogenic peptide domain is selected from the group consisting of SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 and SEQ ID NO: 159.
[0841] 65. The modified Clostridial toxin according to 58, wherein the henipavirus fusogenic peptide domain is selected from the group consisting of SEQ ID NO: 160 and SEQ ID NO: 161.
[0842] 66. The modified Clostridial toxin according to 58, wherein the metapneumovirus fusogenic peptide domain is SEQ ID NO: 162.
[0843] 67. The modified Clostridial toxin according to 45, wherein the Clostridial non-toxin associated protein β-trefoil domain is selected from the group consisting of a Clostridial botulinum serotype A HA-33 β-trefoil domain, a Clostridial botulinum serotype B HA-33 β-trefoil domain, a Clostridial botulinum serotype C1 HA-33 β-trefoil domain, a Clostridial botulinum serotype D HA-33 β-trefoil domain, a Clostridial botulinum serotype A HA-17 β-trefoil domain, a Clostridial botulinum serotype B HA-17 β-trefoil domain, a Clostridial botulinum serotype C1 HA-17 β-trefoil domain, a Clostridial botulinum serotype D HA-17 β-trefoil domain, a Clostridial botulinum serotype A NTNH β-trefoil domain, a Clostridial botulinum serotype B NTNH β-trefoil domain, a Clostridial botulinum serotype C1 NTNH trefoil domain, a Clostridial botulinum serotype D NTNH β-trefoil domain, a Clostridial botulinum serotype E NTNH β-trefoil domain, a Clostridial botulinum serotype F NTNH β-trefoil domain and a Clostridial botulinum serotype G NTNH β-trefoil domain.
[0844] 68. The modified Clostridial toxin according to 45, wherein the Clostridial non-toxin associated protein β-trefoil domain is selected from the group consisting of amino acids 10-144 of SEQ ID NO: 9, amino acids 151-293 of SEQ ID NO: 9, amino acids 10-144 of SEQ ID NO: 10, amino acids 151-293 of SEQ ID NO: 10, amino acids 10-144 of SEQ ID NO: 11, amino acids 151-293 of SEQ ID NO: 11, amino acids 10-146 of SEQ ID NO: 12, amino acids 153-294 of SEQ ID NO: 12, amino acids 10-144 of SEQ ID NO: 13, amino acids 151-279 of SEQ ID NO: 13, amino acids 10-144 of SEQ ID NO: 14, amino acids 151-292 of SEQ ID NO: 14, amino acids 10-146 of SEQ ID NO: 15, amino acids 153-291 of SEQ ID NO: 15, amino acids 10-141 of SEQ ID NO: 16, amino acids 148-285 of SEQ ID NO: 15, amino acids 10-141 of SEQ ID NO: 16, amino acids 148-285 of SEQ ID NO: 16, amino acids 10-141 of SEQ ID NO: 17, amino acids 148-286 of SEQ ID NO: 17, amino acids 10-141 of SEQ ID NO: 18, amino acids 148-286 of SEQ ID NO: 18, amino acids 9-146 of SEQ ID NO: 19, amino acids 9-146 of SEQ ID NO: 20, amino acids 9-146 of SEQ ID NO: 21, amino acids 9-146 of SEQ ID NO: 22, amino acids 1050-1194 of SEQ ID NO: 23, amino acids 1050-1199 of SEQ ID NO: 24, amino acids 1050-1194 of SEQ ID NO: 25, amino acids 1049-1198 of SEQ ID NO: 26, amino acids 1049-1197 of SEQ ID NO: 27, amino acids 1049-1197 of SEQ ID NO: 28, amino acids 1014-1163 of SEQ ID NO: 29, amino acids 1016-1160 of SEQ ID NO: 30, amino acids 1017-1166 of SEQ ID NO: 31 and amino acids 1050-1197 of SEQ ID NO: 1199.
[0845] 69. The modified Clostridial toxin according to 45, wherein the protease cleavage site is an endogenous Clostridial toxin di-chain loop protease cleavage site or an exogenous cleavage site.
[0846] 70. The modified Clostridial toxin according to 69, wherein the endogenous Clostridial toxin di-chain loop protease cleavage site is selected from the group consisting of a BoNT/A di-chain loop protease cleavage site, a BoNT/B di-chain loop protease cleavage site, a BoNT/C1 di-chain loop protease cleavage site, a BoNT/D di-chain loop protease cleavage site, a BoNT/E di-chain loop protease cleavage site, a BoNT/F di-chain loop protease cleavage site, a BoNT/G di-chain loop protease cleavage site and a TeNT di-chain loop protease cleavage site.
[0847] 71. The modified Clostridial toxin according to 69, wherein the exogenous protease cleavage site is selected from the group consisting of an enterokinase cleavage site, a Thrombin cleavage site, a Factor Xa cleavage site, a human rhinovirus 3C protease cleavage site, a tobacco etch virus protease cleavage site, a dipeptidyl aminopeptidase cleavage site, a small ubiquitin-like modifier (SUMO)/ubiquitin-like protein-1 (ULP-1) protease cleavage site, and a Clostridial toxin substrate cleavage site.
[0848] 72. The modified Clostridial toxin according to 71, wherein the Clostridial toxin substrate cleavage site is selected from the group consisting of a BoNT/A substrate cleavage site, a BoNT/B substrate cleavage site, a BoNT/C1 substrate cleavage site, a BoNT/D substrate cleavage site, a BoNT/E substrate cleavage site, a BoNT/F substrate cleavage site, a BoNT/G substrate cleavage site and a TeNT substrate cleavage site.
[0849] 73. A modified Clostridial toxin comprising:
[0850] a) a Clostridial toxin enzymatic domain capable of executing an enzymatic target modification step of a Clostridial toxin intoxication process;
[0851] b) a Clostridial toxin translocation domain capable of executing a translocation step of a Clostridial toxin intoxication process;
[0852] c) a translocation facilitating domain capable of facilitating a translocation step of a Clostridial toxin intoxication process;
[0853] d) an enhanced targeting domain comprising a FGF β-trefoil domain capable of selectively binding an FGFR3; and
[0854] e) a protease cleavage site
[0855] wherein cleavage of the protease cleavage site converts the single-chain form of the modified Clostridial toxin into the di-chain form.
[0856] 74. The modified Clostridial toxin according to 73, wherein the modified Clostridial toxin comprises, in a linear amino-to-carboxyl single polypeptide order, the Clostridial toxin enzymatic domain, the protease cleavage site, the Clostridial toxin translocation domain, the translocation facilitating domain and the enhanced targeting domain.
[0857] 75. The modified Clostridial toxin according to 73, wherein the modified Clostridial toxin comprises, in a linear amino-to-carboxyl single polypeptide order, the Clostridial toxin enzymatic domain, the protease cleavage site, the enhanced targeting domain, the Clostridial toxin translocation domain and the translocation facilitating domain.
[0858] 76. The modified Clostridial toxin according to 73, wherein the modified Clostridial toxin comprises, in a linear amino-to-carboxyl single polypeptide order, the enhanced targeting domain, the Clostridial toxin translocation domain, the translocation facilitating domain, the protease cleavage site and the Clostridial toxin enzymatic domain.
[0859] 77. The modified Clostridial toxin according to 73, wherein the modified Clostridial toxin comprises, in a linear amino-to-carboxyl single polypeptide order, the enhanced targeting domain, the Clostridial toxin enzymatic domain, the protease cleavage site, the Clostridial toxin translocation domain and the translocation facilitating domain.
[0860] 78. The modified Clostridial toxin according to 73, wherein the modified Clostridial toxin comprises, in a linear amino-to-carboxyl single polypeptide order, the Clostridial toxin translocation domain, the translocation facilitating domain, the protease cleavage site, the Clostridial toxin enzymatic domain and the enhanced targeting domain.
[0861] 79. The modified Clostridial toxin according to 73, wherein the modified Clostridial toxin comprises, in a linear amino-to-carboxyl single polypeptide order, the Clostridial toxin translocation domain, the translocation facilitating domain, the protease cleavage site, the enhanced targeting domain and the Clostridial toxin enzymatic domain.
[0862] 80. The modified Clostridial toxin according to 73, wherein the Clostridial toxin enzymatic domain is selected from the group consisting of a BoNT/A enzymatic domain, a BoNT/B enzymatic domain, a BoNT/C1 enzymatic domain, a BoNT/D enzymatic domain, a BoNT/E enzymatic domain, a BoNT/F enzymatic domain, a BoNT/G enzymatic domain and a TeNT enzymatic domain.
[0863] 81. The modified Clostridial toxin according to 73, wherein the Clostridial toxin translocation domain is selected from the group consisting of a BoNT/A translocation domain, a BoNT/B translocation domain, a BoNT/C1 translocation domain, a BoNT/D translocation domain, a BoNT/E translocation domain, a BoNT/F translocation domain, a BoNT/G translocation domain and a TeNT translocation domain.
[0864] 82. The modified Clostridial toxin according to 73, wherein the translocation facilitating domain is a Clostridial toxin translocation facilitating domain.
[0865] 83. The modified Clostridial toxin according to 82, wherein the Clostridial toxin translocation facilitating domain is selected from the group consisting of a BoNT/A translocation facilitating domain, a BoNT/B translocation facilitating domain, a BoNT/C1 translocation facilitating domain, a BoNT/D translocation domain, a BoNT/E translocation facilitating domain, a BoNT/F translocation facilitating domain, a BoNT/G translocation facilitating domain and a TeNT translocation facilitating domain.
[0866] 84. The modified Clostridial toxin according to 82, wherein the Clostridial toxin translocation facilitating domain comprises an amino acid sequence selected from the group consisting of amino acids 874-1110 of SEQ ID NO: 1, amino acids 861-1097 of SEQ ID NO: 2, amino acids 869-1111 of SEQ ID NO: 3, amino acids 865-1098 of SEQ ID NO: 4, amino acids 848-1085 of SEQ ID NO: 5, amino acids 867-1105 of SEQ ID NO: 6, amino acids 866-1105 of SEQ ID NO: 7 and amino acid 882-1127 of SEQ ID NO: 8.
[0867] 85. The modified Clostridial toxin according to 73, wherein the translocation facilitating domain is an enveloped virus fusogenic peptide domain.
[0868] 86. The modified Clostridial toxin according to 85, wherein the enveloped virus fusogenic peptide domain is selected from the group consisting of an influenzavirus fusogenic peptide domain, an alphavirus fusogenic peptide domain, a vesiculovirus fusogenic peptide domain, a respirovirus fusogenic peptide domain, a morbillivirus fusogenic peptide domain, an avulavirus fusogenic peptide domain, a henipavirus fusogenic peptide domain, a metapneumovirus fusogenic peptide domain and a foamy virus fusogenic peptide domain.
[0869] 87. The modified Clostridial toxin according to 86, wherein the influenzavirus fusogenic peptide domain is selected from the group consisting of SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 and SEQ ID NO: 91.
[0870] 88. The modified Clostridial toxin according to 86, wherein the alphavirus fusogenic peptide domain is selected from the group consisting of SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117 and SEQ ID NO: 118.
[0871] 89. The modified Clostridial toxin according to 86, wherein the vesiculovirus fusogenic peptide domain is selected from the group consisting of SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128 and SEQ ID NO: 129.
[0872] 90. The modified Clostridial toxin according to 86, wherein the respirovirus fusogenic peptide domain is selected from the group consisting of SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135 and SEQ ID NO: 136.
[0873] 91. The modified Clostridial toxin according to 86, wherein the morbillivirus fusogenic peptide domain is selected from the group consisting of SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145 and SEQ ID NO: 146.
[0874] 92. The modified Clostridial toxin according to 86, wherein the avulavirus fusogenic peptide domain is selected from the group consisting of SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158 and SEQ ID NO: 159.
[0875] 93. The modified Clostridial toxin according to 86, wherein the henipavirus fusogenic peptide domain is selected from the group consisting of SEQ ID NO: 160 and SEQ ID NO: 161.
[0876] 94. The modified Clostridial toxin according to 86, wherein the metapneumovirus fusogenic peptide domain is SEQ ID NO: 162.
[0877] 95. The modified Clostridial toxin according to 73, wherein the FGF β-trefoil domain is selected from the group consisting of a FGF-1 β-trefoil domain, a FGF-2 β-trefoil domain, a FGF-4 β-trefoil domain, a FGF-8 β-trefoil domain, a FGF-9 β-trefoil domain, a FGF-17 β-trefoil domain and a FGF-18 β-trefoil domain.
[0878] 96. The modified Clostridial toxin according to 73, wherein the FGF β-trefoil domain is selected from the group consisting of amino acids 26-155 of SEQ ID NO: 33, amino acids 29-155 of SEQ ID NO: 34, amino acids 83-206 of SEQ ID NO: 35, amino acids 43-172 of SEQ ID NO: 36, amino acids 63-196 of SEQ ID NO: 37, amino acids 55-183 of SEQ ID NO: 38 and amino acids 54-183 of SEQ ID NO: 39.
[0879] 97. The modified Clostridial toxin according to 73, wherein the protease cleavage site is an endogenous Clostridial toxin di-chain loop protease cleavage site or an exogenous cleavage site.
[0880] 98. The modified Clostridial toxin according to 97, wherein the endogenous Clostridial toxin di-chain loop protease cleavage site is selected from the group consisting of a BoNT/A di-chain loop protease cleavage site, a BoNT/B di-chain loop protease cleavage site, a BoNT/C1 di-chain loop protease cleavage site, a BoNT/D di-chain loop protease cleavage site, a BoNT/E di-chain loop protease cleavage site, a BoNT/F di-chain loop protease cleavage site, a BoNT/G di-chain loop protease cleavage site and a TeNT di-chain loop protease cleavage site.
[0881] 99. The modified Clostridial toxin according to 97, wherein the exogenous protease cleavage site is selected from the group consisting of an enterokinase cleavage site, a Thrombin cleavage site, a Factor Xa cleavage site, a human rhinovirus 3C protease cleavage site, a tobacco etch virus protease cleavage site, a dipeptidyl aminopeptidase cleavage site, a small ubiquitin-like modifier (SUMO)/ubiquitin-like protein-1 (ULP-1) protease cleavage site, and a Clostridial toxin substrate cleavage site.
[0882] 100. The modified Clostridial toxin according to 99, wherein the Clostridial toxin substrate cleavage site is selected from the group consisting of a BoNT/A substrate cleavage site, a BoNT/B substrate cleavage site, a BoNT/C1 substrate cleavage site, a BoNT/D substrate cleavage site, a BoNT/E substrate cleavage site, a BoNT/F substrate cleavage site, a BoNT/G substrate cleavage site and a TeNT substrate cleavage site.
[0883] 101. A polynucleotide molecule encoding a modified Clostridial toxin, the polynucleotide molecule comprising:
[0884] a) a polynucleotide molecule encoding a Clostridial toxin enzymatic domain capable of executing an enzymatic target modification step of a Clostridial toxin intoxication process;
[0885] b) a polynucleotide molecule encoding a Clostridial toxin translocation domain capable of executing a translocation step of a Clostridial toxin intoxication process;
[0886] c) a polynucleotide molecule encoding a translocation facilitating domain capable of facilitating a translocation step of a Clostridial toxin intoxication process;
[0887] d) a polynucleotide molecule encoding an enhanced targeting domain comprising a modified Clostridial HCC targeting domain capable of executing a cell binding step of a Clostridial toxin intoxication process; and
[0888] e) a polynucleotide molecule encoding a protease cleavage site
[0889] wherein cleavage of the protease cleavage site converts the single-chain form of the modified Clostridial toxin into the di-chain form; and
[0890] wherein the modified Clostridial HCC targeting domain exhibits enhanced binding activity for an endogenous Clostridial toxin receptor relative to the binding activity of a naturally-occurring Clostridial HCC targeting domain from which the modified Clostridial HCC targeting domain is derived.
[0891] 102. The polynucleotide molecule according to 101, wherein the polynucleotide molecule encodes the modified Clostridial toxin of any one of claims 1-7.
[0892] 103. The polynucleotide molecule according to 101, wherein the polynucleotide molecule encoding a Clostridial toxin enzymatic domain is selected from the group consisting of a polynucleotide molecule encoding a BoNT/A enzymatic domain, a BoNT/B enzymatic domain, a BoNT/C1 enzymatic domain, a BoNT/D enzymatic domain, a BoNT/E enzymatic domain, a BoNT/F enzymatic domain, a BoNT/G enzymatic domain and a TeNT enzymatic domain.
[0893] 104. The polynucleotide molecule according to 101, wherein the polynucleotide molecule encoding a Clostridial toxin translocation domain is selected from the group consisting of a polynucleotide molecule encoding a BoNT/A translocation domain, a BoNT/B translocation domain, a BoNT/C1 translocation domain, a BoNT/D translocation domain, a BoNT/E translocation domain, a BoNT/F translocation domain, a BoNT/G translocation domain and a TeNT translocation domain.
[0894] 105. The polynucleotide molecule according to 101, wherein the translocation facilitating domain is a Clostridial toxin translocation facilitating domain.
[0895] 106. The polynucleotide molecule according to 105, wherein the Clostridial toxin translocation facilitating domain is selected from the group consisting of a BoNT/A translocation facilitating domain, a BoNT/B translocation facilitating domain, a BoNT/C1 translocation facilitating domain, a BoNT/D translocation domain, a BoNT/E translocation facilitating domain, a BoNT/F translocation facilitating domain, a BoNT/G translocation facilitating domain and a TeNT translocation facilitating domain.
[0896] 107. The polynucleotide molecule according to 101, wherein the translocation facilitating domain is an enveloped virus fusogenic peptide domain.
[0897] 108. The polynucleotide molecule according to 107, wherein the enveloped virus fusogenic peptide domain is selected from the group consisting of an influenzavirus fusogenic peptide domain, an alphavirus fusogenic peptide domain, a vesiculovirus fusogenic peptide domain, a respirovirus fusogenic peptide domain, a morbillivirus fusogenic peptide domain, an avulavirus fusogenic peptide domain, a henipavirus fusogenic peptide domain, a metapneumovirus fusogenic peptide domain and a foamy virus fusogenic peptide domain.
[0898] 109. The polynucleotide molecule according to 101, wherein the polynucleotide molecule encoding a modified Clostridial toxin HCC targeting domain is selected from the group consisting of a polynucleotide molecule encoding a modified BoNT/A HCC targeting domain, a modified BoNT/B HCC targeting domain, a modified BoNT/C1 HCC targeting domain, a modified BoNT/D HCC targeting domain, a modified BoNT/E HCC targeting domain, a modified BoNT/F HCC targeting domain, a modified BoNT/G HCC targeting domain and a modified TeNT HCC targeting domain.
[0899] 110. The polynucleotide molecule according to 101, wherein the polynucleotide molecule encoding a modified Clostridial toxin HCC targeting domain comprises a polynucleotide molecule encoding a substitution of a Clostridial toxin HCC targeting domain α-fold for an α-fold selected from the group consisting of a Clostridial botulinum serotype A HA-33 1α-fold, a Clostridial botulinum serotype B HA-33 1α-fold, a Clostridial botulinum serotype C1 HA-33 1α-fold, a Clostridial botulinum serotype D HA-33 1α-fold, a Clostridial botulinum serotype A HA-33 2α-fold, a Clostridial botulinum serotype B HA-33 2α-fold, a Clostridial botulinum serotype C1 HA-33 2α-fold, a Clostridial botulinum serotype D HA-33 2α-fold, a Clostridial botulinum serotype A HA-17 α-fold, a Clostridial botulinum serotype B HA-17 α-fold, a Clostridial botulinum serotype C1 HA-17 α-fold, a Clostridial botulinum serotype D HA-17 α-fold, a Clostridial botulinum serotype A NTNH α-fold, a Clostridial botulinum serotype B NTNH α-fold, a Clostridial botulinum serotype C1 NTNH α-fold, a Clostridial botulinum serotype D NTNH α-fold, a Clostridial botulinum serotype E NTNH α-fold, a Clostridial botulinum serotype F NTNH α-fold, a Clostridial botulinum serotype G NTNH α-fold, a FGF-1α-fold, a FGF-2 α-fold, a FGF-4 α-fold, a FGF-8 α-fold, a FGF-9 α-fold, a FGF-17 α-fold and a FGF-18 α-fold.
[0900] 111. The polynucleotide molecule according to 101, wherein the polynucleotide molecule encoding a modified Clostridial toxin HCC targeting domain comprises a polynucleotide molecule encoding a substitution of a Clostridial toxin HCC targeting domain β-fold for a β-fold selected from the group consisting of a Clostridial botulinum serotype A HA-33 1β-fold, a Clostridial botulinum serotype B HA-33 1β-fold, a Clostridial botulinum serotype C1 HA-33 1β-fold, a Clostridial botulinum serotype D HA-33 1β-fold, a Clostridial botulinum serotype A HA-33 2β-fold, a Clostridial botulinum serotype B HA-33 2β-fold, a Clostridial botulinum serotype C1 HA-33 2β-fold, a Clostridial botulinum serotype D HA-33 2β-fold, a Clostridial botulinum serotype A HA-17 1β-fold, a Clostridial botulinum serotype B HA-17 1β-fold, a Clostridial botulinum serotype C1 HA-17 1β-fold, a Clostridial botulinum serotype D HA-17 1β-fold, a Clostridial botulinum serotype A NTNH β-fold, a Clostridial botulinum serotype B NTNH β-fold, a Clostridial botulinum serotype C1 NTNH β-fold, a Clostridial botulinum serotype D NTNH β-fold, a Clostridial botulinum serotype E NTNH β-fold, a Clostridial botulinum serotype F NTNH β-fold, a Clostridial botulinum serotype G NTNH β-fold, a FGF-1 β-fold, a FGF-2 β-fold, a FGF-4 β-fold, a FGF-8 β-fold, a FGF-9 β-fold, a FGF-17 β-fold and a FGF-18 β-fold. 112. The polynucleotide molecule according to 101, wherein the polynucleotide molecule encoding a modified Clostridial toxin HCC targeting domain comprises a polynucleotide molecule encoding a substitution of a Clostridial toxin HCC targeting domain γ-fold for a γ-fold selected from the group consisting of a Clostridial botulinum serotype A HA-33 1γ-fold, a Clostridial botulinum serotype B HA-33 1γ-fold, a Clostridial botulinum serotype C1 HA-33 1γ-fold, a Clostridial botulinum serotype D HA-33 1γ-fold, a Clostridial botulinum serotype A HA-33 2γ-fold, a Clostridial botulinum serotype B HA-33 2γ-fold, a Clostridial botulinum serotype C1 HA-33 2γ-fold, a Clostridial botulinum serotype D HA-33 2γ-fold, a Clostridial botulinum serotype A HA-17 γ-fold, a Clostridial botulinum serotype B HA-17 γ-fold, a Clostridial botulinum serotype C1 HA-17 γ-fold, a Clostridial botulinum serotype D HA-17 γ-fold, a Clostridial botulinum serotype A NTNH γ-fold, a Clostridial botulinum serotype B NTNH γ-fold, a Clostridial botulinum serotype C1 NTNH γ-fold, a Clostridial botulinum serotype D NTNH γ-fold, a Clostridial botulinum serotype E NTNH γ-fold, a Clostridial botulinum serotype F NTNH γ-fold, a Clostridial botulinum serotype G NTNH γ-fold, a FGF-1 γ-fold, a FGF-2 γ-fold, a FGF-4 γ-fold, a FGF-8 γ-fold, a FGF-9 γ-fold, a FGF-17 γ-fold and a FGF-18 γ-fold.
[0901] 113. The polynucleotide molecule according to 101, wherein the polynucleotide molecule encoding a modified Clostridial toxin HCC targeting domain comprises a polynucleotide molecule encoding a substitution of a Clostridial toxin HCC targeting domain β4/β5 β-hairpin turn for a β4/β5 β-hairpin turn selected from the group consisting of a Clostridial botulinum serotype A HA-33 β4/β5 β-hairpin turn, a Clostridial botulinum serotype B HA-33 1β4/β5 β-hairpin turn, a Clostridial botulinum serotype C1 HA-33 1β4/β5 β-hairpin turn, a Clostridial botulinum serotype D HA-33 1β4/β5 β-hairpin turn, a Clostridial botulinum serotype A HA-33 2β4/β5 β-hairpin turn, a Clostridial botulinum serotype B HA-33 2β4/β5 β-hairpin turn, a Clostridial botulinum serotype C1 HA-33 2β4/β5 β-hairpin turn, a Clostridial botulinum serotype D HA-33 2β4/β5 β-hairpin turn, a Clostridial botulinum serotype A HA-17 β4/β5 β-hairpin turn, a Clostridial botulinum serotype B HA-17 β4/β5 β-hairpin turn, a Clostridial botulinum serotype C1 HA-17 β4/β5 β-hairpin turn, a Clostridial botulinum serotype D HA-17 β4/β5 β-hairpin turn, a Clostridial botulinum serotype A NTNH β4/β5 β-hairpin turn, a Clostridial botulinum serotype B NTNH β4/β5 β-hairpin turn, a Clostridial botulinum serotype C1 NTNH β4/β5 β-hairpin turn, a Clostridial botulinum serotype D NTNH β4/β5 β-hairpin turn, a Clostridial botulinum serotype E NTNH β4/β5 β-hairpin turn, a Clostridial botulinum serotype F NTNH β4/β5 β-hairpin turn, a Clostridial botulinum serotype G NTNH β4/β5 β-hairpin turn, a FGF-1 β4/β5 β-hairpin turn, a FGF-2 β4/β5 β-hairpin turn, a FGF-4 β4/β5 β-hairpin turn, a FGF-8 β4/β5 β-hairpin turn, a FGF-9 β4/β5 β-hairpin turn, a FGF-17 β4/β5 β-hairpin turn and a FGF-18 β4/β5 β-hairpin turn.
[0902] 114. The polynucleotide molecule according to 101, wherein the polynucleotide molecule encoding a modified Clostridial toxin HCC targeting domain comprises a polynucleotide molecule encoding a substitution of a Clostridial toxin HCC targeting domain β8/β9 β-hairpin turn for a β8/β9 β-hairpin turn selected from the group consisting of a Clostridial botulinum serotype A HA-33 β8/β9 β-hairpin turn, a Clostridial botulinum serotype B HA-33 1β8/β9 β-hairpin turn, a Clostridial botulinum serotype Cl HA-33 1β8/β9 β-hairpin turn, a Clostridial botulinum serotype D HA-33 1β8/β9 β-hairpin turn, a Clostridial botulinum serotype A HA-33 2β8/β9 β-hairpin turn, a Clostridial botulinum serotype B HA-33 2β8/β9 β-hairpin turn, a Clostridial botulinum serotype C1 HA-33 2β8/β9 β-hairpin turn, a Clostridial botulinum serotype D HA-33 2β8/β9 β-hairpin turn, a Clostridial botulinum serotype A HA-17 β8/β9 β-hairpin turn, a Clostridial botulinum serotype B HA-17 β8/β9 β-hairpin turn, a Clostridial botulinum serotype C1 HA-17 β8/β9 β-hairpin turn, a Clostridial botulinum serotype D HA-17 β8/β9 β-hairpin turn, a Clostridial botulinum serotype A NTNH β8/β9 β-hairpin turn, a Clostridial botulinum serotype B NTNH β8/β9 β-hairpin turn, a Clostridial botulinum serotype C1 NTNH β8/β9 β-hairpin turn, a Clostridial botulinum serotype D NTNH β8/β9 β-hairpin turn, a Clostridial botulinum serotype E NTNH β8/β9 β-hairpin turn, a Clostridial botulinum serotype F NTNH β8/β9 β-hairpin turn, a Clostridial botulinum serotype G NTNH β8/β9 β-hairpin turn, a FGF-1 β8/β9 β-hairpin turn, a FGF-2 β8/β9 β-hairpin turn, a FGF-4 β8/β9 β-hairpin turn, a FGF-8 β8/β9 β-hairpin turn, a FGF-9 β8/β9 β-hairpin turn, a FGF-17
β8/β9 β-hairpin turn and a FGF-18 β8/β9 β-hairpin turn.
[0903] 115. The polynucleotide molecule according to 101, wherein the polynucleotide molecule encoding the protease cleavage site is a polynucleotide molecule encoding an endogenous Clostridial toxin di-chain loop protease cleavage site or a polynucleotide molecule encoding an exogenous cleavage site.
[0904] 116. The polynucleotide molecule according to 101, wherein the polynucleotide molecule comprises an expression vector.
[0905] 117. A polynucleotide molecule encoding a modified Clostridial toxin, the polynucleotide molecule comprising:
[0906] a) a polynucleotide molecule encoding a Clostridial toxin enzymatic domain capable of executing an enzymatic target modification step of a Clostridial toxin intoxication process;
[0907] b) a polynucleotide molecule encoding a Clostridial toxin translocation domain capable of executing a translocation step of a Clostridial toxin intoxication process;
[0908] c) a polynucleotide molecule encoding a translocation facilitating domain capable of facilitating a translocation step of a Clostridial toxin intoxication process;
[0909] d) a polynucleotide molecule encoding an enhanced targeting domain comprising a Clostridial non-toxin associated protein β-trefoil domain capable of executing a cell binding step of a Clostridial toxin intoxication process; and
[0910] e) a polynucleotide molecule encoding a protease cleavage site
[0911] wherein cleavage of the protease cleavage site converts the single-chain form of the modified Clostridial toxin into the di-chain form.
[0912] 118. The polynucleotide molecule according to 115, wherein the polynucleotide molecule encodes a modified Clostridial toxin of any one of claims 45-51.
[0913] 119. The polynucleotide molecule according to 117, wherein the polynucleotide molecule encoding a Clostridial toxin enzymatic domain is selected from the group consisting of a polynucleotide molecule encoding a BoNT/A enzymatic domain, a BoNT/B enzymatic domain, a BoNT/C1 enzymatic domain, a BoNT/D enzymatic domain, a BoNT/E enzymatic domain, a BoNT/F enzymatic domain, a BoNT/G enzymatic domain and a TeNT enzymatic domain.
[0914] 120. The polynucleotide molecule according to 117, wherein the polynucleotide molecule encoding a Clostridial toxin translocation domain is selected from the group consisting of a polynucleotide molecule encoding a BoNT/A translocation domain, a BoNT/B translocation domain, a BoNT/C1 translocation domain, a BoNT/D translocation domain, a BoNT/E translocation domain, a BoNT/F translocation domain, a BoNT/G translocation domain and a TeNT translocation domain.
[0915] 121. The polynucleotide molecule according to 117, wherein the translocation facilitating domain is a Clostridial toxin translocation facilitating domain.
[0916] 122. The polynucleotide molecule according to 121, wherein the Clostridial toxin translocation facilitating domain is selected from the group consisting of a BoNT/A translocation facilitating domain, a BoNT/B translocation facilitating domain, a BoNT/C1 translocation facilitating domain, a BoNT/D translocation domain, a BoNT/E translocation facilitating domain, a BoNT/F translocation facilitating domain, a BoNT/G translocation facilitating domain and a TeNT translocation facilitating domain.
[0917] 123. The polynucleotide molecule according to 117, wherein the translocation facilitating domain is an enveloped virus fusogenic peptide domain.
[0918] 124. The polynucleotide molecule according to 123, wherein the enveloped virus fusogenic peptide domain is selected from the group consisting of an influenzavirus fusogenic peptide domain, an alphavirus fusogenic peptide domain, a vesiculovirus fusogenic peptide domain, a respirovirus fusogenic peptide domain, a morbillivirus fusogenic peptide domain, an avulavirus fusogenic peptide domain, a henipavirus fusogenic peptide domain, a metapneumovirus fusogenic peptide domain and a foamy virus fusogenic peptide domain.
[0919] 125. The polynucleotide molecule according to 117, wherein the polynucleotide molecule encoding a Clostridial non-toxin associated protein β-trefoil domain selected from the group consisting of a polynucleotide molecule encoding a Clostridial botulinum serotype A HA-33 β-trefoil domain, a Clostridial botulinum serotype B HA-33 β-trefoil domain, a Clostridial botulinum serotype C1 HA-33 β-trefoil domain, a Clostridial botulinum serotype D HA-33 β-trefoil domain, a Clostridial botulinum serotype A HA-17 β-trefoil domain, a Clostridial botulinum serotype B HA-17 β-trefoil domain, a Clostridial botulinum serotype C1 HA-17 β-trefoil domain, a Clostridial botulinum serotype D HA-17 β-trefoil domain, a Clostridial botulinum serotype A NTNH β-trefoil domain, a Clostridial botulinum serotype B NTNH β-trefoil domain, a Clostridial botulinum serotype C1 NTNH β-trefoil domain, a Clostridial botulinum serotype D NTNH β-trefoil domain, a Clostridial botulinum serotype E NTNH β-trefoil domain, a Clostridial botulinum serotype F NTNH β-trefoil domain and a Clostridial botulinum serotype G NTNH β-trefoil domain.
[0920] 126. The polynucleotide molecule according to 117, wherein the polynucleotide molecule encoding the protease cleavage site is a polynucleotide molecule encoding an endogenous Clostridial toxin di-chain loop protease cleavage site or a polynucleotide molecule encoding an exogenous cleavage site.
[0921] 127. The polynucleotide molecule according to 117, wherein the polynucleotide molecule comprises an expression vector.
[0922] 128. A polynucleotide molecule encoding a modified Clostridial toxin, the polynucleotide molecule comprising:
[0923] a) a polynucleotide molecule encoding a Clostridial toxin enzymatic domain capable of executing an enzymatic target modification step of a Clostridial toxin intoxication process;
[0924] b) a polynucleotide molecule encoding a Clostridial toxin translocation domain capable of executing a translocation step of a Clostridial toxin intoxication process;
[0925] c) a polynucleotide molecule encoding a Clostridial toxin translocation facilitating domain capable of facilitating a translocation step of a Clostridial toxin intoxication process;
[0926] d) a polynucleotide molecule encoding an enhanced targeting domain comprising a FGF β-trefoil domain capable of selectively binding an FGFR3; and
[0927] e) a polynucleotide molecule encoding a protease cleavage site
[0928] wherein cleavage of the protease cleavage site converts the single-chain form of the modified Clostridial toxin into the di-chain form.
[0929] 129. The polynucleotide molecule according to 128, wherein the polynucleotide molecule encodes a modified Clostridial toxin of any one of claims 73-79.
[0930] 130. The polynucleotide molecule according to 128, wherein the polynucleotide molecule encoding a Clostridial toxin enzymatic domain is selected from the group consisting of a polynucleotide molecule encoding a BoNT/A enzymatic domain, a BoNT/B enzymatic domain, a BoNT/C1 enzymatic domain, a BoNT/D enzymatic domain, a BoNT/E enzymatic domain, a BoNT/F enzymatic domain, a BoNT/G enzymatic domain and a TeNT enzymatic domain.
[0931] 131. The polynucleotide molecule according to 128, wherein the polynucleotide molecule encoding a Clostridial toxin translocation domain is selected from the group consisting of a polynucleotide molecule encoding a BoNT/A translocation domain, a BoNT/B translocation domain, a BoNT/C1 translocation domain, a BoNT/D translocation domain, a BoNT/E translocation domain, a BoNT/F translocation domain, a BoNT/G translocation domain and a TeNT translocation domain.
[0932] 132. The polynucleotide molecule according to 128, wherein the translocation facilitating domain is a Clostridial toxin translocation facilitating domain.
[0933] 133. The polynucleotide molecule according to 132, wherein the Clostridial toxin translocation facilitating domain is selected from the group consisting of a BoNT/A translocation facilitating domain, a BoNT/B translocation facilitating domain, a BoNT/C1 translocation facilitating domain, a BoNT/D translocation domain, a BoNT/E translocation facilitating domain, a BoNT/F translocation facilitating domain, a BoNT/G translocation facilitating domain and a TeNT translocation facilitating domain.
[0934] 134. The polynucleotide molecule according to 128, wherein the translocation facilitating domain is an enveloped virus fusogenic peptide domain.
[0935] 135. The polynucleotide molecule according to 134, wherein the enveloped virus fusogenic peptide domain is selected from the group consisting of an influenzavirus fusogenic peptide domain, an alphavirus fusogenic peptide domain, a vesiculovirus fusogenic peptide domain, a respirovirus fusogenic peptide domain, a morbillivirus fusogenic peptide domain, an avulavirus fusogenic peptide domain, a henipavirus fusogenic peptide domain, a metapneumovirus fusogenic peptide domain and a foamy virus fusogenic peptide domain.
[0936] 136. The polynucleotide molecule according to 128, wherein the polynucleotide molecule encoding a FGF β-trefoil domain is selected from the group consisting of a polynucleotide molecule encoding a FGF-1 β-trefoil domain, a FGF-2 β-trefoil domain, a FGF-4 β-trefoil domain, a FGF-8 β-trefoil domain, a FGF-9 β-trefoil domain, a FGF-17 β-trefoil domain and a FGF-18 β-trefoil domain.
[0937] 137. The polynucleotide molecule according to 128, wherein the polynucleotide molecule encoding the protease cleavage site is a polynucleotide molecule encoding an endogenous Clostridial toxin di-chain loop protease cleavage site or a polynucleotide molecule encoding an exogenous cleavage site.
[0938] 138. The polynucleotide molecule according to 128, wherein the polynucleotide molecule comprises an expression vector.
[0939] 139. A method of producing a modified Clostridial toxin comprising the step of expressing a polynucleotide molecule encoding a modified Clostridial toxin in a cell, the polynucleotide molecule comprising:
[0940] a) a polynucleotide molecule encoding a Clostridial toxin enzymatic domain capable of executing an enzymatic target modification step of a Clostridial toxin intoxication process;
[0941] b) a polynucleotide molecule encoding a Clostridial toxin translocation domain capable of executing a translocation step of a Clostridial toxin intoxication process;
[0942] c) a polynucleotide molecule encoding a translocation facilitating domain capable of facilitating a translocation step of a Clostridial toxin intoxication process;
[0943] d) a polynucleotide molecule encoding an enhanced targeting domain comprising a modified Clostridial HCC targeting domain capable of executing a cell binding step of a Clostridial toxin intoxication process; and
[0944] e) a polynucleotide molecule encoding a protease cleavage site
[0945] wherein cleavage of the protease cleavage site converts the single-chain form of the modified Clostridial toxin into the di-chain form; and
[0946] wherein the modified Clostridial HCC targeting domain exhibits enhanced binding activity for an endogenous Clostridial toxin receptor relative to the binding activity of a naturally-occurring Clostridial HCC targeting domain from which the modified Clostridial binding HCC targeting is derived.
[0947] 140. The method according to 139, wherein the polynucleotide molecule is any one of the polynucleotide molecules of 102.
[0948] 141. A method of producing a modified Clostridial toxin comprising the step of expressing a polynucleotide molecule encoding a modified Clostridial toxin in a cell, the polynucleotide molecule comprising:
[0949] a) a polynucleotide molecule encoding a Clostridial toxin enzymatic domain capable of executing an enzymatic target modification step of a Clostridial toxin intoxication process;
[0950] b) a polynucleotide molecule encoding a Clostridial toxin translocation domain capable of executing a translocation step of a Clostridial toxin intoxication process;
[0951] c) a polynucleotide molecule encoding a translocation facilitating domain capable of facilitating a translocation step of a Clostridial toxin intoxication process;
[0952] d) a polynucleotide molecule encoding an enhanced targeting domain comprising a Clostridial non-toxin associated protein β-trefoil domain capable of executing a cell binding step of a Clostridial toxin intoxication process; and
[0953] e) a polynucleotide molecule encoding a protease cleavage site
[0954] wherein cleavage of the protease cleavage site converts the single-chain form of the modified Clostridial toxin into the di-chain form.
[0955] 142. The method according to 141, wherein the polynucleotide molecule is any one of the polynucleotide molecules of 118.
[0956] 143. A method of producing a modified Clostridial toxin comprising the step of expressing a polynucleotide molecule encoding a modified Clostridial toxin in a cell, the polynucleotide molecule comprising:
[0957] a) a polynucleotide molecule encoding a Clostridial toxin enzymatic domain capable of executing an enzymatic target modification step of a Clostridial toxin intoxication process;
[0958] b) a polynucleotide molecule encoding a Clostridial toxin translocation domain capable of executing a translocation step of a Clostridial toxin intoxication process;
[0959] c) a polynucleotide molecule encoding a translocation facilitating domain capable of facilitating a translocation step of a Clostridial toxin intoxication process;
[0960] d) a polynucleotide molecule encoding an enhanced targeting domain comprising a FGF β-trefoil domain capable of selectively binding an FGFR3; and
[0961] e) a polynucleotide molecule encoding a protease cleavage site
[0962] wherein cleavage of the protease cleavage site converts the single-chain form of the modified Clostridial toxin into the di-chain form.
[0963] 144. The method according to 143, wherein the polynucleotide molecule is any one of the polynucleotide molecules of 129.
[0964] 145. A method of producing a modified Clostridial toxin comprising the steps of:
[0965] a) introducing into a cell a polynucleotide molecule encoding a modified Clostridial toxin, the polynucleotide molecule comprising:
[0966] i) a polynucleotide molecule encoding a Clostridial toxin enzymatic domain capable of executing an enzymatic target modification step of a Clostridial toxin intoxication process;
[0967] ii) a polynucleotide molecule encoding a Clostridial toxin translocation domain capable of executing a translocation step of a Clostridial toxin intoxication process;
[0968] iii) a polynucleotide molecule encoding a translocation facilitating domain capable of facilitating a translocation step of a Clostridial toxin intoxication process;
[0969] iv) a polynucleotide molecule encoding an enhanced targeting domain comprising a modified Clostridial H
CC targeting domain capable of executing a cell binding step of a Clostridial toxin intoxication process; and
[0970] v) a polynucleotide molecule encoding a protease cleavage site
[0971] wherein cleavage of the protease cleavage site converts the single-chain form of the modified Clostridial toxin into the di-chain form; and
[0972] wherein the modified Clostridial HCC targeting domain exhibits enhanced binding activity for an endogenous Clostridial toxin receptor relative to the binding activity of a naturally-occurring Clostridial HCC targeting domain from which the modified Clostridial HCC targeting domain is derived.
[0973] b) expressing the modified Clostridial toxin encoded by the polynucleotide molecule.
[0974] 146. The method according to 145, wherein the polynucleotide molecule is any one of the polynucleotide molecules of 102.
[0975] 147. A method of producing a modified Clostridial toxin comprising the steps of:
[0976] a) introducing into a cell a polynucleotide molecule encoding a modified Clostridial toxin, the polynucleotide molecule comprising:
[0977] i) a polynucleotide molecule encoding a Clostridial toxin enzymatic domain capable of executing an enzymatic target modification step of a Clostridial toxin intoxication process;
[0978] ii) a polynucleotide molecule encoding a Clostridial toxin translocation domain capable of executing a translocation step of a Clostridial toxin intoxication process;
[0979] iii) a polynucleotide molecule encoding a translocation facilitating domain capable of facilitating a translocation step of a Clostridial toxin intoxication process;
[0980] iv) a polynucleotide molecule encoding an enhanced targeting domain comprising a Clostridial non-toxin associated protein β-trefoil domain capable of executing a cell binding step of a Clostridial toxin intoxication process; and
[0981] v) a polynucleotide molecule encoding a protease cleavage site
[0982] wherein cleavage of the protease cleavage site converts the single-chain form of the modified Clostridial toxin into the di-chain form.
[0983] b) expressing the modified Clostridial toxin encoded by the polynucleotide molecule.
[0984] 148. The method according to 147, wherein the polynucleotide molecule is any one of the polynucleotide molecules of 118.
[0985] 149. A method of producing a modified Clostridial toxin comprising the steps of:
[0986] a) introducing into a cell a polynucleotide molecule encoding a modified Clostridial toxin, the polynucleotide molecule comprising:
[0987] i) a polynucleotide molecule encoding a Clostridial toxin enzymatic domain capable of executing an enzymatic target modification step of a Clostridial toxin intoxication process;
[0988] ii) a polynucleotide molecule encoding a Clostridial toxin translocation domain capable of executing a translocation step of a Clostridial toxin intoxication process;
[0989] iii) a polynucleotide molecule encoding a translocation facilitating domain capable of facilitating a translocation step of a Clostridial toxin intoxication process;
[0990] iv) a polynucleotide molecule encoding an enhanced targeting domain comprising a FGF β-trefoil domain capable of selectively binding an FGFR3; and
[0991] v) a polynucleotide molecule encoding a protease cleavage site
[0992] wherein cleavage of the protease cleavage site converts the single-chain form of the modified Clostridial toxin into the di-chain form.
[0993] b) expressing the modified Clostridial toxin encoded by the polynucleotide molecule.
[0994] 150. The method according to 149, wherein the polynucleotide molecule is any one of the polynucleotide molecules of 129.
EXAMPLES
[0995] The following non-limiting examples are provided for illustrative purposes only in order to facilitate a more complete understanding of disclosed embodiments and are in no way intended to limit any of the embodiments disclosed in the present specification.
Example 1
Construction of a Modified Clostridial Toxin Comprising a Translocation Facilitating Domain and a Modified Clostridial Toxin Targeting Domain with Enhanced Binding Activity
[0996] This example illustrates how to make a modified Clostridial toxin comprising a translocation facilitating domain and a modified Clostridial toxin binding domain with enhanced binding activity using site-directed mutagenesis.
[0997] A polynucleotide molecule encoding BoNT/A (SEQ ID NO: 1) is synthesized using standard procedures (BlueHeron® Biotechnology, Bothell, Wash.). Oligonucleotides of 20 to 50 bases in length are synthesized using standard phosphoramidite synthesis. These oligonucleotides are hybridized into double stranded duplexes that are ligated together to assemble the full-length polynucleotide molecule. This polynucleotide molecule is cloned using standard molecular biology methods into a pUCBHB1 vector at the SmaI site to generate pUCBHB1/BoNT/A. The synthesized polynucleotide molecule is verified by sequencing using Big Dye Terminator® Chemistry 3.1 (Applied Biosystems, Foster City, Calif.) and an ABI 3100 sequencer (Applied Biosystems, Foster City, Calif.).
[0998] If desired, an expression optimized polynucleotide molecule encoding BoNT/A (SEQ ID NO: 1) can be synthesized in order to improve expression in an Escherichia coli strain. The polynucleotide molecule encoding the BoNT/A can be modified to 1) contain synonymous codons typically present in native polynucleotide molecules of an Escherichia coli strain; 2) contain a G+C content that more closely matches the average G+C content of native polynucleotide molecules found in an Escherichia coli strain; 3) reduce polymononucleotide regions found within the polynucleotide molecule; and/or 4) eliminate internal regulatory or structural sites found within the polynucleotide molecule, see, e.g., Lance E. Steward et al. Optimizing Expression of Active Botulinum Toxin Type E, PCT Patent Serial No. 2005/020578 (Jun. 9, 2005); Lance E. Steward et al. Optimizing Expression of Active Botulinum Toxin Type A, PCT Patent Serial No. 2005/027917 (Aug. 3, 2005). Once sequence optimization is complete, oligonucleotides of 20 to 50 bases in length are synthesized using standard phosphoramidite synthesis. These oligonucleotides are hybridized into double stranded duplexes that are ligated together to assemble the full-length polynucleotide molecule. This polynucleotide molecule is cloned using standard molecular biology methods into a pUCBHB1 vector at the SmaI site to generate pUCBHB1/BoNT/A. The synthesized polynucleotide molecule is verified by sequencing using Big Dye Terminator® Chemistry 3.1 (Applied Biosystems, Foster City, Calif.) and an ABI 3100 sequencer (Applied Biosystems, Foster City, Calif.). Is so desired, optimization to a different organism, such as, e.g., a yeast strain, an insect cell-line or a mammalian cell line, can be done, see, e.g., Steward, supra, PCT Patent Serial No. 2005/020578 (Jun. 9, 2005); and Steward, supra, PCT Patent Serial No. 2005/027917 (Aug. 3, 2005).
[0999] A similar cloning strategy is used to make pUCBHB1 cloning constructs comprising a polynucleotide molecule encoding BoNT/B of SEQ ID NO: 2; a polynucleotide molecule encoding BoNT/C1 of SEQ ID NO: 3; a polynucleotide molecule encoding BoNT/D of SEQ ID NO: 4; a polynucleotide molecule encoding BoNT/E of SEQ ID NO: 5; a polynucleotide molecule encoding BoNT/F of SEQ ID NO: 6; a polynucleotide molecule encoding BoNT/G of SEQ ID NO: 7; and a polynucleotide molecule encoding TeNT of SEQ ID NO: 8. In addition, one skilled in the art can modify Clostridial toxins, such as, e.g., to include an exogenous protease cleavage site within the di-chain loop region, or flexible spacer regions.
[1000] To construct pET29/BoNT/A, a pUCBHB1/BoNT/A construct is digested with restriction endonucleases that 1) excise the insert comprising the open reading frame of SEQ ID NO: 1 encoding BoNT/A; and 2) enable this insert to be operably-linked to a pET29 vector (EMD Biosciences-Novagen, Madison, Wis.). This insert is subcloned using a T4 DNA ligase procedure into a pET29 vector that is digested with appropriate restriction endonucleases to yield pET29/BoNT/A. The ligation mixture is transformed into chemically competent E. coli DH5α cells (Invitrogen, Inc, Carlsbad, Calif.) using a heat shock method, plated on 1.5% Luria-Bertani agar plates (pH 7.0) containing 50 μg/mL of Kanamycin, and placed in a 37° C. incubator for overnight growth. Bacteria containing expression constructs are identified as Kanamycin resistant colonies. Candidate constructs are isolated using an alkaline lysis plasmid mini-preparation procedure and analyzed by restriction endonuclease digest mapping to determine the presence and orientation of the insert. This cloning strategy yielded a pET29 expression construct comprising the polynucleotide molecule encoding the BoNT/A of SEQ ID NO: 1 operably-linked to a carboxyl terminal polyhistidine affinity binding peptide.
[1001] A similar cloning strategy is used to make pET29 expression constructs comprising a polynucleotide molecule encoding BoNT/B of SEQ ID NO: 2; a polynucleotide molecule encoding BoNT/C1 of SEQ ID NO: 3; a polynucleotide molecule encoding BoNT/D of SEQ ID NO: 4; a polynucleotide molecule encoding BoNT/E of SEQ ID NO: 5; a polynucleotide molecule encoding BoNT/F of SEQ ID NO: 6; a polynucleotide molecule encoding BoNT/G of SEQ ID NO: 7; and a polynucleotide molecule encoding TeNT of SEQ ID NO: 8.
[1002] To construct a modified BoNT/A comprising a modified HCC targeting domain with enhanced binding activity, specific amino acids influencing binding activity will be changed. It is already known that amino acids Trp 1101, Gly 1102, Leu 1105, Tyr 1111, Tyr 1112, Gly 1158, Ile 1163, Asp 1179, Glu 1203, Phe 1252, Ser 1264, Trp 1266, Tyr 1267, Gln 1270, Gly 1279 and Trp 1282 of SEQ ID NO: 1 are important for function. To determine which amino acid substitutions could enhance the binding activity of a BoNT/A binding domain, computational protein design algorithms will generate novel proteins with optimized properties. The crystal structure of a BoNT/A binding domain will be used as the starting template for computational calculations. Potential amino acid candidates will be identified using a combined output from Protein Design Automation® (PDA®) and Sequence Prediction Algorithm® (SPA®) calculations. For PDA calculations, the conformations of amino acids at variable positions will be represented as a set of backbone-independent side chain rotamers derived from the rotamer library. The energies of all possible combinations of the considered amino acids at the chosen variable positions will be calculated using a force field containing terms describing van der Waals, solvation, electrostatic, and hydrogen bond interactions. The optimal (ground state) sequence will be determined using a Dead End Elimination (DEE) algorithm, and a Monte Carlo (MC) algorithm will be used to evaluate the energies of similar sequences around the predicted ground state. SPA calculations utilize a genetic algorithm to screen for low energy sequences, with energies being calculated during each round of "evolution" for those sequences being sampled. The conformations of amino acids will be represented as a set of side chain rotamers derived from a backbone-independent rotamer library using a flexible rotamer model. SPA calculations will generate sequences which will be subsequently clustered computationally into groups of similar sequences using a nearest neighbor single linkage hierarchical clustering algorithm. Critical contact amino acids will be fixed in both sequence and conformation and calculations will be carried out to evaluate single and combinatorial substitutions at variable amino acids. All amino acids in contact with these residues will be floated, that is the amino acid conformation but not the amino acid identity will be allowed to vary to allow for conformational adjustments. Final experimental substitutions will be chosen based on their predicted energies relative to the naturally occurring BoNT/A binding domain and their occupancy, that is the number times the substitution occurred in the set of 1000 MC or genetic algorithm sequences. Two sets of design calculations will be carried out using Rosetta to identify substitutions predicted to stabilize the BoNT/A binding domain. In the first round, only single amino acid substitutions will be modeled. In a second round, interface amino acids will be allowed to change to all 20 naturally occurring amino acids including the native amino acid type, but excluding cysteine, simultaneously. In each case, amino acid side chains contacting the substituted amino acid side chains will be repacked (allowing all rotamers of the native amino acid type). Sequences and conformations with low energies will be selected using a Monte-Carlo simulated annealing procedure. All resulting protein complex models will be rescored by computing a predicted binding energy. Final sequences were selected for the lowest binding energy
[1003] Identified candidate amino acids will be changed using site-directed in vitro mutagenesis. A 50 μL reaction will be assembled using pET29/BoNT/A as a template, sense and antisense oligonucleotides encoding the desired amino acid change identified above, and reagents included with the QuickChange® II XL Site-Directed Mutagenesis kit (Stratagene, La Jolla, Calif.). The polymerase chain reaction (PCR) mix will contain 5 μL of 10× Buffer, 1 μL of deoxyribonucleotides (dNTPs), 1 μL of PfuUltra® High Fidelity DNA polymerase (2.5 units/μL), 125 ng of each primer, 100 ng of template DNA, and nuclease-free water to a final volume of 50 μL. The thermocycler conditions will be: one cycle of 95° C. for 60 seconds; 16 cycles of 95° C. for 30 seconds, 55° C. for 60 seconds, and 72° C. for 10 minutes; one cycle of 72° C. for 5 minutes; and 4° C. to hold. Following thermocycling, 1 μL of Dpnl restriction enzyme (Stratagene, La Jolla, Calif.) will be added to the reaction and will be incubated for 1 hour at 37° C. to digest the template DNA. The reaction will be purified by QIAquick kit (QIAGEN, Inc., Valencia, Calif.) and will be analysis by agarose gel electrophoresis to determine that the reaction produced full-length plasmid. The mutagenesis products will be transformed into chemically competent E. coli DH5α cells (Invitrogen, Inc, Carlsbad, Calif.) using a heat shock method, plated on 1.5% Luria-Bertani agar plates (pH 7.0) containing 100 μg/mL of Ampicillin, and will be placed in a 37° C. incubator for overnight growth. Candidate mutagenesis constructs will be isolated as Ampicillin resistant colonies and will be analyzed using an alkaline lysis plasmid mini-preparation procedure to isolate the expression construct and restriction endonuclease digests to determine the presence of the insert. The incorporation of the point mutation will be determined by sequence analysis of candidate plasmid constructs.
[1004] To test the binding activity of modified BoNT/A candidates with enhanced binding activity, the soluble portion of FGFR3 will be expressed recombinantly for use in surface plasmon resonance (SPR) binding assays, e.g., Biacore® (Biacore Inc., Piscataway, N.J.). The soluble portion of FGFR3 will be expressed as a fusion to streptavidin and the receptor will then be immobilized on an appropriate sensor chip. Utilizing a Biacore® instrument, changes in local refractive index as a result of receptor binding will be measured as a change in the SPR angle. The rates of change in the SPR angle will then be analyzed to determine association rate (Kon), dissociation rate (Koff) and the dissociation equilibrium constant (KD=Koff/Kon). Modified BoNT/A candidates with enhanced binding activity will exhibit either an increased association rate, a decreased dissociation rate, both an increased association rate and a decreased dissociation rate, or a decreased dissociation equilibrium constant relative to the measurements obtained from the naturally occurring BoNT/A from which the modified BoNT/A with enhanced binding activity was derived.
[1005] To construct a modified BoNT/A described above that replaces the BoNT/A translocation facilitating domain with another Clostridial toxin translocation facilitating domain, a translocation facilitating domain of BoNT/B will be introduced into the modified BoNT/A described above using a Splicing by Overlapping ends polymerase chain reaction (SOE-PCR) procedure, see, e.g., R. M. Horton et al., Engineering hybrid genes without the use of restriction enzymes: gene splicing by overlapping extension, 77(1) Gene 61-68 (1989); and R. M. Horton, PCR-mediated recombination and mutagenesis. SOEing together tailor-made genes, 3(2) Mol. Biotechnol. 93-99 (1995). A nucleic acid fragment comprising a region encoding amino acids 859 to 1097 of BoNT/B (SEQ ID NO: 2) will be operably-linked by SOE-PCR to replace the region corresponding to the BoNT/A translocation facilitating domain of amino acids 874-1110 of SEQ ID NO: 1 of the modified BoNT/A described above and will be subcloned into a pCR2.1 vector using the TOPO® TA cloning method (Invitrogen, Inc, Carlsbad, Calif.). The forward and reverse oligonucleotide primers used for these reactions are designed to include unique restriction enzyme sites useful for subsequent subcloning steps. The resulting construct is digested with restriction enzymes that 1) excise the insert containing the entire open reading frame encoding the modified BoNT/A; and 2) enable this insert to be operably-linked to a pQBI-25A vector (Qbiogene, Inc., Carlsbad, Calif.). The resulting restriction fragment will be purified by the QIAquick Gel Extraction Kit (QIAGEN, Inc., Valencia, Calif.), and will be subcloned using a T4 DNA ligase procedure into a pQBI-25A vector (Qbiogene, Inc., Irvine, Calif.). This cloning strategy yielded a pQBI-25 expression construct encoding a modified BoNT/A comprising a BoNT/B translocation facilitating domain and a modified HCC targeting domain with enhanced binding activity.
[1006] A similar cloning strategy is used to make pQBI-25 expression constructs comprising a polynucleotide molecule encoding a modified BoNT/A comprising a modified targeting domain with enhanced binding activity that includes, e.g., a translocation facilitating domain comprising amino acids 869-1111 of BoNT/C1 of SEQ ID NO: 3; a translocation facilitating domain comprising amino acids 865-1098 of BoNT/D of SEQ ID NO: 4; a translocation facilitating domain comprising amino acids 846-1058 of BoNT/E of SEQ ID NO: 5; a translocation facilitating domain comprising amino acids 867-1105 of BoNT/F of SEQ ID NO: 6; a translocation facilitating domain comprising amino acids 866-1105 of BoNT/G of SEQ ID NO: 7; or a translocation facilitating domain comprising amino acids 882-1127 of TeNT of SEQ ID NO: 8.
Example 2
Construction of a Modified Clostridial Toxin Comprising a Translocation Facilitating Domain and a Non-Toxin Associated Protein
[1007] The following example illustrates how to make a modified Clostridial toxin comprising a translocation facilitating domain and an enhanced targeting domain comprising a non-toxin associated protein.
[1008] A polynucleotide molecule encoding BoNT/A-33/A is synthesized using standard procedures (BlueHeron® Biotechnology, Bothell, Wash.), as described in Example 1. BoNT/A-33/A is a BoNT/A modified to replace amino acids 1111-1296 of SEQ ID NO: 1, a BoNT/A β-trefoil domain, with amino acids 151 to 293 of SEQ ID NO: 9, a HA-33 β-trefoil domain from a Clostridial botulinum serotype A strain. If desired, an expression optimized polynucleotide molecule encoding BoNT/A-33/A can be synthesized in order to improve expression in to a different organism, such as, e.g., an Escherichia coli strain, a yeast strain, an insect cell-line or a mammalian cell line, can be done, see, e.g., Steward, supra, PCT Patent Serial No. 2005/020578 (Jun. 9, 2005); and Steward, supra, PCT Patent Serial No. 2005/027917 (Aug. 3, 2005). The synthesized polynucleotide molecule is verified by sequencing using Big Dye Terminator® Chemistry 3.1 (Applied Biosystems, Foster City, Calif.) and an ABI 3100 sequencer (Applied Biosystems, Foster City, Calif.).
[1009] A similar cloning strategy is used to make pUCBHB1 cloning constructs for BoNT/B-33/A, a modified BoNT/B where amino acids 1098-1291 of SEQ ID NO: 2 are replaced with amino acids 151 to 293 of SEQ ID NO: 9; BoNT/C1-33/A, a modified BoNT/C1 where amino acids 1112-1291 of SEQ ID NO: 3 are replaced with amino acids 151 to 293 of SEQ ID NO: 9; BoNT/D-33/A, a modified BoNT/D where amino acids 1099-1276 of SEQ ID NO: 4 are replaced with amino acids 151 to 293 of SEQ ID NO: 9; BoNT/E-33/A, a modified BoNT/E where amino acids 1086-1252 of SEQ ID NO: 5 are replaced with amino acids 151 to 293 of SEQ ID NO: 9; BoNT/F-33/A, a modified BoNT/F where amino acids 1106-1274 of SEQ ID NO: 6 are replaced with amino acids 151 to 293 of SEQ ID NO: 9; BoNT/G-33/A, a modified BoNT/G where amino acids 1106-1297 of SEQ ID NO: 7 are replaced with amino acids 151 to 293 of SEQ ID NO: 9; and TeNT-33/A, a modified TeNT where amino acids 1128-1315 of SEQ ID NO: 8 are replaced with amino acids 151 to 293 of SEQ ID NO: 9. Similarly, the β-trefoil domain from a Clostridial toxin indicated above can be replaced with a non-toxin associated protein β-trefoil domain comprising amino acids 10-144 of SEQ ID NO: 9; amino acids 10-144 of SEQ ID NO: 10; amino acids 10-144 of SEQ ID NO: 11; amino acids 10-146 of SEQ ID NO: 12; amino acids 10-144 of SEQ ID NO: 13; amino acids 10-144 of SEQ ID NO: 14; amino acids 10-146 of SEQ ID NO: 15; amino acids 10-141 of SEQ ID NO: 16; amino acids 10-141 of SEQ ID NO: 17; amino acids 10-141 of SEQ ID NO: 18; amino acids 151-293 of SEQ ID NO: 10; amino acids 151-293 of SEQ ID NO: 11; amino acids 153-294 of SEQ ID NO: 12; amino acids 151-279 of SEQ ID NO: 13; amino acids 151-292 of SEQ ID NO: 14; amino acids 153-291 of SEQ ID NO: 15; amino acids 148-285 of SEQ ID NO: 16; amino acids 148-286 of SEQ ID NO: 17; amino acids 148-286 of SEQ ID NO: 18; amino acids 9-146 of SEQ ID NO: 19; amino acids 9-146 of SEQ ID NO: 20; amino acids 9-146 of SEQ ID NO: 21; amino acids 9-146 of SEQ ID NO: 22; amino acids 1050-1194 of SEQ ID NO: 23; amino acids 1050-1199 of SEQ ID NO: 24; amino acids 1050-1194 of SEQ ID NO: 25; amino acids 1049-1198 of SEQ ID NO: 26; amino acids 1049-1197 of SEQ ID NO: 27; amino acids 1049-1197 of SEQ ID NO: 28; amino acids 1014-1163 of SEQ ID NO: 29; amino acids 1016-1160 of SEQ ID NO: 30; amino acids 1017-1166 of SEQ ID NO: 31; and amino acids 1050-1199 of SEQ ID NO: 32.
[1010] To construct pET29/BoNT/A-33/A, a pUCBHB1/BoNT/A-33/A construct is digested with restriction endonucleases that 1) excise the insert comprising the open reading frame encoding BoNT/A-33/A; and 2) enable this insert to be operably-linked to a pET29 vector (EMD Biosciences-Novagen, Madison, Wis.). This insert is subcloned using a T4 DNA ligase procedure into a pET29 vector that is digested with appropriate restriction endonucleases to yield pET29/BoNT/A-33/A. The ligation mixture is transformed into chemically competent E. coli DH5α cells (Invitrogen, Inc, Carlsbad, Calif.) using a heat shock method, plated on 1.5% Luria-Bertani agar plates (pH 7.0) containing 50 μg/mL of Kanamycin, and placed in a 37° C. incubator for overnight growth. Bacteria containing expression constructs are identified as Kanamycin resistant colonies. Candidate constructs are isolated using an alkaline lysis plasmid mini-preparation procedure and analyzed by restriction endonuclease digest mapping to determine the presence and orientation of the insert. This cloning strategy yielded a pET29 expression construct comprising the polynucleotide molecule encoding BoNT/A-33/A operably-linked to a carboxyl terminal polyhistidine affinity binding peptide.
[1011] A similar cloning strategy is used to make pET29 expression constructs comprising a polynucleotide molecule encoding for BoNT/B-33/A, BoNT/C1-33/A, BoNT/D-33/A, BoNT/E-33/A, BoNT/F-33/A, BoNT/G-33/A, TeNT-33/A, as well as the modified Clostridial toxin indicated above comprising amino acids 10-144 of SEQ ID NO: 9; amino acids 10-144 of SEQ ID NO: 10; amino acids 10-144 of SEQ ID NO: 11; amino acids 10-146 of SEQ ID NO: 12; amino acids 10-144 of SEQ ID NO: 13; amino acids 10-144 of SEQ ID NO: 14; amino acids 10-146 of SEQ ID NO: 15; amino acids 10-141 of SEQ ID NO: 16; amino acids 10-141 of SEQ ID NO: 17; amino acids 10-141 of SEQ ID NO: 18; amino acids 151-293 of SEQ ID NO: 10; amino acids 151-293 of SEQ ID NO: 11; amino acids 153-294 of SEQ ID NO: 12; amino acids 151-279 of SEQ ID NO: 13; amino acids 151-292 of SEQ ID NO: 14; amino acids 153-291 of SEQ ID NO: 15; amino acids 148-285 of SEQ ID NO: 16; amino acids 148-286 of SEQ ID NO: 17; amino acids 148-286 of SEQ ID NO: 18; amino acids 9-146 of SEQ ID NO: 19; amino acids 9-146 of SEQ ID NO: 20; amino acids 9-146 of SEQ ID NO: 21; amino acids 9-146 of SEQ ID NO: 22; amino acids 1050-1194 of SEQ ID NO: 23; amino acids 1050-1199 of SEQ ID NO: 24; amino acids 1050-1194 of SEQ ID NO: 25; amino acids 1049-1198 of SEQ ID NO: 26; amino acids 1049-1197 of SEQ ID NO: 27; amino acids 1049-1197 of SEQ ID NO: 28; amino acids 1014-1163 of SEQ ID NO: 29; amino acids 1016-1160 of SEQ ID NO: 30; amino acids 1017-1166 of SEQ ID NO: 31; and amino acids 1050-1199 of SEQ ID NO: 32.
[1012] To construct a BoNT/A-33/A that replaces the BoNT/A translocation facilitating domain with another Clostridial toxin translocation facilitating domain, a translocation facilitating domain of BoNT/B will be introduced into the BoNT/A-33/A as described above using a Splicing by Overlapping ends polymerase chain reaction (SOE-PCR) procedure, see, e.g., R. M. Horton et al., Engineering hybrid genes without the use of restriction enzymes: gene splicing by overlapping extension, 77(1) Gene 61-68 (1989); and R. M. Horton, PCR-mediated recombination and mutagenesis. SOEing together tailor-made genes, 3(2) Mol. Biotechnol. 93-99 (1995). A nucleic acid fragment comprising a region encoding amino acids 859 to 1097 of BoNT/B (SEQ ID NO: 2) will be operably-linked by SOE-PCR to replace the region corresponding to the BoNT/A translocation facilitating domain comprising amino acids 874-1110 of SEQ ID NO: 1 of the BoNT/A-33/A and will be subcloned into a pCR2.1 vector using the TOPO® TA cloning method (Invitrogen, Inc, Carlsbad, Calif.). The forward and reverse oligonucleotide primers used for these reactions are designed to include unique restriction enzyme sites useful for subsequent subcloning steps. The resulting construct is digested with restriction enzymes that 1) excise the insert containing the entire open reading frame encoding the modified BoNT/A-33/A; and 2) enable this insert to be operably-linked to a pQBI-25A vector (Qbiogene, Inc., Carlsbad, Calif.). The resulting restriction fragment will be purified by the QIAquick Gel Extraction Kit (QIAGEN, Inc., Valencia, Calif.), and will be subcloned using a T4 DNA ligase procedure into a pQBI-25A vector (Qbiogene, Inc., Irvine, Calif.). This cloning strategy yielded a pQBI-25 expression construct encoding a BoNT/A-33/A comprising a BoNT/B translocation facilitating domain.
[1013] A similar cloning strategy is used to make pQBI-25 expression constructs comprising a polynucleotide molecule encoding a BoNT/A-33/A that includes, e.g., a translocation facilitating domain comprising amino acids 869-1111 of BoNT/C1 of SEQ ID NO: 3; a translocation facilitating domain comprising amino acids 865-1098 of BoNT/D of SEQ ID NO: 4; a translocation facilitating domain comprising amino acids 846-1058 of BoNT/E of SEQ ID NO: 5; a translocation facilitating domain comprising amino acids 867-1105 of BoNT/F of SEQ ID NO: 6; a translocation facilitating domain comprising amino acids 866-1105 of BoNT/G of SEQ ID NO: 7; or a translocation facilitating domain comprising amino acids 882-1127 of TeNT of SEQ ID NO: 8, as well as the modified Clostridial toxin indicated above comprising amino acids 10-144 of SEQ ID NO: 9; amino acids 10-144 of SEQ ID NO: 10; amino acids 10-144 of SEQ ID NO: 11; amino acids 10-146 of SEQ ID NO: 12; amino acids 10-144 of SEQ ID NO: 13; amino acids 10-144 of SEQ ID NO: 14; amino acids 10-146 of SEQ ID NO: 15; amino acids 10-141 of SEQ ID NO: 16; amino acids 10-141 of SEQ ID NO: 17; amino acids 10-141 of SEQ ID NO: 18; amino acids 151-293 of SEQ ID NO: 10; amino acids 151-293 of SEQ ID NO: 11; amino acids 153-294 of SEQ ID NO: 12; amino acids 151-279 of SEQ ID NO: 13; amino acids 151-292 of SEQ ID NO: 14; amino acids 153-291 of SEQ ID NO: 15; amino acids 148-285 of SEQ ID NO: 16; amino acids 148-286 of SEQ ID NO: 17; amino acids 148-286 of SEQ ID NO: 18; amino acids 9-146 of SEQ ID NO: 19; amino acids 9-146 of SEQ ID NO: 20; amino acids 9-146 of SEQ ID NO: 21; amino acids 9-146 of SEQ ID NO: 22; amino acids 1050-1194 of SEQ ID NO: 23; amino acids 1050-1199 of SEQ ID NO: 24; amino acids 1050-1194 of SEQ ID NO: 25; amino acids 1049-1198 of SEQ ID NO: 26; amino acids 1049-1197 of SEQ ID NO: 27; amino acids 1049-1197 of SEQ ID NO: 28; amino acids 1014-1163 of SEQ ID NO: 29; amino acids 1016-1160 of SEQ ID NO: 30; amino acids 1017-1166 of SEQ ID NO: 31; and amino acids 1050-1199 of SEQ ID NO: 32.
Example 3
Construction of a Modified Clostridial Toxin Comprising a Translocation Facilitating Domain and a Non-Toxin Associated Protein Fold
[1014] The following example illustrates how to make a modified Clostridial toxin comprising a translocation facilitating domain and an enhanced targeting domain comprising a non-toxin associated protein fold.
[1015] A polynucleotide molecule encoding BoNT/A-17γ/A is synthesized using standard procedures (BlueHeron® Biotechnology, Bothell, Wash.), as described in Example 1. BoNT/A-17γ/A is a BoNT/A modified to replace amino acids 1237-1296 of SEQ ID NO: 1, a γ-fold from a BoNT/A β-trefoil domain, with amino acids 95 to 146 of SEQ ID NO: 19, a γ-fold from a HA-17 β-trefoil domain from a Clostridial botulinum serotype A strain. If desired, an expression optimized polynucleotide molecule encoding BoNT/A-17γ/A can be synthesized in order to improve expression in to a different organism, such as, e.g., an Escherichia coli strain, a yeast strain, an insect cell-line or a mammalian cell line, can be done, see, e.g., Steward, supra, PCT Patent Serial No. 2005/020578 (Jun. 9, 2005); and Steward, supra, PCT Patent Serial No. 2005/027917 (Aug. 3, 2005). The synthesized polynucleotide molecule is verified by sequencing using Big Dye Terminator® Chemistry 3.1 (Applied Biosystems, Foster City, Calif.) and an ABI 3100 sequencer (Applied Biosystems, Foster City, Calif.).
[1016] A similar cloning strategy is used to make pUCBHB1 cloning constructs for BoNT/B-17γ/A, a modified BoNT/B where amino acids 1223-1291 of SEQ ID NO: 2 are replaced with amino acids 95 to 146 of SEQ ID NO: 19; BoNT/C1-F18γ, a modified BoNT/C1 where amino acids 1230-1291 of SEQ ID NO: 3 are replaced with amino acids 95 to 146 of SEQ ID NO: 19; BoNT/D-17γ/A, a modified BoNT/D where amino acids 1219-1276 of SEQ ID NO: 4 are replaced with amino acids 95 to 146 of SEQ ID NO: 19; BoNT/E-17γ/A, a modified BoNT/E where amino acids 1199-1252 of SEQ ID NO: 5 are replaced with amino acids 95 to 146 of SEQ ID NO: 19; BoNT/F-17γ/A, a modified BoNT/F where amino acids 1222-1274 of SEQ ID NO: 6 are replaced with amino acids 95 to 146 of SEQ ID NO: 19; BoNT/G-17γ/A, a modified BoNT/G where amino acids 1231-1297 of SEQ ID NO: 7 are replaced with amino acids 95 to 146 of SEQ ID NO: 19; and TeNT-17γ/A, a modified TeNT where amino acids 1255-1315 of SEQ ID NO: 8 are replaced with amino acids 95 to 146 of SEQ ID NO: 19.
[1017] Similarly, the γ-fold from a HA-17/A β-trefoil domain can replace amino acids 1111-1162 of SEQ ID NO: 1, an α-fold from a BoNT/A β-trefoil domain; amino acids 1098-1147 of SEQ ID NO: 2, an α-fold from a BoNT/B β-trefoil domain; amino acids 1112-1150 of SEQ ID NO: 3, an α-fold from a BoNT/C1 trefoil domain; amino acids 1099-1137 of SEQ ID NO: 4, an α-fold from a BoNT/D β-trefoil domain; amino acids 1086-1129 of SEQ ID NO: 5, an α-fold from a BoNT/E β-trefoil domain; amino acids 1106-1152 of SEQ ID NO: 6, an α-fold from a BoNT/F β-trefoil domain; amino acids 1106-1153 of SEQ ID NO: 7, an α-fold from a BoNT/G β-trefoil domain; or amino acids 1128-1177 of SEQ ID NO: 8, an α-fold from a TeNT β-trefoil domain. Similarly, the γ-fold from a HA-17/Aβ-trefoil domain can replace amino acids 1179-1223 of SEQ ID NO: 1, a β-fold from a BoNT/A β-trefoil domain; amino acids 1166-1210 of SEQ ID NO: 2, a β-fold from a BoNT/B β-trefoil domain; amino acids 1167-1218 of SEQ ID NO: 3, a β-fold from a BoNT/C1 β-trefoil domain; amino acids 1154-1207 of SEQ ID NO: 4, a β-fold from a BoNT/D β-trefoil domain; amino acids 1147-1190 of SEQ ID NO: 5, a β-fold from a BoNT/E β-trefoil domain; amino acids 1172-1213 of SEQ ID NO: 6, a β-fold from a BoNT/F β-trefoil domain; amino acids 1173-1218 of SEQ ID NO: 7, a β-fold from a BoNT/G β-trefoil domain; or amino acids 1195-1240 of SEQ ID NO: 8, a β-fold from a TeNT β-trefoil domain.
[1018] Similarly, an α-fold, β-fold or γ-fold from a β-trefoil domain from a Clostridial toxin indicated above can be replaced with a HA-17 γ-fold comprising amino acids 95-146 of SEQ ID NO: 20, amino acids 95-146 of SEQ ID NO: 21, or amino acids 95-146 of SEQ ID NO: 22; a HA-33 γ-fold comprising amino acids 105-144 of SEQ ID NO: 9, amino acids 105-144 of SEQ ID NO: 10, amino acids 105-144 of SEQ ID NO: 11, amino acids 107-146 of SEQ ID NO: 12, amino acids 105-144 of SEQ ID NO: 13, amino acids 105-144 of SEQ ID NO: 14, amino acids 107-146 of SEQ ID NO: 15, amino acids 103-141 of SEQ ID NO: 16, amino acids 103-141 of SEQ ID NO: 17, amino acids 103-141 of SEQ ID NO: 18, amino acids 249-293 of SEQ ID NO: 9, amino acids 249-293 of SEQ ID NO: 10, amino acids 249-293 of SEQ ID NO: 11, amino acids 250-294 of SEQ ID NO: 12, amino acids 249-279 of SEQ ID NO: 13, amino acids 248-292 of SEQ ID NO: 14, amino acids 249-291 of SEQ ID NO: 15, amino acids 241-285 of SEQ ID NO: 16, amino acids 242-286 of SEQ ID NO: 17, or amino acids 242-286 of SEQ ID NO: 18; or a NTNH γ-fold comprising amino acids 1149-1194 of SEQ ID NO: 23, amino acids 1149-1199 of SEQ ID NO: 24, amino acids 1149-1194 of SEQ ID NO: 25, amino acids 1148-1198 of SEQ ID NO: 26, amino acids 1148-1197 of SEQ ID NO: 27, amino acids 1148-1197 of SEQ ID NO: 28, amino acids 1114-1163 of SEQ ID NO: 29, amino acids 1115-1160 of SEQ ID NO: 30, amino acids 1117-1166 of SEQ ID NO: 31, or amino acids 1150-1199 of SEQ ID NO: 32.
[1019] Likewise, an α-fold, β-fold or γ-fold from a β-trefoil domain from a Clostridial toxin indicated above can be replaced with a HA-17 α-fold comprising amino acids 9-50 of SEQ ID NO: 19, amino acids 9-50 of SEQ ID NO: 20, amino acids 9-50 of SEQ ID NO: 21, or amino acids 9-50 of SEQ ID NO: 22; a HA-33 α-fold comprising amino acids 10-54 of SEQ ID NO: 9, amino acids 10-54 of SEQ ID NO: 10, amino acids 10-54 of SEQ ID NO: 11, amino acids 10-56 of SEQ ID NO: 12, amino acids 10-54 of SEQ ID NO: 13, amino acids 10-54 of SEQ ID NO: 14, amino acids 10-56 of SEQ ID NO: 15, amino acids 10-54 of SEQ ID NO: 16, amino acids 10-54 of SEQ ID NO: 17, amino acids 10-54 of SEQ ID NO: 18, amino acids 151-195 of SEQ ID NO: 9, amino acids 151-195 of SEQ ID NO: 10, amino acids 151-195 of SEQ ID NO: 11, amino acids 153-197 of SEQ ID NO: 12, amino acids 151-195 of SEQ ID NO: 13, amino acids 151-195 of SEQ ID NO: 14, amino acids 153-197 of SEQ ID NO: 15, amino acids 148-190 of SEQ ID NO: 16, amino acids 148-190 of SEQ ID NO: 17, or amino acids 148-190 of SEQ ID NO: 18; or a NTNH α-fold comprising amino acids 1050-1097 of SEQ ID NO: 23, amino acids 1050-1097 of SEQ ID NO: 24, amino acids 1050-1097 of SEQ ID NO: 25, amino acids 1049-1096 of SEQ ID NO: 26, amino acids 1049-1096 of SEQ ID NO: 27, amino acids 1049-1096 of SEQ ID NO: 28, amino acids 1014-1061 of SEQ ID NO: 29, amino acids 1016-1063 of SEQ ID NO: 30, amino acids 1017-1064 of SEQ ID NO: 31, or amino acids 1050-1097 of SEQ ID NO: 32.
[1020] Further, an α-fold, β-fold or γ-fold from a β-trefoil domain from a Clostridial toxin indicated above can be replaced with a HA-17 β-fold comprising amino acids 55-91 of SEQ ID NO: 19, amino acids 55-91 of SEQ ID NO: 20, amino acids 55-91 of SEQ ID NO: 21, or amino acids 55-91 of SEQ ID NO: 22; a HA-33 β-fold comprising amino acids 60-100 of SEQ ID NO: 9, amino acids 60-100 of SEQ ID NO: 10, amino acids 60-100 of SEQ ID NO: 11, amino acids 62-102 of SEQ ID NO: 12, amino acids 60-100 of SEQ ID NO: 13, amino acids 60-100 of SEQ ID NO: 14, amino acids 62-102 of SEQ ID NO: 15, amino acids 60-98 of SEQ ID NO: 16, amino acids 60-98 of SEQ ID NO: 17, amino acids 60-98 of SEQ ID NO: 18, amino acids 200-242 of SEQ ID NO: 9, amino acids 200-242 of SEQ ID NO: 10, amino acids 200-242 of SEQ ID NO: 11, amino acids 202-243 of SEQ ID NO: 12, amino acids 200-242 of SEQ ID NO: 13, amino acids 200-241 of SEQ ID NO: 14, amino acids 200-242 of SEQ ID NO: 15, amino acids 195-234 of SEQ ID NO: 16, amino acids 195-235 of SEQ ID NO: 17, or amino acids 195-235 of SEQ ID NO: 18; or a NTNH β-fold comprising amino acids 1111-1138 of SEQ ID NO: 23, amino acids 1111-1139 of SEQ ID NO: 24, amino acids 1111-1138 of SEQ ID NO: 25, amino acids 1110-1138 of SEQ ID NO: 26, amino acids 1110-1138 of SEQ ID NO: 27, amino acids 1110-1138 of SEQ ID NO: 28, amino acids 1075-1103 of SEQ ID NO: 29, amino acids 1077-1104 of SEQ ID NO: 30, amino acids 1078-1106 of SEQ ID NO: 31, or amino acids 1111-1139 of SEQ ID NO: 32.
[1021] To construct pET29/BoNT/A-17γ/A, a pUCBHB1/BoNT/A-17γ/A construct is digested with restriction endonucleases that 1) excise the insert comprising the open reading frame encoding BoNT/A-17γ/A; and 2) enable this insert to be operably-linked to a pET29 vector (EMD Biosciences-Novagen, Madison, Wis.). This insert is subcloned using a T4 DNA ligase procedure into a pET29 vector that is digested with appropriate restriction endonucleases to yield pET29/BoNT/A-17γ/A. The ligation mixture is transformed into chemically competent E. coli DH5α cells (Invitrogen, Inc, Carlsbad, Calif.) using a heat shock method, plated on 1.5% Luria-Bertani agar plates (pH 7.0) containing 50 μg/mL of Kanamycin, and placed in a 37° C. incubator for overnight growth. Bacteria containing expression constructs are identified as Kanamycin resistant colonies. Candidate constructs are isolated using an alkaline lysis plasmid mini-preparation procedure and analyzed by restriction endonuclease digest mapping to determine the presence and orientation of the insert. This cloning strategy yielded a pET29 expression construct comprising the polynucleotide molecule encoding BoNT/A-17γ/A operably-linked to a carboxyl terminal polyhistidine affinity binding peptide.
[1022] A similar cloning strategy is used to make pET29 expression constructs comprising a polynucleotide molecule encoding BoNT/B-17γ/A, BoNT/C1-17γ/A, BoNT/D-17γ/A, BoNT/E-17γ/A, BoNT/F-17γ/A, BoNT/G-17γ/A, TeNT-17γ/A, BoNT/A-33-1γ/A, BoNT/B-33-1γ/A, BoNT/C1-33-1γ/A, BoNT/D-33-1γ/A, BoNT/E-33-1 γ/A, BoNT/F-33-1γ/A, BoNT/G-33-1γ/A, TeNT-33-1γ/A, BoNT/A-33-2γ/A, BoNT/B-33-2γ/A, BoNT/C1-33-2γ/A, BoNT/D-33-2γ/A, BoNT/E-33-2γ/A, BoNT/F-33-2γ/A, BoNT/G-33-2γ/A, TeNT-33-2γ/A, BoNT/B-NTNHγ/A, BoNT/B-NTNHγ/A, BoNT/C1-NTNHγ/A, BoNT/D-NTNHγ/A, BoNT/E-NTNHγ/A, BoNT/F-NTNHγ/A, BoNT/G-NTNHγ/A, TeNT-NTNHγ/A, BoNT/A-17α/A, BoNT/B-17α/A, BoNT/C1-17α/A, BoNT/D-17α/A, BoNT/E-17α/A, BoNT/F-17α/A, BoNT/G-17α/A, TeNT-17α/A, BoNT/A-33-1α/A, BoNT/B-33-1α/A, BoNT/C1-33-1α/A, BoNT/D-33-1α/A, BoNT/E-33-1α/A, BoNT/F-33-1α/A, BoNT/G-33-1α/A, TeNT-33-1α/A, BoNT/A-33-2α/A, BoNT/B-33-2α/A, BoNT/C1-33-2α/A, BoNT/D-33-2α/A, BoNT/E-33-2α/A, BoNT/F-33-2α/A, BoNT/G-33-2α/A, TeNT-33-2α/A, BoNT/B-NTNHα/A, BoNT/B-NTNHα/A, BoNT/C1-NTNHα/A, BoNT/D-NTNHα/A, BoNT/E-NTNHα/A, BoNT/F-NTNHα/A, BoNT/G-NTNHα/A, TeNT-NTNHa, BoNT/A-17β/A, BoNT/B-17β/A, BoNT/C1-17β/A, BoNT/D-17β/A, BoNT/E-17β/A, BoNT/F-17β/A, BoNT/G-17β/A, TeNT-17β/A, BoNT/A-33-1β/A, BoNT/B-33-1β/A, BoNT/C1-33-1β/A, BoNT/D-33-1β/A, BoNT/E-33-1β/A, BoNT/F-33-1β/A, BoNT/G-33-1β/A, TeNT-33-1β/A, BoNT/A-33-2β/A, BoNT/B-33-2β/A, BoNT/C1-33-2β/A, BoNT/D-33-2β/A, BoNT/E-33-2β/A, BoNT/F-33-2β/A, BoNT/G-33-2β/A, TeNT-33-2β/A, BoNT/B-NTNHβ/A, BoNT/B-NTNHβ/A, BoNT/C1-NTNHβ/A, BoNT/D-NTNHβ/A, BoNT/E-NTNHβ/A, BoNT/F-NTNHβ/A, BoNT/G-NTNHβ/A, TeNT-NTNHβ.
[1023] A similar cloning strategy is also used to make pET29 expression constructs comprising a polynucleotide molecule encoding a modified Clostridial toxin indicated above that has its α-fold or β-fold replaced by amino acids comprising a HA-17 α-fold, β-fold or γ-fold; amino acids comprising a HA-33 1α-fold, 1β-fold, 1γ-fold, 2α-fold, 26-fold, or 2γ-fold; or amino acids comprising a NTNH α-fold, β-fold or γ-fold.
[1024] To construct a BoNT/A-17γ/A that replaces the BoNT/A translocation facilitating domain with another Clostridial toxin translocation facilitating domain, a translocation facilitating domain of BoNT/B will be introduced into the BoNT/A-17γ/A as described above using a Splicing by Overlapping ends polymerase chain reaction (SOE-PCR) procedure, see, e.g., R. M. Horton et al., Engineering hybrid genes without the use of restriction enzymes: gene splicing by overlapping extension, 77(1) Gene 61-68 (1989); and R. M. Horton, PCR-mediated recombination and mutagenesis. SOEing together tailor-made genes, 3(2) Mol. Biotechnol. 93-99 (1995). A nucleic acid fragment comprising a region encoding amino acids 859 to 1097 of BoNT/B (SEQ ID NO: 2) will be operably-linked by SOE-PCR to replace the region corresponding to the BoNT/A translocation facilitating domain comprising amino acids 874-1110 of SEQ ID NO: 1 of the BoNT/A-17γ/A and will be subcloned into a pCR2.1 vector using the TOPO® TA cloning method (Invitrogen, Inc, Carlsbad, Calif.). The forward and reverse oligonucleotide primers used for these reactions are designed to include unique restriction enzyme sites useful for subsequent subcloning steps. The resulting construct is digested with restriction enzymes that 1) excise the insert containing the entire open reading frame encoding the modified BoNT/A-17γ/A; and 2) enable this insert to be operably-linked to a pQBI-25A vector (Qbiogene, Inc., Carlsbad, Calif.). The resulting restriction fragment will be purified by the QIAquick Gel Extraction Kit (QIAGEN, Inc., Valencia, Calif.), and will be subcloned using a T4 DNA ligase procedure into a pQBI-25A vector (Qbiogene, Inc., Irvine, Calif.). This cloning strategy yielded a pQBI-25 expression construct encoding a BoNT/A-17γ/A comprising a BoNT/B translocation facilitating domain.
[1025] A similar cloning strategy is used to make pQBI-25 expression constructs comprising a polynucleotide molecule encoding a BoNT/A-17γ/A that includes, e.g., a translocation facilitating domain comprising amino acids 869-1111 of BoNT/C1 of SEQ ID NO: 3; a translocation facilitating domain comprising amino acids 865-1098 of BoNT/D of SEQ ID NO: 4; a translocation facilitating domain comprising amino acids 846-1058 of BoNT/E of SEQ ID NO: 5; a translocation facilitating domain comprising amino acids 867-1105 of BoNT/F of SEQ ID NO: 6; a translocation facilitating domain comprising amino acids 866-1105 of BoNT/G of SEQ ID NO: 7; or a translocation facilitating domain comprising amino acids 882-1127 of TeNT of SEQ ID NO: 8.
[1026] Likewise, as well as, a polynucleotide molecule encoding a Clostridial translocation facilitating domain as described above can be introduced into a polynucleotide molecule encoding BoNT/B-17γ/A, BoNT/C1-17γ/A, BoNT/D-17γ/A, BoNT/E-17γ/A, BoNT/F-17γ/A, BoNT/G-17γ/A, TeNT-17γ/A, BoNT/A-33-1γ/A, BoNT/B-33-1 γ/A, BoNT/C1-33-1γ/A, BoNT/D-33-1 γ/A, BoNT/E-33-1 γ/A, BoNT/F-33-1γ/A, BoNT/G-33-1γ/A, TeNT-33-1γ/A, BoNT/A-33-2γ/A, BoNT/B-33-2γ/A, BoNT/C1-33-2γ/A, BoNT/D-33-2γ/A, BoNT/E-33-2γ/A, BoNT/F-33-2γ/A, BoNT/G-33-2γ/A, TeNT-33-2γ/A, BoNT/B-NTNHγ/A, BoNT/B-NTNHγ/A, BoNT/C1-NTNHγ/A, BoNT/D-NTNHγ/A, BoNT/E-NTNHγ/A, BoNT/F-NTNHγ/A, BoNT/G-NTNHγ/A, TeNT-NTNHγ/A, BoNT/A-17α/A, BoNT/B-17α/A, BoNT/C1-17α/A, BoNT/D-17α/A, BoNT/E-17α/A, BoNT/F-17α/A, BoNT/G-17α/A, TeNT-17α/A, BoNT/A-33-1α/A, BoNT/B-33-1α/A, BoNT/C1-33-1α/A, BoNT/D-33-1α/A, BoNT/E-33-1α/A, BoNT/F-33-1α/A, BoNT/G-33-1α/A, TeNT-33-1α/A, BoNT/A-33-2α/A, BoNT/B-33-2α/A, BoNT/C1-33-2α/A, BoNT/D-33-2α/A, BoNT/E-33-2α/A, BoNT/F-33-2α/A, BoNT/G-33-2α/A, TeNT-33-2α/A, BoNT/B-NTNHα/A, BoNT/B-NTNHα/A, BoNT/C1-NTNHα/A, BoNT/D-NTNHα/A, BoNT/E-NTNHα/A, BoNT/F-NTNHα/A, BoNT/G-NTNHα/A, TeNT-NTNHa, BoNT/A-17β/A, BoNT/B-17β/A, BoNT/C1-17β/A, BoNT/D-17β/A, BoNT/E-17β/A, BoNT/F-17β/A, BoNT/G-17β/A, TeNT-17β/A, BoNT/A-33-1β/A, BoNT/B-33-1β/A, BoNT/C1-33-1β/A, BoNT/D-33-1β/A, BoNT/E-33-1β/A, BoNT/F-33-1β/A, BoNT/G-33-1β/A, TeNT-33-1β/A, BoNT/A-33-2β/A, BoNT/B-33-2β/A, BoNT/C1-33-2β/A, BoNT/D-33-2β/A, BoNT/E-33-2β/A, BoNT/F-33-2β/A, BoNT/G-33-2β/A, TeNT-33-2β/A, BoNT/B-NTNHβ/A, BoNT/B-NTNHβ/A, BoNT/C1-NTNHβ/A, BoNT/D-NTNHβ/A, BoNT/E-NTNHβ/A, BoNT/F-NTNHβ/A, BoNT/G-NTNHβ/A, TeNT-NTNHβ.
Example 4
Construction of a Modified Clostridial Toxin Comprising a Translocation Facilitating Domain and a FGF that Selectively Binds to a FGFR3
[1027] The following example illustrates how to make a modified Clostridial toxin comprising a translocation facilitating domain and an enhanced targeting domain comprising a FGF that selectively binds to a FGFR3.
[1028] A polynucleotide molecule encoding BoNT/A-F18 is synthesized using standard procedures (BlueHeron® Biotechnology, Bothell, Wash.), as described in Example 1. BoNT/A-F18 is a BoNT/A modified to replace amino acids 1111-1296 of SEQ ID NO: 1, a BoNT/A β-trefoil domain, with amino acids 54 to 183 of SEQ ID NO: 39, a FGF-18 β-trefoil domain. If desired, an expression optimized polynucleotide molecule encoding BoNT/A-F18 can be synthesized in order to improve expression in to a different organism, such as, e.g., an Escherichia coli strain, a yeast strain, an insect cell-line or a mammalian cell line, can be done, see, e.g., Steward, supra, PCT Patent Serial No. 2005/020578 (Jun. 9, 2005); and Steward, supra, PCT Patent Serial No. 2005/027917 (Aug. 3, 2005). The synthesized polynucleotide molecule is verified by sequencing using Big Dye Terminator® Chemistry 3.1 (Applied Biosystems, Foster City, Calif.) and an ABI 3100 sequencer (Applied Biosystems, Foster City, Calif.).
[1029] A similar cloning strategy is used to make pUCBHB1 cloning constructs for BoNT/B-F18, a modified BoNT/B where amino acids 1098-1291 of SEQ ID NO: 2 are replaced with amino acids 54 to 183 of SEQ ID NO: 39; BoNT/C1-F18, a modified BoNT/C1 where amino acids 1112-1291 of SEQ ID NO: 3 are replaced with amino acids 54 to 183 of SEQ ID NO: 39; BoNT/D-F18, a modified BoNT/D where amino acids 1099-1276 of SEQ ID NO: 4 are replaced with amino acids 54 to 183 of SEQ ID NO: 39; BoNT/E-F18, a modified BoNT/E where amino acids 1086-1252 of SEQ ID NO: 5 are replaced with amino acids 54 to 183 of SEQ ID NO: 39; BoNT/F-F18, a modified BoNT/F where amino acids 1106-1274 of SEQ ID NO: 6 are replaced with amino acids 54 to 183 of SEQ ID NO: 39; BoNT/G-F18, a modified BoNT/G where amino acids 1106-1297 of SEQ ID NO: 7 are replaced with amino acids 54 to 183 of SEQ ID NO: 39; and TeNT-F18, a modified TeNT where amino acids 1128-1315 of SEQ ID NO: 8 are replaced with amino acids 54 to 183 of SEQ ID NO: 39. Similarly, the β-trefoil domain from a Clostridial toxin indicated above can be replaced with a FGF β-trefoil domain comprising amino acids 26-155 of SEQ ID NO: 33; amino acids 29-155 of SEQ ID NO: 34; amino acids 83-206 of SEQ ID NO: 35; amino acids 43-172 of SEQ ID NO: 36; amino acids 63-196 of SEQ ID NO: 37; amino acids 55-183 of SEQ ID NO: 38; and amino acids 54-183 of SEQ ID NO: 39.
[1030] To construct pET29/BoNT/A-F18, a pUCBHB1/BoNT/A-F18 construct is digested with restriction endonucleases that 1) excise the insert comprising the open reading frame encoding BoNT/A-F18; and 2) enable this insert to be operably-linked to a pET29 vector (EMD Biosciences-Novagen, Madison, Wis.). This insert is subcloned using a T4 DNA ligase procedure into a pET29 vector that is digested with appropriate restriction endonucleases to yield pET29/BoNT/A-F18. The ligation mixture is transformed into chemically competent E. coli DH5α cells (Invitrogen, Inc, Carlsbad, Calif.) using a heat shock method, plated on 1.5% Luria-Bertani agar plates (pH 7.0) containing 50 μg/mL of Kanamycin, and placed in a 37° C. incubator for overnight growth. Bacteria containing expression constructs are identified as Kanamycin resistant colonies. Candidate constructs are isolated using an alkaline lysis plasmid mini-preparation procedure and analyzed by restriction endonuclease digest mapping to determine the presence and orientation of the insert. This cloning strategy yielded a pET29 expression construct comprising the polynucleotide molecule encoding BoNT/A-F18 operably-linked to a carboxyl terminal polyhistidine affinity binding peptide.
[1031] A similar cloning strategy is used to make pET29 expression constructs comprising a polynucleotide molecule encoding for BoNT/B-F18, BoNT/C1-F18, BoNT/D-F18, BoNT/E-F18, BoNT/F-F18, BoNT/G-F18, TeNT-F18, as well as the modified Clostridial toxin indicated above comprising amino acids 26-155 of SEQ ID NO: 33; amino acids 29-155 of SEQ ID NO: 34; amino acids 83-206 of SEQ ID NO: 35; amino acids 43-172 of SEQ ID NO: 36; amino acids 63-196 of SEQ ID NO: 37; amino acids 55-183 of SEQ ID NO: 38; and amino acids 54-183 of SEQ ID NO: 39.
[1032] To construct a BoNT/A-F18 that replaces the BoNT/A translocation facilitating domain with another Clostridial toxin translocation facilitating domain, a translocation facilitating domain of BoNT/B will be introduced into the BoNT/A-F18 as described above using a Splicing by Overlapping ends polymerase chain reaction (SOE-PCR) procedure, see, e.g., R. M. Horton et al., Engineering hybrid genes without the use of restriction enzymes: gene splicing by overlapping extension, 77(1) Gene 61-68 (1989); and R. M. Horton, PCR-mediated recombination and mutagenesis. SOEing together tailor-made genes, 3(2) Mol. Biotechnol. 93-99 (1995). A nucleic acid fragment comprising a region encoding amino acids 859 to 1097 of BoNT/B (SEQ ID NO: 2) will be operably-linked by SOE-PCR to replace the region corresponding to the BoNT/A translocation facilitating domain comprising amino acids 874-1110 of SEQ ID NO: 1 of the BoNT/A-F18 and will be subcloned into a pCR2.1 vector using the TOPO® TA cloning method (Invitrogen, Inc, Carlsbad, Calif.). The forward and reverse oligonucleotide primers used for these reactions are designed to include unique restriction enzyme sites useful for subsequent subcloning steps. The resulting construct is digested with restriction enzymes that 1) excise the insert containing the entire open reading frame encoding the modified BoNT/A-F18; and 2) enable this insert to be operably-linked to a pQBI-25A vector (Qbiogene, Inc., Carlsbad, Calif.). The resulting restriction fragment will be purified by the QIAquick Gel Extraction Kit (QIAGEN, Inc., Valencia, Calif.), and will be subcloned using a T4 DNA ligase procedure into a pQBI-25A vector (Qbiogene, Inc., Irvine, Calif.). This cloning strategy yielded a pQBI-25 expression construct encoding a BoNT/A-F18 comprising a BoNT/B translocation facilitating domain.
[1033] A similar cloning strategy is used to make pQBI-25 expression constructs comprising a polynucleotide molecule encoding a BoNT/A-F18 that includes, e.g., a translocation facilitating domain comprising amino acids 869-1111 of BoNT/C1 of SEQ ID NO: 3; a translocation facilitating domain comprising amino acids 865-1098 of BoNT/D of SEQ ID NO: 4; a translocation facilitating domain comprising amino acids 846-1058 of BoNT/E of SEQ ID NO: 5; a translocation facilitating domain comprising amino acids 867-1105 of BoNT/F of SEQ ID NO: 6; a translocation facilitating domain comprising amino acids 866-1105 of BoNT/G of SEQ ID NO: 7; or a translocation facilitating domain comprising amino acids 882-1127 of TeNT of SEQ ID NO: 8.
[1034] Likewise, as well as, a polynucleotide molecule encoding a Clostridial translocation facilitating domain as described above can be introduced into a polynucleotide molecule encoding BoNT/B-F18, BoNT/C1-F18, BoNT/D-F18, BoNT/E-F18, BoNT/F-F18, BoNT/G-F18, TeNT-F18, as well as the modified Clostridial toxin indicated above comprising amino acids 26-155 of SEQ ID NO: 33; amino acids 29-155 of SEQ ID NO: 34; amino acids 83-206 of SEQ ID NO: 35; amino acids 43-172 of SEQ ID NO: 36; amino acids 63-196 of SEQ ID NO: 37; amino acids 55-183 of SEQ ID NO: 38; and amino acids 54-183 of SEQ ID NO: 39.
Example 5
Construction of a Modified Clostridial Toxin Comprising a Translocation Facilitating Domain and a FGF Fold that Selectively Binds to a FGFR3
[1035] The following example illustrates how to make a modified Clostridial toxin comprising a translocation facilitating domain and an enhanced targeting domain comprising a FGF fold that selectively binds to a FGFR3.
[1036] A polynucleotide molecule encoding BoNT/A-F18γ is synthesized using standard procedures (BlueHeron® Biotechnology, Bothell, Wash.), as described in Example 1. BoNT/A-F18γ is a BoNT/A modified to replace amino acids 1237-1296 of SEQ ID NO: 1, a γ-fold from a BoNT/A β-trefoil domain, with amino acids 138 to 183 of SEQ ID NO: 39, a γ-fold from a FGF-18 β-trefoil domain. If desired, an expression optimized polynucleotide molecule encoding BoNT/A-F18γ can be synthesized in order to improve expression in to a different organism, such as, e.g., an Escherichia coli strain, a yeast strain, an insect cell-line or a mammalian cell line, can be done, see, e.g., Steward, supra, PCT Patent Serial No. 2005/020578 (Jun. 9, 2005); and Steward, supra, PCT Patent Serial No. 2005/027917 (Aug. 3, 2005). The synthesized polynucleotide molecule is verified by sequencing using Big Dye Terminator® Chemistry 3.1 (Applied Biosystems, Foster City, Calif.) and an ABI 3100 sequencer (Applied Biosystems, Foster City, Calif.).
[1037] A similar cloning strategy is used to make pUCBHB1 cloning constructs for BoNT/B-F18γ, a modified BoNT/B where amino acids 1223-1291 of SEQ ID NO: 2 are replaced with amino acids 138 to 183 of SEQ ID NO: 39; BoNT/C1-F18γ, a modified BoNT/C1 where amino acids 1230-1291 of SEQ ID NO: 3 are replaced with amino acids 138 to 183 of SEQ ID NO: 39; BoNT/D-F18γ, a modified BoNT/D where amino acids 1219-1276 of SEQ ID NO: 4 are replaced with amino acids 138 to 183 of SEQ ID NO: 39; BoNT/E-F18γ, a modified BoNT/E where amino acids 1199-1252 of SEQ ID NO: 5 are replaced with amino acids 138 to 183 of SEQ ID NO: 39; BoNT/F-F18γ, a modified BoNT/F where amino acids 1222-1274 of SEQ ID NO: 6 are replaced with amino acids 138 to 183 of SEQ ID NO: 39; BoNT/G-F18γ, a modified BoNT/G where amino acids 1231-1297 of SEQ ID NO: 7 are replaced with amino acids 138 to 183 of SEQ ID NO: 39; and TeNT-F18γ, a modified TeNT where amino acids 1255-1315 of SEQ ID NO: 8 are replaced with amino acids 138 to 183 of SEQ ID NO: 39. Similarly, the γ-fold from a FGF-18 β-trefoil domain can replace amino acids 1111-1162 of SEQ ID NO: 1, an α-fold from a BoNT/A β-trefoil domain; amino acids 1098-1147 of SEQ ID NO: 2, an α-fold from a BoNT/B β-trefoil domain; amino acids 1112-1150 of SEQ ID NO: 3, an α-fold from a BoNT/C1 β-trefoil domain; amino acids 1099-1137 of SEQ ID NO: 4, an α-fold from a BoNT/D β-trefoil domain; amino acids 1086-1129 of SEQ ID NO: 5, an α-fold from a BoNT/E β-trefoil domain; amino acids 1106-1152 of SEQ ID NO: 6, an α-fold from a BoNT/F β-trefoil domain; amino acids 1106-1153 of SEQ ID NO: 7, an α-fold from a BoNT/G β-trefoil domain; or amino acids 1128-1177 of SEQ ID NO: 8, an α-fold from a TeNT β-trefoil domain. Similarly, the γ-fold from a FGF-18 β-trefoil domain can replace amino acids 1179-1223 of SEQ ID NO: 1, a β-fold from a BoNT/A trefoil domain; amino acids 1166-1210 of SEQ ID NO: 2, a β-fold from a BoNT/B β-trefoil domain; amino acids 1167-1218 of SEQ ID NO: 3, a β-fold from a BoNT/C1 β-trefoil domain; amino acids 1154-1207 of SEQ ID NO: 4, a β-fold from a BoNT/D β-trefoil domain; amino acids 1147-1190 of SEQ ID NO: 5, a β-fold from a BoNT/E β-trefoil domain; amino acids 1172-1213 of SEQ ID NO: 6, a β-fold from a BoNT/F trefoil domain; amino acids 1173-1218 of SEQ ID NO: 7, a β-fold from a BoNT/G β-trefoil domain; or amino acids 1195-1240 of SEQ ID NO: 8, a β-fold from a TeNT β-trefoil domain.
[1038] Similarly, an α-fold, β-fold or γ-fold from a β-trefoil domain from a Clostridial toxin indicated above can be replaced with a FGF γ-fold comprising amino acids 109-155 of SEQ ID NO: 33; amino acids 115-155 of SEQ ID NO: 34; amino acids 166-206 of SEQ ID NO: 35; amino acids 127-172 of SEQ ID NO: 36; amino acids 148-196 of SEQ ID NO: 37; or amino acids 138-183 of SEQ ID NO: 38. Likewise, an α-fold, β-fold or γ-fold from a β-trefoil domain from a Clostridial toxin indicated above can be replaced with a FGF α-fold comprising amino acids 26-64 of SEQ ID NO: 33; amino acids 29-67 of SEQ ID NO: 34; amino acids 83-121 of SEQ ID NO: 35; amino acids 43-80 of SEQ ID NO: 36; amino acids 63-100 of SEQ ID NO: 37; amino acids 55-91 of SEQ ID NO: 38; or amino acids 54-91 of SEQ ID NO: 39. Further, an α-fold, β-fold or γ-fold from a β-trefoil domain from a Clostridial toxin indicated above can be replaced with a FGF β-fold comprising amino acids 68-105 of SEQ ID NO: 33; amino acids 71-111 of SEQ ID NO: 34; amino acids 125-162 of SEQ ID NO: 35; amino acids 84-123 of SEQ ID NO: 36; amino acids 104-144 of SEQ ID NO: 37; amino acids 95-134 of SEQ ID NO: 38; or amino acids 95-134 of SEQ ID NO: 39.
[1039] To construct pET29/BoNT/A-F18, a pUCBHB1/BoNT/A-F18γ construct is digested with restriction endonucleases that 1) excise the insert comprising the open reading frame encoding BoNT/A-F18γ; and 2) enable this insert to be operably-linked to a pET29 vector (EMD Biosciences-Novagen, Madison, Wis.). This insert is subcloned using a T4 DNA ligase procedure into a pET29 vector that is digested with appropriate restriction endonucleases to yield pET29/BoNT/A-F18γ. The ligation mixture is transformed into chemically competent E. coli DH5α cells (Invitrogen, Inc, Carlsbad, Calif.) using a heat shock method, plated on 1.5% Luria-Bertani agar plates (pH 7.0) containing 50 μg/mL of Kanamycin, and placed in a 37° C. incubator for overnight growth. Bacteria containing expression constructs are identified as Kanamycin resistant colonies. Candidate constructs are isolated using an alkaline lysis plasmid mini-preparation procedure and analyzed by restriction endonuclease digest mapping to determine the presence and orientation of the insert. This cloning strategy yielded a pET29 expression construct comprising the polynucleotide molecule encoding BoNT/A-F18γ operably-linked to a carboxyl terminal polyhistidine affinity binding peptide.
[1040] A similar cloning strategy is used to make pET29 expression constructs comprising a polynucleotide molecule encoding for BoNT/B-F18γ, BoNT/C1-F18γ, BoNT/D-F18γ, BoNT/E-F18γ, BoNT/F-F18γ, BoNT/G-F18γ, TeNT-F18γ, BoNT/A-F18α, BoNT/B-F18α, BoNT/C1-F18α, BoNT/D-F18α, BoNT/E-F18α, BoNT/F-F18α, BoNT/G-F18α, TeNT-F18α, BoNT/A-F18β, BoNT/B-F18β, BoNT/C1-F18β, BoNT/D-F18β, BoNT/E-F18β, BoNT/F-F18β, BoNT/G-F18β, or TeNT-F18β, as well as the modified Clostridial toxin indicated above comprising amino acids 109-155 of SEQ ID NO: 33; amino acids 115-155 of SEQ ID NO: 34; amino acids 166-206 of SEQ ID NO: 35; amino acids 127-172 of SEQ ID NO: 36; amino acids 148-196 of SEQ ID NO: 37; amino acids 138-183 of SEQ ID NO: 38; amino acids 26-64 of SEQ ID NO: 33; amino acids 29-67 of SEQ ID NO: 34; amino acids 83-121 of SEQ ID NO: 35; amino acids 43-80 of SEQ ID NO: 36; amino acids 63-100 of SEQ ID NO: 37; amino acids 55-91 of SEQ ID NO: 38; amino acids 54-91 of SEQ ID NO: 39; amino acids 68-105 of SEQ ID NO: 33; amino acids 71-111 of SEQ ID NO: 34; amino acids 125-162 of SEQ ID NO: 35; amino acids 84-123 of SEQ ID NO: 36; amino acids 104-144 of SEQ ID NO: 37; amino acids 95-134 of SEQ ID NO: 38; or amino acids 95-134 of SEQ ID NO: 39.
[1041] To construct a BoNT/A-F18γ that replaces the BoNT/A translocation facilitating domain with another Clostridial toxin translocation facilitating domain, a translocation facilitating domain of BoNT/B will be introduced into the BoNT/A-F18γ as described above using a Splicing by Overlapping ends polymerase chain reaction (SOE-PCR) procedure, see, e.g., R. M. Horton et al., Engineering hybrid genes without the use of restriction enzymes: gene splicing by overlapping extension, 77(1) Gene 61-68 (1989); and R. M. Horton, PCR-mediated recombination and mutagenesis. SOEing together tailor-made genes, 3(2) Mol. Biotechnol. 93-99 (1995). A nucleic acid fragment comprising a region encoding amino acids 859 to 1097 of BoNT/B (SEQ ID NO: 2) will be operably-linked by SOE-PCR to replace the region corresponding to the BoNT/A translocation facilitating domain comprising amino acids 874-1110 of SEQ ID NO: 1 of the BoNT/A-F18γ and will be subcloned into a pCR2.1 vector using the TOPO® TA cloning method (Invitrogen, Inc, Carlsbad, Calif.). The forward and reverse oligonucleotide primers used for these reactions are designed to include unique restriction enzyme sites useful for subsequent subcloning steps. The resulting construct is digested with restriction enzymes that 1) excise the insert containing the entire open reading frame encoding the modified BoNT/A-F18γ; and 2) enable this insert to be operably-linked to a pQBI-25A vector (Qbiogene, Inc., Carlsbad, Calif.). The resulting restriction fragment will be purified by the QIAquick Gel Extraction Kit (QIAGEN, Inc., Valencia, Calif.), and will be subcloned using a T4 DNA ligase procedure into a pQBI-25A vector (Qbiogene, Inc., Irvine, Calif.). This cloning strategy yielded a pQBI-25 expression construct encoding a BoNT/A-F18γ comprising a BoNT/B translocation facilitating domain.
[1042] A similar cloning strategy is used to make pQBI-25 expression constructs comprising a polynucleotide molecule encoding a BoNT/A-F18γ that includes, e.g., a translocation facilitating domain comprising amino acids 869-1111 of BoNT/C1 of SEQ ID NO: 3; a translocation facilitating domain comprising amino acids 865-1098 of BoNT/D of SEQ ID NO: 4; a translocation facilitating domain comprising amino acids 846-1058 of BoNT/E of SEQ ID NO: 5; a translocation facilitating domain comprising amino acids 867-1105 of BoNT/F of SEQ ID NO: 6; a translocation facilitating domain comprising amino acids 866-1105 of BoNT/G of SEQ ID NO: 7; or a translocation facilitating domain comprising amino acids 882-1127 of TeNT of SEQ ID NO: 8.
[1043] Likewise, as well as, a polynucleotide molecule encoding a Clostridial translocation facilitating domain as described above can be introduced into a polynucleotide molecule encoding BoNT/B-F18γ, BoNT/C1-F18γ, BoNT/D-F18γ, BoNT/E-F18γ, BoNT/F-F18γ, BoNT/G-F18γ, TeNT-F18γ, BoNT/A-F18α, BoNT/B-F18α, BoNT/C1-F18α, BoNT/D-F18α, BoNT/E-F18α, BoNT/F-F18α, BoNT/G-F18α, TeNT-F18α, BoNT/A-F18β, BoNT/B-F18β, BoNT/C1-F18β, BoNT/D-F18β, BoNT/E-F18β, BoNT/F-F18β, BoNT/G-F18β, or TeNT-F18β, as well as the modified Clostridial toxin indicated above comprising amino acids 109-155 of SEQ ID NO: 33; amino acids 115-155 of SEQ ID NO: 34; amino acids 166-206 of SEQ ID NO: 35; amino acids 127-172 of SEQ ID NO: 36; amino acids 148-196 of SEQ ID NO: 37; amino acids 138-183 of SEQ ID NO: 38; amino acids 26-64 of SEQ ID NO: 33; amino acids 29-67 of SEQ ID NO: 34; amino acids 83-121 of SEQ ID NO: 35; amino acids 43-80 of SEQ ID NO: 36; amino acids 63-100 of SEQ ID NO: 37; amino acids 55-91 of SEQ ID NO: 38; amino acids 54-91 of SEQ ID NO: 39; amino acids 68-105 of SEQ ID NO: 33; amino acids 71-111 of SEQ ID NO: 34; amino acids 125-162 of SEQ ID NO: 35; amino acids 84-123 of SEQ ID NO: 36; amino acids 104-144 of SEQ ID NO: 37; amino acids 95-134 of SEQ ID NO: 38; or amino acids 95-134 of SEQ ID NO: 39.
Example 6
Expression of Modified Clostridial Toxins in a Bacterial Cell
[1044] The following example illustrates a procedure useful for expressing any of the modified Clostridial toxins disclosed in the present specification in a bacterial cell.
[1045] An expression construct, such as, e.g., any of the expression constructs in Examples 1-5, is introduced into chemically competent E. coli BL21 (DE3) cells (Invitrogen, Inc, Carlsbad, Calif.) using a heat-shock transformation protocol. The heat-shock reaction is plated onto 1.5% Luria-Bertani agar plates (pH 7.0) containing 50 μg/mL of Kanamycin and is placed in a 37° C. incubator for overnight growth. Kanamycin-resistant colonies of transformed E. coli containing the expression construct are used to inoculate a baffled flask containing 3.0 mL of PA-0.5 G media containing 50 μg/mL of Kanamycin which is then placed in a 37° C. incubator, shaking at 250 rpm, for overnight growth. The resulting overnight starter culture is in turn used to inoculate a 3 L baffled flask containing ZYP-5052 autoinducing media containing 50 μg/mL of Kanamycin at a dilution of 1:1000. Culture volumes ranged from about 600 mL (20% flask volume) to about 750 mL (25% flask volume). These cultures are grown in a 37° C. incubator shaking at 250 rpm for approximately 5.5 hours and are then transferred to a 16° C. incubator shaking at 250 rpm for overnight expression. Cells are harvested by centrifugation (4,000 rpm at 4° C. for 20-30 minutes) and are used immediately, or stored dry at -80° C. until needed.
Example 7
Purification and Quantification of Modified Clostridial Toxins
[1046] The following example illustrates methods useful for purification and quantification of any modified Clostridial toxins disclosed in the present specification.
[1047] For immobilized metal affinity chromatography (IMAC) protein purification, E. coli BL21 (DE3) cell pellets used to express a modified Clostridial toxin, as described in Example 7, are resuspended in Column Binding Buffer (25 mM N-(2-hydroxyethyl) piperazine-N'-(2-ethanesulfonic acid) (HEPES), pH 7.8; 500 mM sodium chloride; 10 mM imidazole; 2× Protease Inhibitor Cocktail Set III (EMD Biosciences-Calbiochem, San Diego Calif.); 5 units/mL of Benzonase (EMD Biosciences-Novagen, Madison, Wis.); 0.1% (v/v) Triton-X® 100, 4-octylphenol polyethoxylate; 10% (v/v) glycerol), and then are transferred to a cold Oakridge centrifuge tube. The cell suspension is sonicated on ice (10-12 pulses of 10 seconds at 40% amplitude with 60 seconds cooling intervals on a Branson Digital Sonifier) in order to lyse the cells and then is centrifuged (16,000 rpm at 4° C. for 20 minutes) to clarify the lysate. An immobilized metal affinity chromatography column is prepared using a 20 mL Econo-Pac column support (Bio-Rad Laboratories, Hercules, Calif.) packed with 2.5-5.0 mL of TALON® SuperFlow Co2+ affinity resin (BD Biosciences-Clontech, Palo Alto, Calif.), which is then equilibrated by rinsing with 5 column volumes of deionized, distilled water, followed by 5 column volumes of Column Binding Buffer. The clarified lysate is applied slowly to the equilibrated column by gravity flow (approximately 0.25-0.3 mL/minute). The column is then washed with 5 column volumes of Column Wash Buffer (N-(2-hydroxyethyl) piperazine-N'-(2-ethanesulfonic acid) (HEPES), pH 7.8; 500 mM sodium chloride; 10 mM imidazole; 0.1% (v/v) Triton-X® 100, 4-octylphenol polyethoxylate; 10% (v/v) glycerol). The modified Clostridial toxin is eluted with 20-30 mL of Column Elution Buffer (25 mM N-(2-hydroxyethyl) piperazine-N'-(2-ethanesulfonic acid) (HEPES), pH 7.8; 500 mM sodium chloride; 500 mM imidazole; 0.1% (v/v) Triton-X® 100, 4-octylphenol polyethoxylate; 10% (v/v) glycerol) and is collected in approximately twelve 1 mL fractions. The amount of modified Clostridial toxin contained in each elution fraction is determined by a Bradford dye assay. In this procedure, 20 μL aliquots of each 1.0 mL fraction is combined with 200 μL of Bio-Rad Protein Reagent (Bio-Rad Laboratories, Hercules, Calif.), diluted 1 to 4 with deionized, distilled water, and then the intensity of the colorimetric signal is measured using a spectrophotometer. The five fractions with the strongest signal are considered the elution peak and are combined together. Total protein yield is determined by estimating the total protein concentration of the pooled peak elution fractions using bovine gamma globulin as a standard (Bio-Rad Laboratories, Hercules, Calif.).
[1048] For purification of a modified Clostridial toxin using a FPLC desalting column, a HiPrep® 26/10 size exclusion column (Amersham Biosciences, Piscataway, N.J.) is pre-equilibrated with 80 mL of 4° C. Column Buffer (50 mM sodium phosphate, pH 6.5). After the column is equilibrated, a modified Clostridial toxin sample is applied to the size exclusion column with an isocratic mobile phase of 4° C. Column Buffer and at a flow rate of 10 mL/minute using a BioLogic DuoFlow chromatography system (Bio-Rad Laboratories, Hercules, Calif.). The desalted modified Clostridial toxin sample is collected as a single fraction of approximately 7-12 mL.
[1049] For purification of a modified Clostridial toxin using a FPLC ion exchange column, a modified Clostridial toxin sample that has been desalted following elution from an IMAC column is applied to a 1 mL Q1® anion exchange column (Bio-Rad Laboratories, Hercules, Calif.) using a BioLogic DuoFlow chromatography system (Bio-Rad Laboratories, Hercules, Calif.). The sample is applied to the column in 4° C. Column Buffer (50 mM sodium phosphate, pH 6.5) and is eluted by linear gradient with 4° C. Elution Buffer (50 mM sodium phosphate, 1 M sodium chloride, pH 6.5) as follows: step 1, 5.0 mL of 5% Elution Buffer at a flow rate of 1 mL/minute; step 2, 20.0 mL of 5-30% Elution Buffer at a flow rate of 1 mL/minute; step 3, 2.0 mL of 50% Elution Buffer at a flow rate of 1.0 mL/minute; step 4, 4.0 mL of 100% Elution Buffer at a flow rate of 1.0 mL/minute; and step 5, 5.0 mL of 0% Elution Buffer at a flow rate of 1.0 mL/minute. Elution of modified Clostridial toxin from the column is monitored at 280, 260, and 214 nm, and peaks absorbing above a minimum threshold (0.01 au) at 280 nm are collected. Most of the modified Clostridial toxin will elute at a sodium chloride concentration of approximately 100 to 200 mM. Average total yields of modified Clostridial toxin will be determined by a Bradford assay.
[1050] Expression of a modified Clostridial toxin is analyzed by polyacrylamide gel electrophoresis. Samples purified using the procedure described above are added to 2×LDS Sample Buffer (Invitrogen, Inc, Carlsbad, Calif.) and are separated by MOPS polyacrylamide gel electrophoresis using NuPAGE® Novex 4-12% Bis-Tris precast polyacrylamide gels (Invitrogen, Inc, Carlsbad, Calif.) under denaturing, reducing conditions. Gels are stained with SYPRO® Ruby (Bio-Rad Laboratories, Hercules, Calif.) and the separated polypeptides are imaged using a Fluor-S MAX Multilmager (Bio-Rad Laboratories, Hercules, Calif.) for quantification of modified Clostridial toxin expression levels. The size and amount of modified Clostridial toxin is determined by comparison to MagicMark® protein molecular weight standards (Invitrogen, Inc, Carlsbad, Calif.).
[1051] Expression of modified Clostridial toxin is also analyzed by Western blot analysis. Protein samples purified using the procedure described above are added to 2×LDS Sample Buffer (Invitrogen, Inc, Carlsbad, Calif.) and are separated by MOPS polyacrylamide gel electrophoresis using NuPAGE® Novex 4-12% Bis-Tris precast polyacrylamide gels (Invitrogen, Inc, Carlsbad, Calif.) under denaturing, reducing conditions. Separated polypeptides are transferred from the gel onto polyvinylidene fluoride (PVDF) membranes (Invitrogen, Inc, Carlsbad, Calif.) by Western blotting using a Trans-Blot® SD semi-dry electrophoretic transfer cell apparatus (Bio-Rad Laboratories, Hercules, Calif.). PVDF membranes are blocked by incubating at room temperature for 2 hours in a solution containing 25 mM Tris-Buffered Saline (25 mM 2-amino-2-hydroxymethyl-1,3-propanediol hydrochloric acid (Tris-HCl)(pH 7.4), 137 mM sodium chloride, 2.7 mM potassium chloride), 0.1% TWEEN-20®, polyoxyethylene (20) sorbitan monolaureate, 2% bovine serum albumin, 5% nonfat dry milk. Blocked membranes are incubated at 4° C. for overnight in Tris-Buffered Saline TWEEN-20® (25 mM Tris-Buffered Saline, 0.1% TWEEN-20®, polyoxyethylene (20) sorbitan monolaureate) containing appropriate primary antibodies as a probe. Primary antibody probed blots are washed three times for 15 minutes each time in Tris-Buffered Saline TWEEN-20®. Washed membranes are incubated at room temperature for 2 hours in Tris-Buffered Saline TWEEN-20® containing an appropriate immunoglobulin G antibody conjugated to horseradish peroxidase as a secondary antibody. Secondary antibody-probed blots are washed three times for 15 minutes each time in Tris-Buffered Saline TWEEN-20®. Signal detection of the labeled modified Clostridial toxin are visualized using the ECL PIus® Western Blot Detection System (Amersham Biosciences, Piscataway, N.J.) and are imaged with a Typhoon 9410 Variable Mode Imager (Amersham Biosciences, Piscataway, N.J.) for quantification of modified Clostridial toxin expression levels.
[1052] Although aspects of the present invention have been described with reference to the disclosed embodiments, one skilled in the art will readily appreciate that the specific examples disclosed are only illustrative of these aspects and in no way limit the present invention. Various modifications can be made without departing from the spirit of the present invention.
Sequence CWU
1
1
16211296PRTClostridium botulinum serotype A 1Met Pro Phe Val Asn Lys Gln
Phe Asn Tyr Lys Asp Pro Val Asn Gly1 5 10
15Val Asp Ile Ala Tyr Ile Lys Ile Pro Asn Ala Gly Gln
Met Gln Pro 20 25 30Val Lys
Ala Phe Lys Ile His Asn Lys Ile Trp Val Ile Pro Glu Arg 35
40 45Asp Thr Phe Thr Asn Pro Glu Glu Gly Asp
Leu Asn Pro Pro Pro Glu 50 55 60Ala
Lys Gln Val Pro Val Ser Tyr Tyr Asp Ser Thr Tyr Leu Ser Thr65
70 75 80Asp Asn Glu Lys Asp Asn
Tyr Leu Lys Gly Val Thr Lys Leu Phe Glu 85
90 95Arg Ile Tyr Ser Thr Asp Leu Gly Arg Met Leu Leu
Thr Ser Ile Val 100 105 110Arg
Gly Ile Pro Phe Trp Gly Gly Ser Thr Ile Asp Thr Glu Leu Lys 115
120 125Val Ile Asp Thr Asn Cys Ile Asn Val
Ile Gln Pro Asp Gly Ser Tyr 130 135
140Arg Ser Glu Glu Leu Asn Leu Val Ile Ile Gly Pro Ser Ala Asp Ile145
150 155 160Ile Gln Phe Glu
Cys Lys Ser Phe Gly His Glu Val Leu Asn Leu Thr 165
170 175Arg Asn Gly Tyr Gly Ser Thr Gln Tyr Ile
Arg Phe Ser Pro Asp Phe 180 185
190Thr Phe Gly Phe Glu Glu Ser Leu Glu Val Asp Thr Asn Pro Leu Leu
195 200 205Gly Ala Gly Lys Phe Ala Thr
Asp Pro Ala Val Thr Leu Ala His Glu 210 215
220Leu Ile His Ala Gly His Arg Leu Tyr Gly Ile Ala Ile Asn Pro
Asn225 230 235 240Arg Val
Phe Lys Val Asn Thr Asn Ala Tyr Tyr Glu Met Ser Gly Leu
245 250 255Glu Val Ser Phe Glu Glu Leu
Arg Thr Phe Gly Gly His Asp Ala Lys 260 265
270Phe Ile Asp Ser Leu Gln Glu Asn Glu Phe Arg Leu Tyr Tyr
Tyr Asn 275 280 285Lys Phe Lys Asp
Ile Ala Ser Thr Leu Asn Lys Ala Lys Ser Ile Val 290
295 300Gly Thr Thr Ala Ser Leu Gln Tyr Met Lys Asn Val
Phe Lys Glu Lys305 310 315
320Tyr Leu Leu Ser Glu Asp Thr Ser Gly Lys Phe Ser Val Asp Lys Leu
325 330 335Lys Phe Asp Lys Leu
Tyr Lys Met Leu Thr Glu Ile Tyr Thr Glu Asp 340
345 350Asn Phe Val Lys Phe Phe Lys Val Leu Asn Arg Lys
Thr Tyr Leu Asn 355 360 365Phe Asp
Lys Ala Val Phe Lys Ile Asn Ile Val Pro Lys Val Asn Tyr 370
375 380Thr Ile Tyr Asp Gly Phe Asn Leu Arg Asn Thr
Asn Leu Ala Ala Asn385 390 395
400Phe Asn Gly Gln Asn Thr Glu Ile Asn Asn Met Asn Phe Thr Lys Leu
405 410 415Lys Asn Phe Thr
Gly Leu Phe Glu Phe Tyr Lys Leu Leu Cys Val Arg 420
425 430Gly Ile Ile Thr Ser Lys Thr Lys Ser Leu Asp
Lys Gly Tyr Asn Lys 435 440 445Ala
Leu Asn Asp Leu Cys Ile Lys Val Asn Asn Trp Asp Leu Phe Phe 450
455 460Ser Pro Ser Glu Asp Asn Phe Thr Asn Asp
Leu Asn Lys Gly Glu Glu465 470 475
480Ile Thr Ser Asp Thr Asn Ile Glu Ala Ala Glu Glu Asn Ile Ser
Leu 485 490 495Asp Leu Ile
Gln Gln Tyr Tyr Leu Thr Phe Asn Phe Asp Asn Glu Pro 500
505 510Glu Asn Ile Ser Ile Glu Asn Leu Ser Ser
Asp Ile Ile Gly Gln Leu 515 520
525Glu Leu Met Pro Asn Ile Glu Arg Phe Pro Asn Gly Lys Lys Tyr Glu 530
535 540Leu Asp Lys Tyr Thr Met Phe His
Tyr Leu Arg Ala Gln Glu Phe Glu545 550
555 560His Gly Lys Ser Arg Ile Ala Leu Thr Asn Ser Val
Asn Glu Ala Leu 565 570
575Leu Asn Pro Ser Arg Val Tyr Thr Phe Phe Ser Ser Asp Tyr Val Lys
580 585 590Lys Val Asn Lys Ala Thr
Glu Ala Ala Met Phe Leu Gly Trp Val Glu 595 600
605Gln Leu Val Tyr Asp Phe Thr Asp Glu Thr Ser Glu Val Ser
Thr Thr 610 615 620Asp Lys Ile Ala Asp
Ile Thr Ile Ile Ile Pro Tyr Ile Gly Pro Ala625 630
635 640Leu Asn Ile Gly Asn Met Leu Tyr Lys Asp
Asp Phe Val Gly Ala Leu 645 650
655Ile Phe Ser Gly Ala Val Ile Leu Leu Glu Phe Ile Pro Glu Ile Ala
660 665 670Ile Pro Val Leu Gly
Thr Phe Ala Leu Val Ser Tyr Ile Ala Asn Lys 675
680 685Val Leu Thr Val Gln Thr Ile Asp Asn Ala Leu Ser
Lys Arg Asn Glu 690 695 700Lys Trp Asp
Glu Val Tyr Lys Tyr Ile Val Thr Asn Trp Leu Ala Lys705
710 715 720Val Asn Thr Gln Ile Asp Leu
Ile Arg Lys Lys Met Lys Glu Ala Leu 725
730 735Glu Asn Gln Ala Glu Ala Thr Lys Ala Ile Ile Asn
Tyr Gln Tyr Asn 740 745 750Gln
Tyr Thr Glu Glu Glu Lys Asn Asn Ile Asn Phe Asn Ile Asp Asp 755
760 765Leu Ser Ser Lys Leu Asn Glu Ser Ile
Asn Lys Ala Met Ile Asn Ile 770 775
780Asn Lys Phe Leu Asn Gln Cys Ser Val Ser Tyr Leu Met Asn Ser Met785
790 795 800Ile Pro Tyr Gly
Val Lys Arg Leu Glu Asp Phe Asp Ala Ser Leu Lys 805
810 815Asp Ala Leu Leu Lys Tyr Ile Tyr Asp Asn
Arg Gly Thr Leu Ile Gly 820 825
830Gln Val Asp Arg Leu Lys Asp Lys Val Asn Asn Thr Leu Ser Thr Asp
835 840 845Ile Pro Phe Gln Leu Ser Lys
Tyr Val Asp Asn Gln Arg Leu Leu Ser 850 855
860Thr Phe Thr Glu Tyr Ile Lys Asn Ile Ile Asn Thr Ser Ile Leu
Asn865 870 875 880Leu Arg
Tyr Glu Ser Asn His Leu Ile Asp Leu Ser Arg Tyr Ala Ser
885 890 895Lys Ile Asn Ile Gly Ser Lys
Val Asn Phe Asp Pro Ile Asp Lys Asn 900 905
910Gln Ile Gln Leu Phe Asn Leu Glu Ser Ser Lys Ile Glu Val
Ile Leu 915 920 925Lys Asn Ala Ile
Val Tyr Asn Ser Met Tyr Glu Asn Phe Ser Thr Ser 930
935 940Phe Trp Ile Arg Ile Pro Lys Tyr Phe Asn Ser Ile
Ser Leu Asn Asn945 950 955
960Glu Tyr Thr Ile Ile Asn Cys Met Glu Asn Asn Ser Gly Trp Lys Val
965 970 975Ser Leu Asn Tyr Gly
Glu Ile Ile Trp Thr Leu Gln Asp Thr Gln Glu 980
985 990Ile Lys Gln Arg Val Val Phe Lys Tyr Ser Gln Met
Ile Asn Ile Ser 995 1000 1005Asp
Tyr Ile Asn Arg Trp Ile Phe Val Thr Ile Thr Asn Asn Arg Leu 1010
1015 1020Asn Asn Ser Lys Ile Tyr Ile Asn Gly Arg
Leu Ile Asp Gln Lys Pro1025 1030 1035
1040Ile Ser Asn Leu Gly Asn Ile His Ala Ser Asn Asn Ile Met Phe
Lys 1045 1050 1055Leu Asp
Gly Cys Arg Asp Thr His Arg Tyr Ile Trp Ile Lys Tyr Phe 1060
1065 1070Asn Leu Phe Asp Lys Glu Leu Asn Glu
Lys Glu Ile Lys Asp Leu Tyr 1075 1080
1085Asp Asn Gln Ser Asn Ser Gly Ile Leu Lys Asp Phe Trp Gly Asp Tyr
1090 1095 1100Leu Gln Tyr Asp Lys Pro Tyr
Tyr Met Leu Asn Leu Tyr Asp Pro Asn1105 1110
1115 1120Lys Tyr Val Asp Val Asn Asn Val Gly Ile Arg Gly
Tyr Met Tyr Leu 1125 1130
1135Lys Gly Pro Arg Gly Ser Val Met Thr Thr Asn Ile Tyr Leu Asn Ser
1140 1145 1150Ser Leu Tyr Arg Gly Thr
Lys Phe Ile Ile Lys Lys Tyr Ala Ser Gly 1155 1160
1165Asn Lys Asp Asn Ile Val Arg Asn Asn Asp Arg Val Tyr Ile
Asn Val 1170 1175 1180Val Val Lys Asn
Lys Glu Tyr Arg Leu Ala Thr Asn Ala Ser Gln Ala1185 1190
1195 1200Gly Val Glu Lys Ile Leu Ser Ala Leu
Glu Ile Pro Asp Val Gly Asn 1205 1210
1215Leu Ser Gln Val Val Val Met Lys Ser Lys Asn Asp Gln Gly Ile
Thr 1220 1225 1230Asn Lys Cys
Lys Met Asn Leu Gln Asp Asn Asn Gly Asn Asp Ile Gly 1235
1240 1245Phe Ile Gly Phe His Gln Phe Asn Asn Ile Ala
Lys Leu Val Ala Ser 1250 1255 1260Asn
Trp Tyr Asn Arg Gln Ile Glu Arg Ser Ser Arg Thr Leu Gly Cys1265
1270 1275 1280Ser Trp Glu Phe Ile Pro
Val Asp Asp Gly Trp Gly Glu Arg Pro Leu 1285
1290 129521291PRTClostridium botulinum serotype B 2Met
Pro Val Thr Ile Asn Asn Phe Asn Tyr Asn Asp Pro Ile Asp Asn1
5 10 15Asn Asn Ile Ile Met Met Glu
Pro Pro Phe Ala Arg Gly Thr Gly Arg 20 25
30Tyr Tyr Lys Ala Phe Lys Ile Thr Asp Arg Ile Trp Ile Ile
Pro Glu 35 40 45Arg Tyr Thr Phe
Gly Tyr Lys Pro Glu Asp Phe Asn Lys Ser Ser Gly 50 55
60Ile Phe Asn Arg Asp Val Cys Glu Tyr Tyr Asp Pro Asp
Tyr Leu Asn65 70 75
80Thr Asn Asp Lys Lys Asn Ile Phe Leu Gln Thr Met Ile Lys Leu Phe
85 90 95Asn Arg Ile Lys Ser Lys
Pro Leu Gly Glu Lys Leu Leu Glu Met Ile 100
105 110Ile Asn Gly Ile Pro Tyr Leu Gly Asp Arg Arg Val
Pro Leu Glu Glu 115 120 125Phe Asn
Thr Asn Ile Ala Ser Val Thr Val Asn Lys Leu Ile Ser Asn 130
135 140Pro Gly Glu Val Glu Arg Lys Lys Gly Ile Phe
Ala Asn Leu Ile Ile145 150 155
160Phe Gly Pro Gly Pro Val Leu Asn Glu Asn Glu Thr Ile Asp Ile Gly
165 170 175Ile Gln Asn His
Phe Ala Ser Arg Glu Gly Phe Gly Gly Ile Met Gln 180
185 190Met Lys Phe Cys Pro Glu Tyr Val Ser Val Phe
Asn Asn Val Gln Glu 195 200 205Asn
Lys Gly Ala Ser Ile Phe Asn Arg Arg Gly Tyr Phe Ser Asp Pro 210
215 220Ala Leu Ile Leu Met His Glu Leu Ile His
Val Leu His Gly Leu Tyr225 230 235
240Gly Ile Lys Val Asp Asp Leu Pro Ile Val Pro Asn Glu Lys Lys
Phe 245 250 255Phe Met Gln
Ser Thr Asp Ala Ile Gln Ala Glu Glu Leu Tyr Thr Phe 260
265 270Gly Gly Gln Asp Pro Ser Ile Ile Thr Pro
Ser Thr Asp Lys Ser Ile 275 280
285Tyr Asp Lys Val Leu Gln Asn Phe Arg Gly Ile Val Asp Arg Leu Asn 290
295 300Lys Val Leu Val Cys Ile Ser Asp
Pro Asn Ile Asn Ile Asn Ile Tyr305 310
315 320Lys Asn Lys Phe Lys Asp Lys Tyr Lys Phe Val Glu
Asp Ser Glu Gly 325 330
335Lys Tyr Ser Ile Asp Val Glu Ser Phe Asp Lys Leu Tyr Lys Ser Leu
340 345 350Met Phe Gly Phe Thr Glu
Thr Asn Ile Ala Glu Asn Tyr Lys Ile Lys 355 360
365Thr Arg Ala Ser Tyr Phe Ser Asp Ser Leu Pro Pro Val Lys
Ile Lys 370 375 380Asn Leu Leu Asp Asn
Glu Ile Tyr Thr Ile Glu Glu Gly Phe Asn Ile385 390
395 400Ser Asp Lys Asp Met Glu Lys Glu Tyr Arg
Gly Gln Asn Lys Ala Ile 405 410
415Asn Lys Gln Ala Tyr Glu Glu Ile Ser Lys Glu His Leu Ala Val Tyr
420 425 430Lys Ile Gln Met Cys
Lys Ser Val Lys Ala Pro Gly Ile Cys Ile Asp 435
440 445Val Asp Asn Glu Asp Leu Phe Phe Ile Ala Asp Lys
Asn Ser Phe Ser 450 455 460Asp Asp Leu
Ser Lys Asn Glu Arg Ile Glu Tyr Asn Thr Gln Ser Asn465
470 475 480Tyr Ile Glu Asn Asp Phe Pro
Ile Asn Glu Leu Ile Leu Asp Thr Asp 485
490 495Leu Ile Ser Lys Ile Glu Leu Pro Ser Glu Asn Thr
Glu Ser Leu Thr 500 505 510Asp
Phe Asn Val Asp Val Pro Val Tyr Glu Lys Gln Pro Ala Ile Lys 515
520 525Lys Ile Phe Thr Asp Glu Asn Thr Ile
Phe Gln Tyr Leu Tyr Ser Gln 530 535
540Thr Phe Pro Leu Asp Ile Arg Asp Ile Ser Leu Thr Ser Ser Phe Asp545
550 555 560Asp Ala Leu Leu
Phe Ser Asn Lys Val Tyr Ser Phe Phe Ser Met Asp 565
570 575Tyr Ile Lys Thr Ala Asn Lys Val Val Glu
Ala Gly Leu Phe Ala Gly 580 585
590Trp Val Lys Gln Ile Val Asn Asp Phe Val Ile Glu Ala Asn Lys Ser
595 600 605Asn Thr Met Asp Lys Ile Ala
Asp Ile Ser Leu Ile Val Pro Tyr Ile 610 615
620Gly Leu Ala Leu Asn Val Gly Asn Glu Thr Ala Lys Gly Asn Phe
Glu625 630 635 640Asn Ala
Phe Glu Ile Ala Gly Ala Ser Ile Leu Leu Glu Phe Ile Pro
645 650 655Glu Leu Leu Ile Pro Val Val
Gly Ala Phe Leu Leu Glu Ser Tyr Ile 660 665
670Asp Asn Lys Asn Lys Ile Ile Lys Thr Ile Asp Asn Ala Leu
Thr Lys 675 680 685Arg Asn Glu Lys
Trp Ser Asp Met Tyr Gly Leu Ile Val Ala Gln Trp 690
695 700Leu Ser Thr Val Asn Thr Gln Phe Tyr Thr Ile Lys
Glu Gly Met Tyr705 710 715
720Lys Ala Leu Asn Tyr Gln Ala Gln Ala Leu Glu Glu Ile Ile Lys Tyr
725 730 735Arg Tyr Asn Ile Tyr
Ser Glu Lys Glu Lys Ser Asn Ile Asn Ile Asp 740
745 750Phe Asn Asp Ile Asn Ser Lys Leu Asn Glu Gly Ile
Asn Gln Ala Ile 755 760 765Asp Asn
Ile Asn Asn Phe Ile Asn Gly Cys Ser Val Ser Tyr Leu Met 770
775 780Lys Lys Met Ile Pro Leu Ala Val Glu Lys Leu
Leu Asp Phe Asp Asn785 790 795
800Thr Leu Lys Lys Asn Leu Leu Asn Tyr Ile Asp Glu Asn Lys Leu Tyr
805 810 815Leu Ile Gly Ser
Ala Glu Tyr Glu Lys Ser Lys Val Asn Lys Tyr Leu 820
825 830Lys Thr Ile Met Pro Phe Asp Leu Ser Ile Tyr
Thr Asn Asp Thr Ile 835 840 845Leu
Ile Glu Met Phe Asn Lys Tyr Asn Ser Glu Ile Leu Asn Asn Ile 850
855 860Ile Leu Asn Leu Arg Tyr Lys Asp Asn Asn
Leu Ile Asp Leu Ser Gly865 870 875
880Tyr Gly Ala Lys Val Glu Val Tyr Asp Gly Val Glu Leu Asn Asp
Lys 885 890 895Asn Gln Phe
Lys Leu Thr Ser Ser Ala Asn Ser Lys Ile Arg Val Thr 900
905 910Gln Asn Gln Asn Ile Ile Phe Asn Ser Val
Phe Leu Asp Phe Ser Val 915 920
925Ser Phe Trp Ile Arg Ile Pro Lys Tyr Lys Asn Asp Gly Ile Gln Asn 930
935 940Tyr Ile His Asn Glu Tyr Thr Ile
Ile Asn Cys Met Lys Asn Asn Ser945 950
955 960Gly Trp Lys Ile Ser Ile Arg Gly Asn Arg Ile Ile
Trp Thr Leu Ile 965 970
975Asp Ile Asn Gly Lys Thr Lys Ser Val Phe Phe Glu Tyr Asn Ile Arg
980 985 990Glu Asp Ile Ser Glu Tyr
Ile Asn Arg Trp Phe Phe Val Thr Ile Thr 995 1000
1005Asn Asn Leu Asn Asn Ala Lys Ile Tyr Ile Asn Gly Lys Leu
Glu Ser 1010 1015 1020Asn Thr Asp Ile
Lys Asp Ile Arg Glu Val Ile Ala Asn Gly Glu Ile1025 1030
1035 1040Ile Phe Lys Leu Asp Gly Asp Ile Asp
Arg Thr Gln Phe Ile Trp Met 1045 1050
1055Lys Tyr Phe Ser Ile Phe Asn Thr Glu Leu Ser Gln Ser Asn Ile
Glu 1060 1065 1070Glu Arg Tyr
Lys Ile Gln Ser Tyr Ser Glu Tyr Leu Lys Asp Phe Trp 1075
1080 1085Gly Asn Pro Leu Met Tyr Asn Lys Glu Tyr Tyr
Met Phe Asn Ala Gly 1090 1095 1100Asn
Lys Asn Ser Tyr Ile Lys Leu Lys Lys Asp Ser Pro Val Gly Glu1105
1110 1115 1120Ile Leu Thr Arg Ser Lys
Tyr Asn Gln Asn Ser Lys Tyr Ile Asn Tyr 1125
1130 1135Arg Asp Leu Tyr Ile Gly Glu Lys Phe Ile Ile Arg
Arg Lys Ser Asn 1140 1145
1150Ser Gln Ser Ile Asn Asp Asp Ile Val Arg Lys Glu Asp Tyr Ile Tyr
1155 1160 1165Leu Asp Phe Phe Asn Leu Asn
Gln Glu Trp Arg Val Tyr Thr Tyr Lys 1170 1175
1180Tyr Phe Lys Lys Glu Glu Glu Lys Leu Phe Leu Ala Pro Ile Ser
Asp1185 1190 1195 1200Ser
Asp Glu Phe Tyr Asn Thr Ile Gln Ile Lys Glu Tyr Asp Glu Gln
1205 1210 1215Pro Thr Tyr Ser Cys Gln Leu
Leu Phe Lys Lys Asp Glu Glu Ser Thr 1220 1225
1230Asp Glu Ile Gly Leu Ile Gly Ile His Arg Phe Tyr Glu Ser
Gly Ile 1235 1240 1245Val Phe Glu
Glu Tyr Lys Asp Tyr Phe Cys Ile Ser Lys Trp Tyr Leu 1250
1255 1260Lys Glu Val Lys Arg Lys Pro Tyr Asn Leu Lys Leu
Gly Cys Asn Trp1265 1270 1275
1280Gln Phe Ile Pro Lys Asp Glu Gly Trp Thr Glu 1285
129031291PRTClostridium botulinum serotype C1 3Met Pro Ile Thr
Ile Asn Asn Phe Asn Tyr Ser Asp Pro Val Asp Asn1 5
10 15Lys Asn Ile Leu Tyr Leu Asp Thr His Leu
Asn Thr Leu Ala Asn Glu 20 25
30Pro Glu Lys Ala Phe Arg Ile Thr Gly Asn Ile Trp Val Ile Pro Asp
35 40 45Arg Phe Ser Arg Asn Ser Asn Pro
Asn Leu Asn Lys Pro Pro Arg Val 50 55
60Thr Ser Pro Lys Ser Gly Tyr Tyr Asp Pro Asn Tyr Leu Ser Thr Asp65
70 75 80Ser Asp Lys Asp Pro
Phe Leu Lys Glu Ile Ile Lys Leu Phe Lys Arg 85
90 95Ile Asn Ser Arg Glu Ile Gly Glu Glu Leu Ile
Tyr Arg Leu Ser Thr 100 105
110Asp Ile Pro Phe Pro Gly Asn Asn Asn Thr Pro Ile Asn Thr Phe Asp
115 120 125Phe Asp Val Asp Phe Asn Ser
Val Asp Val Lys Thr Arg Gln Gly Asn 130 135
140Asn Trp Val Lys Thr Gly Ser Ile Asn Pro Ser Val Ile Ile Thr
Gly145 150 155 160Pro Arg
Glu Asn Ile Ile Asp Pro Glu Thr Ser Thr Phe Lys Leu Thr
165 170 175Asn Asn Thr Phe Ala Ala Gln
Glu Gly Phe Gly Ala Leu Ser Ile Ile 180 185
190Ser Ile Ser Pro Arg Phe Met Leu Thr Tyr Ser Asn Ala Thr
Asn Asp 195 200 205Val Gly Glu Gly
Arg Phe Ser Lys Ser Glu Phe Cys Met Asp Pro Ile 210
215 220Leu Ile Leu Met His Glu Leu Asn His Ala Met His
Asn Leu Tyr Gly225 230 235
240Ile Ala Ile Pro Asn Asp Gln Thr Ile Ser Ser Val Thr Ser Asn Ile
245 250 255Phe Tyr Ser Gln Tyr
Asn Val Lys Leu Glu Tyr Ala Glu Ile Tyr Ala 260
265 270Phe Gly Gly Pro Thr Ile Asp Leu Ile Pro Lys Ser
Ala Arg Lys Tyr 275 280 285Phe Glu
Glu Lys Ala Leu Asp Tyr Tyr Arg Ser Ile Ala Lys Arg Leu 290
295 300Asn Ser Ile Thr Thr Ala Asn Pro Ser Ser Phe
Asn Lys Tyr Ile Gly305 310 315
320Glu Tyr Lys Gln Lys Leu Ile Arg Lys Tyr Arg Phe Val Val Glu Ser
325 330 335Ser Gly Glu Val
Thr Val Asn Arg Asn Lys Phe Val Glu Leu Tyr Asn 340
345 350Glu Leu Thr Gln Ile Phe Thr Glu Phe Asn Tyr
Ala Lys Ile Tyr Asn 355 360 365Val
Gln Asn Arg Lys Ile Tyr Leu Ser Asn Val Tyr Thr Pro Val Thr 370
375 380Ala Asn Ile Leu Asp Asp Asn Val Tyr Asp
Ile Gln Asn Gly Phe Asn385 390 395
400Ile Pro Lys Ser Asn Leu Asn Val Leu Phe Met Gly Gln Asn Leu
Ser 405 410 415Arg Asn Pro
Ala Leu Arg Lys Val Asn Pro Glu Asn Met Leu Tyr Leu 420
425 430Phe Thr Lys Phe Cys His Lys Ala Ile Asp
Gly Arg Ser Leu Tyr Asn 435 440
445Lys Thr Leu Asp Cys Arg Glu Leu Leu Val Lys Asn Thr Asp Leu Pro 450
455 460Phe Ile Gly Asp Ile Ser Asp Val
Lys Thr Asp Ile Phe Leu Arg Lys465 470
475 480Asp Ile Asn Glu Glu Thr Glu Val Ile Tyr Tyr Pro
Asp Asn Val Ser 485 490
495Val Asp Gln Val Ile Leu Ser Lys Asn Thr Ser Glu His Gly Gln Leu
500 505 510Asp Leu Leu Tyr Pro Ser
Ile Asp Ser Glu Ser Glu Ile Leu Pro Gly 515 520
525Glu Asn Gln Val Phe Tyr Asp Asn Arg Thr Gln Asn Val Asp
Tyr Leu 530 535 540Asn Ser Tyr Tyr Tyr
Leu Glu Ser Gln Lys Leu Ser Asp Asn Val Glu545 550
555 560Asp Phe Thr Phe Thr Arg Ser Ile Glu Glu
Ala Leu Asp Asn Ser Ala 565 570
575Lys Val Tyr Thr Tyr Phe Pro Thr Leu Ala Asn Lys Val Asn Ala Gly
580 585 590Val Gln Gly Gly Leu
Phe Leu Met Trp Ala Asn Asp Val Val Glu Asp 595
600 605Phe Thr Thr Asn Ile Leu Arg Lys Asp Thr Leu Asp
Lys Ile Ser Asp 610 615 620Val Ser Ala
Ile Ile Pro Tyr Ile Gly Pro Ala Leu Asn Ile Ser Asn625
630 635 640Ser Val Arg Arg Gly Asn Phe
Thr Glu Ala Phe Ala Val Thr Gly Val 645
650 655Thr Ile Leu Leu Glu Ala Phe Pro Glu Phe Thr Ile
Pro Ala Leu Gly 660 665 670Ala
Phe Val Ile Tyr Ser Lys Val Gln Glu Arg Asn Glu Ile Ile Lys 675
680 685Thr Ile Asp Asn Cys Leu Glu Gln Arg
Ile Lys Arg Trp Lys Asp Ser 690 695
700Tyr Glu Trp Met Met Gly Thr Trp Leu Ser Arg Ile Ile Thr Gln Phe705
710 715 720Asn Asn Ile Ser
Tyr Gln Met Tyr Asp Ser Leu Asn Tyr Gln Ala Gly 725
730 735Ala Ile Lys Ala Lys Ile Asp Leu Glu Tyr
Lys Lys Tyr Ser Gly Ser 740 745
750Asp Lys Glu Asn Ile Lys Ser Gln Val Glu Asn Leu Lys Asn Ser Leu
755 760 765Asp Val Lys Ile Ser Glu Ala
Met Asn Asn Ile Asn Lys Phe Ile Arg 770 775
780Glu Cys Ser Val Thr Tyr Leu Phe Lys Asn Met Leu Pro Lys Val
Ile785 790 795 800Asp Glu
Leu Asn Glu Phe Asp Arg Asn Thr Lys Ala Lys Leu Ile Asn
805 810 815Leu Ile Asp Ser His Asn Ile
Ile Leu Val Gly Glu Val Asp Lys Leu 820 825
830Lys Ala Lys Val Asn Asn Ser Phe Gln Asn Thr Ile Pro Phe
Asn Ile 835 840 845Phe Ser Tyr Thr
Asn Asn Ser Leu Leu Lys Asp Ile Ile Asn Glu Tyr 850
855 860Phe Asn Asn Ile Asn Asp Ser Lys Ile Leu Ser Leu
Gln Asn Arg Lys865 870 875
880Asn Thr Leu Val Asp Thr Ser Gly Tyr Asn Ala Glu Val Ser Glu Glu
885 890 895Gly Asp Val Gln Leu
Asn Pro Ile Phe Pro Phe Asp Phe Lys Leu Gly 900
905 910Ser Ser Gly Glu Asp Arg Gly Lys Val Ile Val Thr
Gln Asn Glu Asn 915 920 925Ile Val
Tyr Asn Ser Met Tyr Glu Ser Phe Ser Ile Ser Phe Trp Ile 930
935 940Arg Ile Asn Lys Trp Val Ser Asn Leu Pro Gly
Tyr Thr Ile Ile Asp945 950 955
960Ser Val Lys Asn Asn Ser Gly Trp Ser Ile Gly Ile Ile Ser Asn Phe
965 970 975Leu Val Phe Thr
Leu Lys Gln Asn Glu Asp Ser Glu Gln Ser Ile Asn 980
985 990Phe Ser Tyr Asp Ile Ser Asn Asn Ala Pro Gly
Tyr Asn Lys Trp Phe 995 1000
1005Phe Val Thr Val Thr Asn Asn Met Met Gly Asn Met Lys Ile Tyr Ile
1010 1015 1020Asn Gly Lys Leu Ile Asp Thr
Ile Lys Val Lys Glu Leu Thr Gly Ile1025 1030
1035 1040Asn Phe Ser Lys Thr Ile Thr Phe Glu Ile Asn Lys
Ile Pro Asp Thr 1045 1050
1055Gly Leu Ile Thr Ser Asp Ser Asp Asn Ile Asn Met Trp Ile Arg Asp
1060 1065 1070Phe Tyr Ile Phe Ala Lys
Glu Leu Asp Gly Lys Asp Ile Asn Ile Leu 1075 1080
1085Phe Asn Ser Leu Gln Tyr Thr Asn Val Val Lys Asp Tyr Trp
Gly Asn 1090 1095 1100Asp Leu Arg Tyr
Asn Lys Glu Tyr Tyr Met Val Asn Ile Asp Tyr Leu1105 1110
1115 1120Asn Arg Tyr Met Tyr Ala Asn Ser Arg
Gln Ile Val Phe Asn Thr Arg 1125 1130
1135Arg Asn Asn Asn Asp Phe Asn Glu Gly Tyr Lys Ile Ile Ile Lys
Arg 1140 1145 1150Ile Arg Gly
Asn Thr Asn Asp Thr Arg Val Arg Gly Gly Asp Ile Leu 1155
1160 1165Tyr Phe Asp Met Thr Ile Asn Asn Lys Ala Tyr
Asn Leu Phe Met Lys 1170 1175 1180Asn
Glu Thr Met Tyr Ala Asp Asn His Ser Thr Glu Asp Ile Tyr Ala1185
1190 1195 1200Ile Gly Leu Arg Glu Gln
Thr Lys Asp Ile Asn Asp Asn Ile Ile Phe 1205
1210 1215Gln Ile Gln Pro Met Asn Asn Thr Tyr Tyr Tyr Ala
Ser Gln Ile Phe 1220 1225
1230Lys Ser Asn Phe Asn Gly Glu Asn Ile Ser Gly Ile Cys Ser Ile Gly
1235 1240 1245Thr Tyr Arg Phe Arg Leu Gly
Gly Asp Trp Tyr Arg His Asn Tyr Leu 1250 1255
1260Val Pro Thr Val Lys Gln Gly Asn Tyr Ala Ser Leu Leu Glu Ser
Thr1265 1270 1275 1280Ser
Thr His Trp Gly Phe Val Pro Val Ser Glu 1285
129041276PRTClostridium botulinum serotype D 4Met Thr Trp Pro Val Lys
Asp Phe Asn Tyr Ser Asp Pro Val Asn Asp1 5
10 15Asn Asp Ile Leu Tyr Leu Arg Ile Pro Gln Asn Lys
Leu Ile Thr Thr 20 25 30Pro
Val Lys Ala Phe Met Ile Thr Gln Asn Ile Trp Val Ile Pro Glu 35
40 45Arg Phe Ser Ser Asp Thr Asn Pro Ser
Leu Ser Lys Pro Pro Arg Pro 50 55
60Thr Ser Lys Tyr Gln Ser Tyr Tyr Asp Pro Ser Tyr Leu Ser Thr Asp65
70 75 80Glu Gln Lys Asp Thr
Phe Leu Lys Gly Ile Ile Lys Leu Phe Lys Arg 85
90 95Ile Asn Glu Arg Asp Ile Gly Lys Lys Leu Ile
Asn Tyr Leu Val Val 100 105
110Gly Ser Pro Phe Met Gly Asp Ser Ser Thr Pro Glu Asp Thr Phe Asp
115 120 125Phe Thr Arg His Thr Thr Asn
Ile Ala Val Glu Lys Phe Glu Asn Gly 130 135
140Ser Trp Lys Val Thr Asn Ile Ile Thr Pro Ser Val Leu Ile Phe
Gly145 150 155 160Pro Leu
Pro Asn Ile Leu Asp Tyr Thr Ala Ser Leu Thr Leu Gln Gly
165 170 175Gln Gln Ser Asn Pro Ser Phe
Glu Gly Phe Gly Thr Leu Ser Ile Leu 180 185
190Lys Val Ala Pro Glu Phe Leu Leu Thr Phe Ser Asp Val Thr
Ser Asn 195 200 205Gln Ser Ser Ala
Val Leu Gly Lys Ser Ile Phe Cys Met Asp Pro Val 210
215 220Ile Ala Leu Met His Glu Leu Thr His Ser Leu His
Gln Leu Tyr Gly225 230 235
240Ile Asn Ile Pro Ser Asp Lys Arg Ile Arg Pro Gln Val Ser Glu Gly
245 250 255Phe Phe Ser Gln Asp
Gly Pro Asn Val Gln Phe Glu Glu Leu Tyr Thr 260
265 270Phe Gly Gly Leu Asp Val Glu Ile Ile Pro Gln Ile
Glu Arg Ser Gln 275 280 285Leu Arg
Glu Lys Ala Leu Gly His Tyr Lys Asp Ile Ala Lys Arg Leu 290
295 300Asn Asn Ile Asn Lys Thr Ile Pro Ser Ser Trp
Ile Ser Asn Ile Asp305 310 315
320Lys Tyr Lys Lys Ile Phe Ser Glu Lys Tyr Asn Phe Asp Lys Asp Asn
325 330 335Thr Gly Asn Phe
Val Val Asn Ile Asp Lys Phe Asn Ser Leu Tyr Ser 340
345 350Asp Leu Thr Asn Val Met Ser Glu Val Val Tyr
Ser Ser Gln Tyr Asn 355 360 365Val
Lys Asn Arg Thr His Tyr Phe Ser Arg His Tyr Leu Pro Val Phe 370
375 380Ala Asn Ile Leu Asp Asp Asn Ile Tyr Thr
Ile Arg Asp Gly Phe Asn385 390 395
400Leu Thr Asn Lys Gly Phe Asn Ile Glu Asn Ser Gly Gln Asn Ile
Glu 405 410 415Arg Asn Pro
Ala Leu Gln Lys Leu Ser Ser Glu Ser Val Val Asp Leu 420
425 430Phe Thr Lys Val Cys Leu Arg Leu Thr Lys
Asn Ser Arg Asp Asp Ser 435 440
445Thr Cys Ile Lys Val Lys Asn Asn Arg Leu Pro Tyr Val Ala Asp Lys 450
455 460Asp Ser Ile Ser Gln Glu Ile Phe
Glu Asn Lys Ile Ile Thr Asp Glu465 470
475 480Thr Asn Val Gln Asn Tyr Ser Asp Lys Phe Ser Leu
Asp Glu Ser Ile 485 490
495Leu Asp Gly Gln Val Pro Ile Asn Pro Glu Ile Val Asp Pro Leu Leu
500 505 510Pro Asn Val Asn Met Glu
Pro Leu Asn Leu Pro Gly Glu Glu Ile Val 515 520
525Phe Tyr Asp Asp Ile Thr Lys Tyr Val Asp Tyr Leu Asn Ser
Tyr Tyr 530 535 540Tyr Leu Glu Ser Gln
Lys Leu Ser Asn Asn Val Glu Asn Ile Thr Leu545 550
555 560Thr Thr Ser Val Glu Glu Ala Leu Gly Tyr
Ser Asn Lys Ile Tyr Thr 565 570
575Phe Leu Pro Ser Leu Ala Glu Lys Val Asn Lys Gly Val Gln Ala Gly
580 585 590Leu Phe Leu Asn Trp
Ala Asn Glu Val Val Glu Asp Phe Thr Thr Asn 595
600 605Ile Met Lys Lys Asp Thr Leu Asp Lys Ile Ser Asp
Val Ser Val Ile 610 615 620Ile Pro Tyr
Ile Gly Pro Ala Leu Asn Ile Gly Asn Ser Ala Leu Arg625
630 635 640Gly Asn Phe Asn Gln Ala Phe
Ala Thr Ala Gly Val Ala Phe Leu Leu 645
650 655Glu Gly Phe Pro Glu Phe Thr Ile Pro Ala Leu Gly
Val Phe Thr Phe 660 665 670Tyr
Ser Ser Ile Gln Glu Arg Glu Lys Ile Ile Lys Thr Ile Glu Asn 675
680 685Cys Leu Glu Gln Arg Val Lys Arg Trp
Lys Asp Ser Tyr Gln Trp Met 690 695
700Val Ser Asn Trp Leu Ser Arg Ile Thr Thr Gln Phe Asn His Ile Asn705
710 715 720Tyr Gln Met Tyr
Asp Ser Leu Ser Tyr Gln Ala Asp Ala Ile Lys Ala 725
730 735Lys Ile Asp Leu Glu Tyr Lys Lys Tyr Ser
Gly Ser Asp Lys Glu Asn 740 745
750Ile Lys Ser Gln Val Glu Asn Leu Lys Asn Ser Leu Asp Val Lys Ile
755 760 765Ser Glu Ala Met Asn Asn Ile
Asn Lys Phe Ile Arg Glu Cys Ser Val 770 775
780Thr Tyr Leu Phe Lys Asn Met Leu Pro Lys Val Ile Asp Glu Leu
Asn785 790 795 800Lys Phe
Asp Leu Arg Thr Lys Thr Glu Leu Ile Asn Leu Ile Asp Ser
805 810 815His Asn Ile Ile Leu Val Gly
Glu Val Asp Arg Leu Lys Ala Lys Val 820 825
830Asn Glu Ser Phe Glu Asn Thr Met Pro Phe Asn Ile Phe Ser
Tyr Thr 835 840 845Asn Asn Ser Leu
Leu Lys Asp Ile Ile Asn Glu Tyr Phe Asn Ser Ile 850
855 860Asn Asp Ser Lys Ile Leu Ser Leu Gln Asn Lys Lys
Asn Ala Leu Val865 870 875
880Asp Thr Ser Gly Tyr Asn Ala Glu Val Arg Val Gly Asp Asn Val Gln
885 890 895Leu Asn Thr Ile Tyr
Thr Asn Asp Phe Lys Leu Ser Ser Ser Gly Asp 900
905 910Lys Ile Ile Val Asn Leu Asn Asn Asn Ile Leu Tyr
Ser Ala Ile Tyr 915 920 925Glu Asn
Ser Ser Val Ser Phe Trp Ile Lys Ile Ser Lys Asp Leu Thr 930
935 940Asn Ser His Asn Glu Tyr Thr Ile Ile Asn Ser
Ile Glu Gln Asn Ser945 950 955
960Gly Trp Lys Leu Cys Ile Arg Asn Gly Asn Ile Glu Trp Ile Leu Gln
965 970 975Asp Val Asn Arg
Lys Tyr Lys Ser Leu Ile Phe Asp Tyr Ser Glu Ser 980
985 990Leu Ser His Thr Gly Tyr Thr Asn Lys Trp Phe
Phe Val Thr Ile Thr 995 1000
1005Asn Asn Ile Met Gly Tyr Met Lys Leu Tyr Ile Asn Gly Glu Leu Lys
1010 1015 1020Gln Ser Gln Lys Ile Glu Asp
Leu Asp Glu Val Lys Leu Asp Lys Thr1025 1030
1035 1040Ile Val Phe Gly Ile Asp Glu Asn Ile Asp Glu Asn
Gln Met Leu Trp 1045 1050
1055Ile Arg Asp Phe Asn Ile Phe Ser Lys Glu Leu Ser Asn Glu Asp Ile
1060 1065 1070Asn Ile Val Tyr Glu Gly
Gln Ile Leu Arg Asn Val Ile Lys Asp Tyr 1075 1080
1085Trp Gly Asn Pro Leu Lys Phe Asp Thr Glu Tyr Tyr Ile Ile
Asn Asp 1090 1095 1100Asn Tyr Ile Asp
Arg Tyr Ile Ala Pro Glu Ser Asn Val Leu Val Leu1105 1110
1115 1120Val Gln Tyr Pro Asp Arg Ser Lys Leu
Tyr Thr Gly Asn Pro Ile Thr 1125 1130
1135Ile Lys Ser Val Ser Asp Lys Asn Pro Tyr Ser Arg Ile Leu Asn
Gly 1140 1145 1150Asp Asn Ile
Ile Leu His Met Leu Tyr Asn Ser Arg Lys Tyr Met Ile 1155
1160 1165Ile Arg Asp Thr Asp Thr Ile Tyr Ala Thr Gln
Gly Gly Glu Cys Ser 1170 1175 1180Gln
Asn Cys Val Tyr Ala Leu Lys Leu Gln Ser Asn Leu Gly Asn Tyr1185
1190 1195 1200Gly Ile Gly Ile Phe Ser
Ile Lys Asn Ile Val Ser Lys Asn Lys Tyr 1205
1210 1215Cys Ser Gln Ile Phe Ser Ser Phe Arg Glu Asn Thr
Met Leu Leu Ala 1220 1225
1230Asp Ile Tyr Lys Pro Trp Arg Phe Ser Phe Lys Asn Ala Tyr Thr Pro
1235 1240 1245Val Ala Val Thr Asn Tyr Glu
Thr Lys Leu Leu Ser Thr Ser Ser Phe 1250 1255
1260Trp Lys Phe Ile Ser Arg Asp Pro Gly Trp Val Glu1265
1270 127551252PRTClostridium botulinum serotype E 5Met
Pro Lys Ile Asn Ser Phe Asn Tyr Asn Asp Pro Val Asn Asp Arg1
5 10 15Thr Ile Leu Tyr Ile Lys Pro
Gly Gly Cys Gln Glu Phe Tyr Lys Ser 20 25
30Phe Asn Ile Met Lys Asn Ile Trp Ile Ile Pro Glu Arg Asn
Val Ile 35 40 45Gly Thr Thr Pro
Gln Asp Phe His Pro Pro Thr Ser Leu Lys Asn Gly 50 55
60Asp Ser Ser Tyr Tyr Asp Pro Asn Tyr Leu Gln Ser Asp
Glu Glu Lys65 70 75
80Asp Arg Phe Leu Lys Ile Val Thr Lys Ile Phe Asn Arg Ile Asn Asn
85 90 95Asn Leu Ser Gly Gly Ile
Leu Leu Glu Glu Leu Ser Lys Ala Asn Pro 100
105 110Tyr Leu Gly Asn Asp Asn Thr Pro Asp Asn Gln Phe
His Ile Gly Asp 115 120 125Ala Ser
Ala Val Glu Ile Lys Phe Ser Asn Gly Ser Gln Asp Ile Leu 130
135 140Leu Pro Asn Val Ile Ile Met Gly Ala Glu Pro
Asp Leu Phe Glu Thr145 150 155
160Asn Ser Ser Asn Ile Ser Leu Arg Asn Asn Tyr Met Pro Ser Asn His
165 170 175Gly Phe Gly Ser
Ile Ala Ile Val Thr Phe Ser Pro Glu Tyr Ser Phe 180
185 190Arg Phe Asn Asp Asn Ser Met Asn Glu Phe Ile
Gln Asp Pro Ala Leu 195 200 205Thr
Leu Met His Glu Leu Ile His Ser Leu His Gly Leu Tyr Gly Ala 210
215 220Lys Gly Ile Thr Thr Lys Tyr Thr Ile Thr
Gln Lys Gln Asn Pro Leu225 230 235
240Ile Thr Asn Ile Arg Gly Thr Asn Ile Glu Glu Phe Leu Thr Phe
Gly 245 250 255Gly Thr Asp
Leu Asn Ile Ile Thr Ser Ala Gln Ser Asn Asp Ile Tyr 260
265 270Thr Asn Leu Leu Ala Asp Tyr Lys Lys Ile
Ala Ser Lys Leu Ser Lys 275 280
285Val Gln Val Ser Asn Pro Leu Leu Asn Pro Tyr Lys Asp Val Phe Glu 290
295 300Ala Lys Tyr Gly Leu Asp Lys Asp
Ala Ser Gly Ile Tyr Ser Val Asn305 310
315 320Ile Asn Lys Phe Asn Asp Ile Phe Lys Lys Leu Tyr
Ser Phe Thr Glu 325 330
335Phe Asp Leu Ala Thr Lys Phe Gln Val Lys Cys Arg Gln Thr Tyr Ile
340 345 350Gly Gln Tyr Lys Tyr Phe
Lys Leu Ser Asn Leu Leu Asn Asp Ser Ile 355 360
365Tyr Asn Ile Ser Glu Gly Tyr Asn Ile Asn Asn Leu Lys Val
Asn Phe 370 375 380Arg Gly Gln Asn Ala
Asn Leu Asn Pro Arg Ile Ile Thr Pro Ile Thr385 390
395 400Gly Arg Gly Leu Val Lys Lys Ile Ile Arg
Phe Cys Lys Asn Ile Val 405 410
415Ser Val Lys Gly Ile Arg Lys Ser Ile Cys Ile Glu Ile Asn Asn Gly
420 425 430Glu Leu Phe Phe Val
Ala Ser Glu Asn Ser Tyr Asn Asp Asp Asn Ile 435
440 445Asn Thr Pro Lys Glu Ile Asp Asp Thr Val Thr Ser
Asn Asn Asn Tyr 450 455 460Glu Asn Asp
Leu Asp Gln Val Ile Leu Asn Phe Asn Ser Glu Ser Ala465
470 475 480Pro Gly Leu Ser Asp Glu Lys
Leu Asn Leu Thr Ile Gln Asn Asp Ala 485
490 495Tyr Ile Pro Lys Tyr Asp Ser Asn Gly Thr Ser Asp
Ile Glu Gln His 500 505 510Asp
Val Asn Glu Leu Asn Val Phe Phe Tyr Leu Asp Ala Gln Lys Val 515
520 525Pro Glu Gly Glu Asn Asn Val Asn Leu
Thr Ser Ser Ile Asp Thr Ala 530 535
540Leu Leu Glu Gln Pro Lys Ile Tyr Thr Phe Phe Ser Ser Glu Phe Ile545
550 555 560Asn Asn Val Asn
Lys Pro Val Gln Ala Ala Leu Phe Val Ser Trp Ile 565
570 575Gln Gln Val Leu Val Asp Phe Thr Thr Glu
Ala Asn Gln Lys Ser Thr 580 585
590Val Asp Lys Ile Ala Asp Ile Ser Ile Val Val Pro Tyr Ile Gly Leu
595 600 605Ala Leu Asn Ile Gly Asn Glu
Ala Gln Lys Gly Asn Phe Lys Asp Ala 610 615
620Leu Glu Leu Leu Gly Ala Gly Ile Leu Leu Glu Phe Glu Pro Glu
Leu625 630 635 640Leu Ile
Pro Thr Ile Leu Val Phe Thr Ile Lys Ser Phe Leu Gly Ser
645 650 655Ser Asp Asn Lys Asn Lys Val
Ile Lys Ala Ile Asn Asn Ala Leu Lys 660 665
670Glu Arg Asp Glu Lys Trp Lys Glu Val Tyr Ser Phe Ile Val
Ser Asn 675 680 685Trp Met Thr Lys
Ile Asn Thr Gln Phe Asn Lys Arg Lys Glu Gln Met 690
695 700Tyr Gln Ala Leu Gln Asn Gln Val Asn Ala Ile Lys
Thr Ile Ile Glu705 710 715
720Ser Lys Tyr Asn Ser Tyr Thr Leu Glu Glu Lys Asn Glu Leu Thr Asn
725 730 735Lys Tyr Asp Ile Lys
Gln Ile Glu Asn Glu Leu Asn Gln Lys Val Ser 740
745 750Ile Ala Met Asn Asn Ile Asp Arg Phe Leu Thr Glu
Ser Ser Ile Ser 755 760 765Tyr Leu
Met Lys Leu Ile Asn Glu Val Lys Ile Asn Lys Leu Arg Glu 770
775 780Tyr Asp Glu Asn Val Lys Thr Tyr Leu Leu Asn
Tyr Ile Ile Gln His785 790 795
800Gly Ser Ile Leu Gly Glu Ser Gln Gln Glu Leu Asn Ser Met Val Thr
805 810 815Asp Thr Leu Asn
Asn Ser Ile Pro Phe Lys Leu Ser Ser Tyr Thr Asp 820
825 830Asp Lys Ile Leu Ile Ser Tyr Phe Asn Lys Phe
Phe Lys Arg Ile Lys 835 840 845Ser
Ser Ser Val Leu Asn Met Arg Tyr Lys Asn Asp Lys Tyr Val Asp 850
855 860Thr Ser Gly Tyr Asp Ser Asn Ile Asn Ile
Asn Gly Asp Val Tyr Lys865 870 875
880Tyr Pro Thr Asn Lys Asn Gln Phe Gly Ile Tyr Asn Asp Lys Leu
Ser 885 890 895Glu Val Asn
Ile Ser Gln Asn Asp Tyr Ile Ile Tyr Asp Asn Lys Tyr 900
905 910Lys Asn Phe Ser Ile Ser Phe Trp Val Arg
Ile Pro Asn Tyr Asp Asn 915 920
925Lys Ile Val Asn Val Asn Asn Glu Tyr Thr Ile Ile Asn Cys Met Arg 930
935 940Asp Asn Asn Ser Gly Trp Lys Val
Ser Leu Asn His Asn Glu Ile Ile945 950
955 960Trp Thr Leu Gln Asp Asn Ala Gly Ile Asn Gln Lys
Leu Ala Phe Asn 965 970
975Tyr Gly Asn Ala Asn Gly Ile Ser Asp Tyr Ile Asn Lys Trp Ile Phe
980 985 990Val Thr Ile Thr Asn Asp
Arg Leu Gly Asp Ser Lys Leu Tyr Ile Asn 995 1000
1005Gly Asn Leu Ile Asp Gln Lys Ser Ile Leu Asn Leu Gly Asn
Ile His 1010 1015 1020Val Ser Asp Asn
Ile Leu Phe Lys Ile Val Asn Cys Ser Tyr Thr Arg1025 1030
1035 1040Tyr Ile Gly Ile Arg Tyr Phe Asn Ile
Phe Asp Lys Glu Leu Asp Glu 1045 1050
1055Thr Glu Ile Gln Thr Leu Tyr Ser Asn Glu Pro Asn Thr Asn Ile
Leu 1060 1065 1070Lys Asp Phe
Trp Gly Asn Tyr Leu Leu Tyr Asp Lys Glu Tyr Tyr Leu 1075
1080 1085Leu Asn Val Leu Lys Pro Asn Asn Phe Ile Asp
Arg Arg Lys Asp Ser 1090 1095 1100Thr
Leu Ser Ile Asn Asn Ile Arg Ser Thr Ile Leu Leu Ala Asn Arg1105
1110 1115 1120Leu Tyr Ser Gly Ile Lys
Val Lys Ile Gln Arg Val Asn Asn Ser Ser 1125
1130 1135Thr Asn Asp Asn Leu Val Arg Lys Asn Asp Gln Val
Tyr Ile Asn Phe 1140 1145
1150Val Ala Ser Lys Thr His Leu Phe Pro Leu Tyr Ala Asp Thr Ala Thr
1155 1160 1165Thr Asn Lys Glu Lys Thr Ile
Lys Ile Ser Ser Ser Gly Asn Arg Phe 1170 1175
1180Asn Gln Val Val Val Met Asn Ser Val Gly Asn Asn Cys Thr Met
Asn1185 1190 1195 1200Phe
Lys Asn Asn Asn Gly Asn Asn Ile Gly Leu Leu Gly Phe Lys Ala
1205 1210 1215Asp Thr Val Val Ala Ser Thr
Trp Tyr Tyr Thr His Met Arg Asp His 1220 1225
1230Thr Asn Ser Asn Gly Cys Phe Trp Asn Phe Ile Ser Glu Glu
His Gly 1235 1240 1245Trp Gln Glu
Lys 125061274PRTClostridium botulinum serotype F 6Met Pro Val Ala Ile
Asn Ser Phe Asn Tyr Asn Asp Pro Val Asn Asp1 5
10 15Asp Thr Ile Leu Tyr Met Gln Ile Pro Tyr Glu
Glu Lys Ser Lys Lys 20 25
30Tyr Tyr Lys Ala Phe Glu Ile Met Arg Asn Val Trp Ile Ile Pro Glu
35 40 45Arg Asn Thr Ile Gly Thr Asn Pro
Ser Asp Phe Asp Pro Pro Ala Ser 50 55
60Leu Lys Asn Gly Ser Ser Ala Tyr Tyr Asp Pro Asn Tyr Leu Thr Thr65
70 75 80Asp Ala Glu Lys Asp
Arg Tyr Leu Lys Thr Thr Ile Lys Leu Phe Lys 85
90 95Arg Ile Asn Ser Asn Pro Ala Gly Lys Val Leu
Leu Gln Glu Ile Ser 100 105
110Tyr Ala Lys Pro Tyr Leu Gly Asn Asp His Thr Pro Ile Asp Glu Phe
115 120 125Ser Pro Val Thr Arg Thr Thr
Ser Val Asn Ile Lys Leu Ser Thr Asn 130 135
140Val Glu Ser Ser Met Leu Leu Asn Leu Leu Val Leu Gly Ala Gly
Pro145 150 155 160Asp Ile
Phe Glu Ser Cys Cys Tyr Pro Val Arg Lys Leu Ile Asp Pro
165 170 175Asp Val Val Tyr Asp Pro Ser
Asn Tyr Gly Phe Gly Ser Ile Asn Ile 180 185
190Val Thr Phe Ser Pro Glu Tyr Glu Tyr Thr Phe Asn Asp Ile
Ser Gly 195 200 205Gly His Asn Ser
Ser Thr Glu Ser Phe Ile Ala Asp Pro Ala Ile Ser 210
215 220Leu Ala His Glu Leu Ile His Ala Leu His Gly Leu
Tyr Gly Ala Arg225 230 235
240Gly Val Thr Tyr Glu Glu Thr Ile Glu Val Lys Gln Ala Pro Leu Met
245 250 255Ile Ala Glu Lys Pro
Ile Arg Leu Glu Glu Phe Leu Thr Phe Gly Gly 260
265 270Gln Asp Leu Asn Ile Ile Thr Ser Ala Met Lys Glu
Lys Ile Tyr Asn 275 280 285Asn Leu
Leu Ala Asn Tyr Glu Lys Ile Ala Thr Arg Leu Ser Glu Val 290
295 300Asn Ser Ala Pro Pro Glu Tyr Asp Ile Asn Glu
Tyr Lys Asp Tyr Phe305 310 315
320Gln Trp Lys Tyr Gly Leu Asp Lys Asn Ala Asp Gly Ser Tyr Thr Val
325 330 335Asn Glu Asn Lys
Phe Asn Glu Ile Tyr Lys Lys Leu Tyr Ser Phe Thr 340
345 350Glu Ser Asp Leu Ala Asn Lys Phe Lys Val Lys
Cys Arg Asn Thr Tyr 355 360 365Phe
Ile Lys Tyr Glu Phe Leu Lys Val Pro Asn Leu Leu Asp Asp Asp 370
375 380Ile Tyr Thr Val Ser Glu Gly Phe Asn Ile
Gly Asn Leu Ala Val Asn385 390 395
400Asn Arg Gly Gln Ser Ile Lys Leu Asn Pro Lys Ile Ile Asp Ser
Ile 405 410 415Pro Asp Lys
Gly Leu Val Glu Lys Ile Val Lys Phe Cys Lys Ser Val 420
425 430Ile Pro Arg Lys Gly Thr Lys Ala Pro Pro
Arg Leu Cys Ile Arg Val 435 440
445Asn Asn Ser Glu Leu Phe Phe Val Ala Ser Glu Ser Ser Tyr Asn Glu 450
455 460Asn Asp Ile Asn Thr Pro Lys Glu
Ile Asp Asp Thr Thr Asn Leu Asn465 470
475 480Asn Asn Tyr Arg Asn Asn Leu Asp Glu Val Ile Leu
Asp Tyr Asn Ser 485 490
495Gln Thr Ile Pro Gln Ile Ser Asn Arg Thr Leu Asn Thr Leu Val Gln
500 505 510Asp Asn Ser Tyr Val Pro
Arg Tyr Asp Ser Asn Gly Thr Ser Glu Ile 515 520
525Glu Glu Tyr Asp Val Val Asp Phe Asn Val Phe Phe Tyr Leu
His Ala 530 535 540Gln Lys Val Pro Glu
Gly Glu Thr Asn Ile Ser Leu Thr Ser Ser Ile545 550
555 560Asp Thr Ala Leu Leu Glu Glu Ser Lys Asp
Ile Phe Phe Ser Ser Glu 565 570
575Phe Ile Asp Thr Ile Asn Lys Pro Val Asn Ala Ala Leu Phe Ile Asp
580 585 590Trp Ile Ser Lys Val
Ile Arg Asp Phe Thr Thr Glu Ala Thr Gln Lys 595
600 605Ser Thr Val Asp Lys Ile Ala Asp Ile Ser Leu Ile
Val Pro Tyr Val 610 615 620Gly Leu Ala
Leu Asn Ile Ile Ile Glu Ala Glu Lys Gly Asn Phe Glu625
630 635 640Glu Ala Phe Glu Leu Leu Gly
Val Gly Ile Leu Leu Glu Phe Val Pro 645
650 655Glu Leu Thr Ile Pro Val Ile Leu Val Phe Thr Ile
Lys Ser Tyr Ile 660 665 670Asp
Ser Tyr Glu Asn Lys Asn Lys Ala Ile Lys Ala Ile Asn Asn Ser 675
680 685Leu Ile Glu Arg Glu Ala Lys Trp Lys
Glu Ile Tyr Ser Trp Ile Val 690 695
700Ser Asn Trp Leu Thr Arg Ile Asn Thr Gln Phe Asn Lys Arg Lys Glu705
710 715 720Gln Met Tyr Gln
Ala Leu Gln Asn Gln Val Asp Ala Ile Lys Thr Ala 725
730 735Ile Glu Tyr Lys Tyr Asn Asn Tyr Thr Ser
Asp Glu Lys Asn Arg Leu 740 745
750Glu Ser Glu Tyr Asn Ile Asn Asn Ile Glu Glu Glu Leu Asn Lys Lys
755 760 765Val Ser Leu Ala Met Lys Asn
Ile Glu Arg Phe Met Thr Glu Ser Ser 770 775
780Ile Ser Tyr Leu Met Lys Leu Ile Asn Glu Ala Lys Val Gly Lys
Leu785 790 795 800Lys Lys
Tyr Asp Asn His Val Lys Ser Asp Leu Leu Asn Tyr Ile Leu
805 810 815Asp His Arg Ser Ile Leu Gly
Glu Gln Thr Asn Glu Leu Ser Asp Leu 820 825
830Val Thr Ser Thr Leu Asn Ser Ser Ile Pro Phe Glu Leu Ser
Ser Tyr 835 840 845Thr Asn Asp Lys
Ile Leu Ile Ile Tyr Phe Asn Arg Leu Tyr Lys Lys 850
855 860Ile Lys Asp Ser Ser Ile Leu Asp Met Arg Tyr Glu
Asn Asn Lys Phe865 870 875
880Ile Asp Ile Ser Gly Tyr Gly Ser Asn Ile Ser Ile Asn Gly Asn Val
885 890 895Tyr Ile Tyr Ser Thr
Asn Arg Asn Gln Phe Gly Ile Tyr Asn Ser Arg 900
905 910Leu Ser Glu Val Asn Ile Ala Gln Asn Asn Asp Ile
Ile Tyr Asn Ser 915 920 925Arg Tyr
Gln Asn Phe Ser Ile Ser Phe Trp Val Arg Ile Pro Lys His 930
935 940Tyr Lys Pro Met Asn His Asn Arg Glu Tyr Thr
Ile Ile Asn Cys Met945 950 955
960Gly Asn Asn Asn Ser Gly Trp Lys Ile Ser Leu Arg Thr Val Arg Asp
965 970 975Cys Glu Ile Ile
Trp Thr Leu Gln Asp Thr Ser Gly Asn Lys Glu Asn 980
985 990Leu Ile Phe Arg Tyr Glu Glu Leu Asn Arg Ile
Ser Asn Tyr Ile Asn 995 1000
1005Lys Trp Ile Phe Val Thr Ile Thr Asn Asn Arg Leu Gly Asn Ser Arg
1010 1015 1020Ile Tyr Ile Asn Gly Asn Leu
Ile Val Glu Lys Ser Ile Ser Asn Leu1025 1030
1035 1040Gly Asp Ile His Val Ser Asp Asn Ile Leu Phe Lys
Ile Val Gly Cys 1045 1050
1055Asp Asp Glu Thr Tyr Val Gly Ile Arg Tyr Phe Lys Val Phe Asn Thr
1060 1065 1070Glu Leu Asp Lys Thr Glu
Ile Glu Thr Leu Tyr Ser Asn Glu Pro Asp 1075 1080
1085Pro Ser Ile Leu Lys Asn Tyr Trp Gly Asn Tyr Leu Leu Tyr
Asn Lys 1090 1095 1100Lys Tyr Tyr Leu
Phe Asn Leu Leu Arg Lys Asp Lys Tyr Ile Thr Leu1105 1110
1115 1120Asn Ser Gly Ile Leu Asn Ile Asn Gln
Gln Arg Gly Val Thr Glu Gly 1125 1130
1135Ser Val Phe Leu Asn Tyr Lys Leu Tyr Glu Gly Val Glu Val Ile
Ile 1140 1145 1150Arg Lys Asn
Gly Pro Ile Asp Ile Ser Asn Thr Asp Asn Phe Val Arg 1155
1160 1165Lys Asn Asp Leu Ala Tyr Ile Asn Val Val Asp
Arg Gly Val Glu Tyr 1170 1175 1180Arg
Leu Tyr Ala Asp Thr Lys Ser Glu Lys Glu Lys Ile Ile Arg Thr1185
1190 1195 1200Ser Asn Leu Asn Asp Ser
Leu Gly Gln Ile Ile Val Met Asp Ser Ile 1205
1210 1215Gly Asn Asn Cys Thr Met Asn Phe Gln Asn Asn Asn
Gly Ser Asn Ile 1220 1225
1230Gly Leu Leu Gly Phe His Ser Asn Asn Leu Val Ala Ser Ser Trp Tyr
1235 1240 1245Tyr Asn Asn Ile Arg Arg Asn
Thr Ser Ser Asn Gly Cys Phe Trp Ser 1250 1255
1260Ser Ile Ser Lys Glu Asn Gly Trp Lys Glu1265
127071297PRTClostridium botulinum serotype G 7Met Pro Val Asn Ile Lys Asn
Phe Asn Tyr Asn Asp Pro Ile Asn Asn1 5 10
15Asp Asp Ile Ile Met Met Glu Pro Phe Asn Asp Pro Gly
Pro Gly Thr 20 25 30Tyr Tyr
Lys Ala Phe Arg Ile Ile Asp Arg Ile Trp Ile Val Pro Glu 35
40 45Arg Phe Thr Tyr Gly Phe Gln Pro Asp Gln
Phe Asn Ala Ser Thr Gly 50 55 60Val
Phe Ser Lys Asp Val Tyr Glu Tyr Tyr Asp Pro Thr Tyr Leu Lys65
70 75 80Thr Asp Ala Glu Lys Asp
Lys Phe Leu Lys Thr Met Ile Lys Leu Phe 85
90 95Asn Arg Ile Asn Ser Lys Pro Ser Gly Gln Arg Leu
Leu Asp Met Ile 100 105 110Val
Asp Ala Ile Pro Tyr Leu Gly Asn Ala Ser Thr Pro Pro Asp Lys 115
120 125Phe Ala Ala Asn Val Ala Asn Val Ser
Ile Asn Lys Lys Ile Ile Gln 130 135
140Pro Gly Ala Glu Asp Gln Ile Lys Gly Leu Met Thr Asn Leu Ile Ile145
150 155 160Phe Gly Pro Gly
Pro Val Leu Ser Asp Asn Phe Thr Asp Ser Met Ile 165
170 175Met Asn Gly His Ser Pro Ile Ser Glu Gly
Phe Gly Ala Arg Met Met 180 185
190Ile Arg Phe Cys Pro Ser Cys Leu Asn Val Phe Asn Asn Val Gln Glu
195 200 205Asn Lys Asp Thr Ser Ile Phe
Ser Arg Arg Ala Tyr Phe Ala Asp Pro 210 215
220Ala Leu Thr Leu Met His Glu Leu Ile His Val Leu His Gly Leu
Tyr225 230 235 240Gly Ile
Lys Ile Ser Asn Leu Pro Ile Thr Pro Asn Thr Lys Glu Phe
245 250 255Phe Met Gln His Ser Asp Pro
Val Gln Ala Glu Glu Leu Tyr Thr Phe 260 265
270Gly Gly His Asp Pro Ser Val Ile Ser Pro Ser Thr Asp Met
Asn Ile 275 280 285Tyr Asn Lys Ala
Leu Gln Asn Phe Gln Asp Ile Ala Asn Arg Leu Asn 290
295 300Ile Val Ser Ser Ala Gln Gly Ser Gly Ile Asp Ile
Ser Leu Tyr Lys305 310 315
320Gln Ile Tyr Lys Asn Lys Tyr Asp Phe Val Glu Asp Pro Asn Gly Lys
325 330 335Tyr Ser Val Asp Lys
Asp Lys Phe Asp Lys Leu Tyr Lys Ala Leu Met 340
345 350Phe Gly Phe Thr Glu Thr Asn Leu Ala Gly Glu Tyr
Gly Ile Lys Thr 355 360 365Arg Tyr
Ser Tyr Phe Ser Glu Tyr Leu Pro Pro Ile Lys Thr Glu Lys 370
375 380Leu Leu Asp Asn Thr Ile Tyr Thr Gln Asn Glu
Gly Phe Asn Ile Ala385 390 395
400Ser Lys Asn Leu Lys Thr Glu Phe Asn Gly Gln Asn Lys Ala Val Asn
405 410 415Lys Glu Ala Tyr
Glu Glu Ile Ser Leu Glu His Leu Val Ile Tyr Arg 420
425 430Ile Ala Met Cys Lys Pro Val Met Tyr Lys Asn
Thr Gly Lys Ser Glu 435 440 445Gln
Cys Ile Ile Val Asn Asn Glu Asp Leu Phe Phe Ile Ala Asn Lys 450
455 460Asp Ser Phe Ser Lys Asp Leu Ala Lys Ala
Glu Thr Ile Ala Tyr Asn465 470 475
480Thr Gln Asn Asn Thr Ile Glu Asn Asn Phe Ser Ile Asp Gln Leu
Ile 485 490 495Leu Asp Asn
Asp Leu Ser Ser Gly Ile Asp Leu Pro Asn Glu Asn Thr 500
505 510Glu Pro Phe Thr Asn Phe Asp Asp Ile Asp
Ile Pro Val Tyr Ile Lys 515 520
525Gln Ser Ala Leu Lys Lys Ile Phe Val Asp Gly Asp Ser Leu Phe Glu 530
535 540Tyr Leu His Ala Gln Thr Phe Pro
Ser Asn Ile Glu Asn Leu Gln Leu545 550
555 560Thr Asn Ser Leu Asn Asp Ala Leu Arg Asn Asn Asn
Lys Val Tyr Thr 565 570
575Phe Phe Ser Thr Asn Leu Val Glu Lys Ala Asn Thr Val Val Gly Ala
580 585 590Ser Leu Phe Val Asn Trp
Val Lys Gly Val Ile Asp Asp Phe Thr Ser 595 600
605Glu Ser Thr Gln Lys Ser Thr Ile Asp Lys Val Ser Asp Val
Ser Ile 610 615 620Ile Ile Pro Tyr Ile
Gly Pro Ala Leu Asn Val Gly Asn Glu Thr Ala625 630
635 640Lys Glu Asn Phe Lys Asn Ala Phe Glu Ile
Gly Gly Ala Ala Ile Leu 645 650
655Met Glu Phe Ile Pro Glu Leu Ile Val Pro Ile Val Gly Phe Phe Thr
660 665 670Leu Glu Ser Tyr Val
Gly Asn Lys Gly His Ile Ile Met Thr Ile Ser 675
680 685Asn Ala Leu Lys Lys Arg Asp Gln Lys Trp Thr Asp
Met Tyr Gly Leu 690 695 700Ile Val Ser
Gln Trp Leu Ser Thr Val Asn Thr Gln Phe Tyr Thr Ile705
710 715 720Lys Glu Arg Met Tyr Asn Ala
Leu Asn Asn Gln Ser Gln Ala Ile Glu 725
730 735Lys Ile Ile Glu Asp Gln Tyr Asn Arg Tyr Ser Glu
Glu Asp Lys Met 740 745 750Asn
Ile Asn Ile Asp Phe Asn Asp Ile Asp Phe Lys Leu Asn Gln Ser 755
760 765Ile Asn Leu Ala Ile Asn Asn Ile Asp
Asp Phe Ile Asn Gln Cys Ser 770 775
780Ile Ser Tyr Leu Met Asn Arg Met Ile Pro Leu Ala Val Lys Lys Leu785
790 795 800Lys Asp Phe Asp
Asp Asn Leu Lys Arg Asp Leu Leu Glu Tyr Ile Asp 805
810 815Thr Asn Glu Leu Tyr Leu Leu Asp Glu Val
Asn Ile Leu Lys Ser Lys 820 825
830Val Asn Arg His Leu Lys Asp Ser Ile Pro Phe Asp Leu Ser Leu Tyr
835 840 845Thr Lys Asp Thr Ile Leu Ile
Gln Val Phe Asn Asn Tyr Ile Ser Asn 850 855
860Ile Ser Ser Asn Ala Ile Leu Ser Leu Ser Tyr Arg Gly Gly Arg
Leu865 870 875 880Ile Asp
Ser Ser Gly Tyr Gly Ala Thr Met Asn Val Gly Ser Asp Val
885 890 895Ile Phe Asn Asp Ile Gly Asn
Gly Gln Phe Lys Leu Asn Asn Ser Glu 900 905
910Asn Ser Asn Ile Thr Ala His Gln Ser Lys Phe Val Val Tyr
Asp Ser 915 920 925Met Phe Asp Asn
Phe Ser Ile Asn Phe Trp Val Arg Thr Pro Lys Tyr 930
935 940Asn Asn Asn Asp Ile Gln Thr Tyr Leu Gln Asn Glu
Tyr Thr Ile Ile945 950 955
960Ser Cys Ile Lys Asn Asp Ser Gly Trp Lys Val Ser Ile Lys Gly Asn
965 970 975Arg Ile Ile Trp Thr
Leu Ile Asp Val Asn Ala Lys Ser Lys Ser Ile 980
985 990Phe Phe Glu Tyr Ser Ile Lys Asp Asn Ile Ser Asp
Tyr Ile Asn Lys 995 1000 1005Trp
Phe Ser Ile Thr Ile Thr Asn Asp Arg Leu Gly Asn Ala Asn Ile 1010
1015 1020Tyr Ile Asn Gly Ser Leu Lys Lys Ser Glu
Lys Ile Leu Asn Leu Asp1025 1030 1035
1040Arg Ile Asn Ser Ser Asn Asp Ile Asp Phe Lys Leu Ile Asn Cys
Thr 1045 1050 1055Asp Thr
Thr Lys Phe Val Trp Ile Lys Asp Phe Asn Ile Phe Gly Arg 1060
1065 1070Glu Leu Asn Ala Thr Glu Val Ser Ser
Leu Tyr Trp Ile Gln Ser Ser 1075 1080
1085Thr Asn Thr Leu Lys Asp Phe Trp Gly Asn Pro Leu Arg Tyr Asp Thr
1090 1095 1100Gln Tyr Tyr Leu Phe Asn Gln
Gly Met Gln Asn Ile Tyr Ile Lys Tyr1105 1110
1115 1120Phe Ser Lys Ala Ser Met Gly Glu Thr Ala Pro Arg
Thr Asn Phe Asn 1125 1130
1135Asn Ala Ala Ile Asn Tyr Gln Asn Leu Tyr Leu Gly Leu Arg Phe Ile
1140 1145 1150Ile Lys Lys Ala Ser Asn
Ser Arg Asn Ile Asn Asn Asp Asn Ile Val 1155 1160
1165Arg Glu Gly Asp Tyr Ile Tyr Leu Asn Ile Asp Asn Ile Ser
Asp Glu 1170 1175 1180Ser Tyr Arg Val
Tyr Val Leu Val Asn Ser Lys Glu Ile Gln Thr Gln1185 1190
1195 1200Leu Phe Leu Ala Pro Ile Asn Asp Asp
Pro Thr Phe Tyr Asp Val Leu 1205 1210
1215Gln Ile Lys Lys Tyr Tyr Glu Lys Thr Thr Tyr Asn Cys Gln Ile
Leu 1220 1225 1230Cys Glu Lys
Asp Thr Lys Thr Phe Gly Leu Phe Gly Ile Gly Lys Phe 1235
1240 1245Val Lys Asp Tyr Gly Tyr Val Trp Asp Thr Tyr
Asp Asn Tyr Phe Cys 1250 1255 1260Ile
Ser Gln Trp Tyr Leu Arg Arg Ile Ser Glu Asn Ile Asn Lys Leu1265
1270 1275 1280Arg Leu Gly Cys Asn Trp
Gln Phe Ile Pro Val Asp Glu Gly Trp Thr 1285
1290 1295Glu81315PRTClostridium teteni 8Met Pro Ile Thr
Ile Asn Asn Phe Arg Tyr Ser Asp Pro Val Asn Asn1 5
10 15Asp Thr Ile Ile Met Met Glu Pro Pro Tyr
Cys Lys Gly Leu Asp Ile 20 25
30Tyr Tyr Lys Ala Phe Lys Ile Thr Asp Arg Ile Trp Ile Val Pro Glu
35 40 45Arg Tyr Glu Phe Gly Thr Lys Pro
Glu Asp Phe Asn Pro Pro Ser Ser 50 55
60Leu Ile Glu Gly Ala Ser Glu Tyr Tyr Asp Pro Asn Tyr Leu Arg Thr65
70 75 80Asp Ser Asp Lys Asp
Arg Phe Leu Gln Thr Met Val Lys Leu Phe Asn 85
90 95Arg Ile Lys Asn Asn Val Ala Gly Glu Ala Leu
Leu Asp Lys Ile Ile 100 105
110Asn Ala Ile Pro Tyr Leu Gly Asn Ser Tyr Ser Leu Leu Asp Lys Phe
115 120 125Asp Thr Asn Ser Asn Ser Val
Ser Phe Asn Leu Leu Glu Gln Asp Pro 130 135
140Ser Gly Ala Thr Thr Lys Ser Ala Met Leu Thr Asn Leu Ile Ile
Phe145 150 155 160Gly Pro
Gly Pro Val Leu Asn Lys Asn Glu Val Arg Gly Ile Val Leu
165 170 175Arg Val Asp Asn Lys Asn Tyr
Phe Pro Cys Arg Asp Gly Phe Gly Ser 180 185
190Ile Met Gln Met Ala Phe Cys Pro Glu Tyr Val Pro Thr Phe
Asp Asn 195 200 205Val Ile Glu Asn
Ile Thr Ser Leu Thr Ile Gly Lys Ser Lys Tyr Phe 210
215 220Gln Asp Pro Ala Leu Leu Leu Met His Glu Leu Ile
His Val Leu His225 230 235
240Gly Leu Tyr Gly Met Gln Val Ser Ser His Glu Ile Ile Pro Ser Lys
245 250 255Gln Glu Ile Tyr Met
Gln His Thr Tyr Pro Ile Ser Ala Glu Glu Leu 260
265 270Phe Thr Phe Gly Gly Gln Asp Ala Asn Leu Ile Ser
Ile Asp Ile Lys 275 280 285Asn Asp
Leu Tyr Glu Lys Thr Leu Asn Asp Tyr Lys Ala Ile Ala Asn 290
295 300Lys Leu Ser Gln Val Thr Ser Cys Asn Asp Pro
Asn Ile Asp Ile Asp305 310 315
320Ser Tyr Lys Gln Ile Tyr Gln Gln Lys Tyr Gln Phe Asp Lys Asp Ser
325 330 335Asn Gly Gln Tyr
Ile Val Asn Glu Asp Lys Phe Gln Ile Leu Tyr Asn 340
345 350Ser Ile Met Tyr Gly Phe Thr Glu Ile Glu Leu
Gly Lys Lys Phe Asn 355 360 365Ile
Lys Thr Arg Leu Ser Tyr Phe Ser Met Asn His Asp Pro Val Lys 370
375 380Ile Pro Asn Leu Leu Asp Asp Thr Ile Tyr
Asn Asp Thr Glu Gly Phe385 390 395
400Asn Ile Glu Ser Lys Asp Leu Lys Ser Glu Tyr Lys Gly Gln Asn
Met 405 410 415Arg Val Asn
Thr Asn Ala Phe Arg Asn Val Asp Gly Ser Gly Leu Val 420
425 430Ser Lys Leu Ile Gly Leu Cys Lys Lys Ile
Ile Pro Pro Thr Asn Ile 435 440
445Arg Glu Asn Leu Tyr Asn Arg Thr Ala Ser Leu Thr Asp Leu Gly Gly 450
455 460Glu Leu Cys Ile Lys Ile Lys Asn
Glu Asp Leu Thr Phe Ile Ala Glu465 470
475 480Lys Asn Ser Phe Ser Glu Glu Pro Phe Gln Asp Glu
Ile Val Ser Tyr 485 490
495Asn Thr Lys Asn Lys Pro Leu Asn Phe Asn Tyr Ser Leu Asp Lys Ile
500 505 510Ile Val Asp Tyr Asn Leu
Gln Ser Lys Ile Thr Leu Pro Asn Asp Arg 515 520
525Thr Thr Pro Val Thr Lys Gly Ile Pro Tyr Ala Pro Glu Tyr
Lys Ser 530 535 540Asn Ala Ala Ser Thr
Ile Glu Ile His Asn Ile Asp Asp Asn Thr Ile545 550
555 560Tyr Gln Tyr Leu Tyr Ala Gln Lys Ser Pro
Thr Thr Leu Gln Arg Ile 565 570
575Thr Met Thr Asn Ser Val Asp Asp Ala Leu Ile Asn Ser Thr Lys Ile
580 585 590Tyr Ser Tyr Phe Pro
Ser Val Ile Ser Lys Val Asn Gln Gly Ala Gln 595
600 605Gly Ile Leu Phe Leu Gln Trp Val Arg Asp Ile Ile
Asp Asp Phe Thr 610 615 620Asn Glu Ser
Ser Gln Lys Thr Thr Ile Asp Lys Ile Ser Asp Val Ser625
630 635 640Thr Ile Val Pro Tyr Ile Gly
Pro Ala Leu Asn Ile Val Lys Gln Gly 645
650 655Tyr Glu Gly Asn Phe Ile Gly Ala Leu Glu Thr Thr
Gly Val Val Leu 660 665 670Leu
Leu Glu Tyr Ile Pro Glu Ile Thr Leu Pro Val Ile Ala Ala Leu 675
680 685Ser Ile Ala Glu Ser Ser Thr Gln Lys
Glu Lys Ile Ile Lys Thr Ile 690 695
700Asp Asn Phe Leu Glu Lys Arg Tyr Glu Lys Trp Ile Glu Val Tyr Lys705
710 715 720Leu Val Lys Ala
Lys Trp Leu Gly Thr Val Asn Thr Gln Phe Gln Lys 725
730 735Arg Ser Tyr Gln Met Tyr Arg Ser Leu Glu
Tyr Gln Val Asp Ala Ile 740 745
750Lys Lys Ile Ile Asp Tyr Glu Tyr Lys Ile Tyr Ser Gly Pro Asp Lys
755 760 765Glu Gln Ile Ala Asp Glu Ile
Asn Asn Leu Lys Asn Lys Leu Glu Glu 770 775
780Lys Ala Asn Lys Ala Met Ile Asn Ile Asn Ile Phe Met Arg Glu
Ser785 790 795 800Ser Arg
Ser Phe Leu Val Asn Gln Met Ile Asn Glu Ala Lys Lys Gln
805 810 815Leu Leu Glu Phe Asp Thr Gln
Ser Lys Asn Ile Leu Met Gln Tyr Ile 820 825
830Lys Ala Asn Ser Lys Phe Ile Gly Ile Thr Glu Leu Lys Lys
Leu Glu 835 840 845Ser Lys Ile Asn
Lys Val Phe Ser Thr Pro Ile Pro Phe Ser Tyr Ser 850
855 860Lys Asn Leu Asp Cys Trp Val Asp Asn Glu Glu Asp
Ile Asp Val Ile865 870 875
880Leu Lys Lys Ser Thr Ile Leu Asn Leu Asp Ile Asn Asn Asp Ile Ile
885 890 895Ser Asp Ile Ser Gly
Phe Asn Ser Ser Val Ile Thr Tyr Pro Asp Ala 900
905 910Gln Leu Val Pro Gly Ile Asn Gly Lys Ala Ile His
Leu Val Asn Asn 915 920 925Glu Ser
Ser Glu Val Ile Val His Lys Ala Met Asp Ile Glu Tyr Asn 930
935 940Asp Met Phe Asn Asn Phe Thr Val Ser Phe Trp
Leu Arg Val Pro Lys945 950 955
960Val Ser Ala Ser His Leu Glu Gln Tyr Gly Thr Asn Glu Tyr Ser Ile
965 970 975Ile Ser Ser Met
Lys Lys His Ser Leu Ser Ile Gly Ser Gly Trp Ser 980
985 990Val Ser Leu Lys Gly Asn Asn Leu Ile Trp Thr
Leu Lys Asp Ser Ala 995 1000
1005Gly Glu Val Arg Gln Ile Thr Phe Arg Asp Leu Pro Asp Lys Phe Asn
1010 1015 1020Ala Tyr Leu Ala Asn Lys Trp
Val Phe Ile Thr Ile Thr Asn Asp Arg1025 1030
1035 1040Leu Ser Ser Ala Asn Leu Tyr Ile Asn Gly Val Leu
Met Gly Ser Ala 1045 1050
1055Glu Ile Thr Gly Leu Gly Ala Ile Arg Glu Asp Asn Asn Ile Thr Leu
1060 1065 1070Lys Leu Asp Arg Cys Asn
Asn Asn Asn Gln Tyr Val Ser Ile Asp Lys 1075 1080
1085Phe Arg Ile Phe Cys Lys Ala Leu Asn Pro Lys Glu Ile Glu
Lys Leu 1090 1095 1100Tyr Thr Ser Tyr
Leu Ser Ile Thr Phe Leu Arg Asp Phe Trp Gly Asn1105 1110
1115 1120Pro Leu Arg Tyr Asp Thr Glu Tyr Tyr
Leu Ile Pro Val Ala Ser Ser 1125 1130
1135Ser Lys Asp Val Gln Leu Lys Asn Ile Thr Asp Tyr Met Tyr Leu
Thr 1140 1145 1150Asn Ala Pro
Ser Tyr Thr Asn Gly Lys Leu Asn Ile Tyr Tyr Arg Arg 1155
1160 1165Leu Tyr Asn Gly Leu Lys Phe Ile Ile Lys Arg
Tyr Thr Pro Asn Asn 1170 1175 1180Glu
Ile Asp Ser Phe Val Lys Ser Gly Asp Phe Ile Lys Leu Tyr Val1185
1190 1195 1200Ser Tyr Asn Asn Asn Glu
His Ile Val Gly Tyr Pro Lys Asp Gly Asn 1205
1210 1215Ala Phe Asn Asn Leu Asp Arg Ile Leu Arg Val Gly
Tyr Asn Ala Pro 1220 1225
1230Gly Ile Pro Leu Tyr Lys Lys Met Glu Ala Val Lys Leu Arg Asp Leu
1235 1240 1245Lys Thr Tyr Ser Val Gln Leu
Lys Leu Tyr Asp Asp Lys Asn Ala Ser 1250 1255
1260Leu Gly Leu Val Gly Thr His Asn Gly Gln Ile Gly Asn Asp Pro
Asn1265 1270 1275 1280Arg
Asp Ile Leu Ile Ala Ser Asn Trp Tyr Phe Asn His Leu Lys Asp
1285 1290 1295Lys Ile Leu Gly Cys Asp Trp
Tyr Phe Val Pro Thr Asp Glu Gly Trp 1300 1305
1310Thr Asn Asp 13159293PRTClostridium botulinum
serotype A 9Met Glu His Tyr Ser Val Ile Gln Asn Ser Leu Asn Asp Lys Ile
Val1 5 10 15Thr Ile Ser
Cys Lys Ala Asp Thr Asn Leu Phe Phe Tyr Gln Val Ala 20
25 30Gly Asn Val Ser Leu Phe Gln Gln Thr Arg
Asn Tyr Leu Glu Arg Trp 35 40
45Arg Leu Ile Tyr Asp Ser Asn Lys Ala Ala Tyr Lys Ile Lys Ser Met 50
55 60Asp Ile His Asn Thr Asn Leu Val Leu
Thr Trp Asn Ala Pro Thr His65 70 75
80Asn Ile Ser Thr Gln Gln Asp Ser Asn Ala Asp Asn Gln Tyr
Trp Leu 85 90 95Leu Leu
Lys Asp Ile Gly Asn Asn Ser Phe Ile Ile Ala Ser Tyr Lys 100
105 110Asn Pro Asn Leu Val Leu Tyr Ala Asp
Thr Val Ala Arg Asn Leu Lys 115 120
125Leu Ser Thr Leu Asn Asn Ser Asn Tyr Ile Lys Phe Ile Ile Glu Asp
130 135 140Tyr Ile Ile Ser Asp Leu Asn
Asn Phe Thr Cys Lys Ile Ser Pro Ile145 150
155 160Leu Asp Leu Asn Lys Val Val Gln Gln Val Asp Val
Thr Asn Leu Asn 165 170
175Val Asn Leu Tyr Thr Trp Asp Tyr Gly Arg Asn Gln Lys Trp Thr Ile
180 185 190Arg Tyr Asn Glu Glu Lys
Ala Ala Tyr Gln Phe Phe Asn Thr Ile Leu 195 200
205Ser Asn Gly Val Leu Thr Trp Ile Phe Ser Asn Gly Asn Thr
Val Arg 210 215 220Val Ser Ser Ser Asn
Asp Gln Asn Asn Asp Ala Gln Tyr Trp Leu Ile225 230
235 240Asn Pro Val Ser Asp Thr Asp Glu Thr Tyr
Thr Ile Thr Asn Leu Arg 245 250
255Asp Thr Thr Lys Ala Leu Asp Leu Tyr Gly Gly Gln Thr Ala Asn Gly
260 265 270Thr Ala Ile Gln Val
Phe Asn Tyr His Gly Asp Asp Asn Gln Lys Trp 275
280 285Asn Ile Arg Asn Pro 29010293PRTClostridium
botulinum serotype A 10Met Glu His Tyr Ser Val Ile Gln Asn Ser Leu Asn
Asp Lys Ile Val1 5 10
15Thr Ile Ser Cys Lys Ala Asp Thr Asn Leu Phe Phe Tyr Gln Val Ala
20 25 30Gly Asn Val Ser Leu Phe Gln
Gln Thr Arg Asn Tyr Leu Glu Arg Trp 35 40
45Arg Leu Ile Tyr Asp Ser Asn Lys Ala Ala Tyr Lys Ile Lys Ser
Met 50 55 60Asp Ile His Asn Thr Asn
Leu Val Leu Thr Trp Asn Ala Pro Thr His65 70
75 80Asn Ile Ser Thr Gln Gln Asp Ser Asn Ala Asp
Asn Gln Tyr Trp Leu 85 90
95Leu Leu Lys Asp Ile Gly Asn Asn Ser Phe Ile Ile Ala Ser Tyr Lys
100 105 110Asn Pro Asn Leu Val Leu
Tyr Ala Asp Thr Val Ala Arg Asn Leu Lys 115 120
125Leu Ser Thr Leu Asn Asn Ser Asn Tyr Ile Lys Phe Ile Ile
Glu Asp 130 135 140Tyr Ile Ile Ser Asp
Leu Asn Asn Phe Thr Cys Lys Ile Ser Pro Ile145 150
155 160Leu Asp Arg Asn Lys Val Val Gln Gln Val
Asp Met Thr Asn Leu Asn 165 170
175Val Asn Leu Tyr Thr Trp Asp Tyr Gly Arg Asn Gln Lys Trp Thr Ile
180 185 190Arg Tyr Asn Glu Glu
Lys Ala Ala Tyr Gln Phe Phe Asn Thr Ile Leu 195
200 205Ser Asn Gly Val Leu Thr Trp Ile Phe Ser Asn Gly
Asn Thr Val Arg 210 215 220Val Ser Ser
Ser Asn Asp Gln Asn Asn Asp Ala Gln Tyr Trp Leu Ile225
230 235 240Asn Pro Val Ser Asp Thr Asp
Glu Thr Tyr Thr Ile Thr Asn Leu Arg 245
250 255Asp Thr Thr Lys Ala Leu Asp Leu Tyr Asn Ser Gln
Thr Ala Asn Gly 260 265 270Thr
Ala Ile Gln Val Phe Asn Tyr His Gly Asp Asp Asn Gln Lys Trp 275
280 285Asn Ile Arg Asn Pro
29011293PRTClostridium botulinum serotype A 11Met Glu His Tyr Ser Val Ile
Gln Asn Ser Leu Asn Asp Lys Ile Val1 5 10
15Thr Ile Ser Cys Arg Ala Asp Thr Asn Leu Phe Phe Tyr
Gln Val Ala 20 25 30Gly Asn
Val Ser Leu Phe Gln Gln Thr Arg Asn Tyr Leu Glu Arg Trp 35
40 45Arg Ile Ile Tyr Asp Ser Asn Lys Ala Ala
Tyr Lys Ile Lys Ser Met 50 55 60Asp
Ile His Asn Thr Asn Leu Val Leu Thr Trp Asn Ala Pro Thr His65
70 75 80Asn Ile Ser Thr Gln Gln
Asp Ser Asn Ala Asp Asn Gln Tyr Trp Leu 85
90 95Leu Leu Lys Asp Ile Gly Asn Asn Ser Phe Ile Ile
Ala Ser Tyr Lys 100 105 110Asn
Pro Asn Leu Val Leu Tyr Ala Asp Thr Val Ala Arg Asn Leu Lys 115
120 125Leu Ser Thr Leu Asn Asn Ser Asn Tyr
Ile Lys Phe Ile Ile Glu Asp 130 135
140Tyr Ile Ile Ser Asp Phe Asn Asn Phe Thr Cys Lys Ile Ser Pro Ile145
150 155 160Leu Asp Arg Asn
Lys Val Val Gln Gln Val Ala Thr Thr Asn Leu Asn 165
170 175Val Asn Leu Tyr Thr Trp Asp Tyr Gly Arg
Asn Gln Lys Trp Thr Ile 180 185
190Arg Tyr Asn Glu Glu Lys Ala Ala Tyr Gln Phe Phe Asn Thr Ile Leu
195 200 205Ser Asn Gly Val Leu Thr Trp
Ile Phe Ser Asn Gly Asn Thr Val Arg 210 215
220Val Ser Ser Ser Asn Asp Gln Asn Asn Asp Ala Gln Tyr Trp Leu
Ile225 230 235 240Asn Pro
Val Ser Asp Thr Asp Glu Thr Tyr Thr Ile Thr Asn Leu Arg
245 250 255Asp Thr Thr Lys Ala Leu Asp
Leu Tyr Asn Ser Gln Thr Ala Asn Gly 260 265
270Thr Ala Ile Gln Val Phe Asn Ser Asn Gly Gly Asp Asn Gln
Lys Trp 275 280 285Asn Ile Arg Asn
Pro 29012294PRTClostridium botulinum serotype A 12Met Glu His Tyr Ser
Thr Ile Gln Asn Ser Leu Asn Asp Lys Ile Val1 5
10 15Thr Ile Ser Cys Lys Ala Asn Thr Asp Leu Phe
Phe Tyr Gln Val Pro 20 25
30Gly Asn Gly Asn Val Ser Leu Phe Gln Gln Thr Arg Asn Tyr Leu Glu
35 40 45Arg Trp Arg Ile Ile Tyr Asp Ser
Asn Lys Ala Ala Tyr Lys Ile Lys 50 55
60Ser Met Asn Ile Tyr Asn Thr Asn Leu Val Leu Thr Trp Asn Ala Pro65
70 75 80Thr His Asn Ile Ser
Ala Gln Gln Asp Ser Asn Ala Asp Asn Gln Tyr 85
90 95Trp Leu Leu Leu Lys Asp Ile Gly Asn Asn Ser
Phe Ile Ile Ala Ser 100 105
110Tyr Lys Asn Pro Asn Leu Val Leu Tyr Ala Asp Thr Val Ala Arg Asn
115 120 125Leu Lys Leu Ser Thr Leu Asn
Asn Ser Ser Tyr Ile Lys Phe Ile Ile 130 135
140Glu Asp Tyr Val Ile Ser Asp Phe Lys Asn Phe Thr Cys Arg Ile
Ser145 150 155 160Pro Ile
Leu Ala Gly Gly Lys Val Val Gln Gln Val Ser Met Thr Asn
165 170 175Leu Ala Val Asn Leu Tyr Ile
Trp Asn Asn Asp Leu Asn Gln Lys Trp 180 185
190Thr Ile Ile Tyr Asn Glu Glu Lys Ala Ala Tyr Gln Phe Phe
Asn Lys 195 200 205Ile Leu Ser Asn
Gly Val Leu Thr Trp Ile Phe Ser Asp Gly Asn Thr 210
215 220Val Arg Val Ser Ser Ser Ala Gln Asn Asn Asp Ala
Gln Tyr Trp Leu225 230 235
240Ile Asn Pro Val Ser Asp Asn Tyr Asp Arg Tyr Thr Ile Thr Asn Leu
245 250 255Arg Asp Lys Thr Lys
Val Leu Asp Leu Tyr Gly Gly Gln Thr Ala Asp 260
265 270Gly Thr Thr Ile Gln Val Phe Asn Ser Asn Gly Gly
Asp Asn Gln Ile 275 280 285Trp Thr
Met Ser Asn Pro 29013279PRTClostridium botulinum serotype A 13Met Glu
His Tyr Ser Val Ile Gln Asn Ser Leu Asn Asp Lys Ile Val1 5
10 15Thr Ile Ser Cys Lys Ala Asp Thr
Asn Leu Phe Phe Tyr Gln Val Ala 20 25
30Gly Asn Val Ser Leu Phe Gln Gln Thr Arg Asn Tyr Leu Glu Arg
Trp 35 40 45Arg Leu Ile Tyr Asp
Ser Asn Lys Ala Ala Tyr Lys Ile Lys Ser Met 50 55
60Asp Ile His Asn Thr Asn Leu Val Leu Thr Trp Asn Ala Pro
Thr His65 70 75 80Asn
Ile Ser Thr Gln Gln Asp Ser Asn Ala Asp Asn Gln Tyr Trp Leu
85 90 95Leu Leu Lys Asp Ile Gly Asn
Asn Ser Phe Ile Ile Ala Ser Tyr Lys 100 105
110Asn Pro Asn Leu Val Leu Tyr Ala Asp Thr Val Ala Arg Asn
Leu Lys 115 120 125Leu Ser Thr Leu
Asn Asn Ser Asn Tyr Ile Lys Phe Ile Ile Glu Asp 130
135 140Tyr Ile Ile Ser Asp Leu Asn Asn Phe Thr Cys Lys
Ile Ser Pro Ile145 150 155
160Leu Asp Arg Asn Lys Val Val Gln Gln Val Asp Met Thr Asn Leu Asn
165 170 175Val Asn Leu Tyr Thr
Trp Asp Tyr Gly Arg Asn Gln Lys Trp Thr Ile 180
185 190Arg Tyr Asn Glu Glu Lys Ala Ala Tyr Gln Phe Phe
Asn Thr Ile Leu 195 200 205Ser Asn
Gly Val Leu Thr Trp Ile Phe Ser Asn Gly Asn Thr Val Arg 210
215 220Val Ser Ser Ser Asn Asp Gln Asn Asn Asp Ala
Gln Tyr Trp Leu Ile225 230 235
240Asn Pro Val Ser Asp Thr Asp Glu Thr Tyr Thr Ile Thr Asn Leu Arg
245 250 255Asp Thr Thr Lys
Ala Leu Asp Leu Tyr Asn Ser Gln Thr Ala Asn Gly 260
265 270Thr Ala Ile Gln Val Phe Asn
27514292PRTClostridium botulinum serotype B 14Met Glu His Tyr Ser Val Ile
Gln Asn Ser Leu Asn Asp Glu Ile Val1 5 10
15Thr Ile Ser Cys Lys Ala Asp Thr Asn Leu Phe Phe Tyr
Gln Thr Val 20 25 30Gly Asn
Val Ser Leu Phe Gln Gln Thr Arg Asn Tyr Leu Glu Arg Trp 35
40 45Arg Leu Ile Tyr Asp Ala Asn Lys Ala Ala
Tyr Lys Ile Lys Ser Met 50 55 60Asp
Ser His Asn Thr Asn Leu Val Leu Thr Trp Asn Ala Pro Thr His65
70 75 80Asn Ile Ser Ala Gln Gln
Asp Ser Asn Ala Asp Asn Gln Tyr Trp Leu 85
90 95Leu Leu Lys Asp Ile Gly Ser Asn Ser Phe Ile Ile
Ala Ser Tyr Lys 100 105 110Asn
Pro Asn Leu Val Leu Tyr Ala Asp Thr Val Ala Arg Asn Leu Lys 115
120 125Leu Ser Thr Leu Asn Asn Ser Ser Tyr
Ile Lys Phe Ile Ile Glu Asp 130 135
140Tyr Met Ile Ser Asp Phe Asn Asn Phe Thr Cys Lys Ile Ser Pro Ile145
150 155 160Leu Asp Ser Ser
Lys Val Val Gln Gln Val Ala Met Thr Asp Leu Ser 165
170 175Val Asn Leu Tyr Thr Trp Asp Tyr Gly Arg
Asn Gln Lys Trp Thr Ile 180 185
190Lys Tyr Asn Lys Glu Lys Ser Ala Tyr Gln Phe Phe Asn Thr Ile Leu
195 200 205Ser Asn Gly Val Leu Thr Trp
Ile Ser Ser Asn Gly Asn Thr Val Arg 210 215
220Val Ser Ser Ile Ala Gln Asn Asn Asp Ala Gln Tyr Trp Leu Ile
Asn225 230 235 240Pro Val
Ser Asn Ala Tyr Glu Thr Tyr Thr Ile Thr Asn Leu His Asp
245 250 255Thr Thr Lys Ala Leu Asp Leu
Tyr Asn Ser Gln Thr Ala Asn Gly Thr 260 265
270Thr Ile Gln Val Phe Asn Tyr His Gly Asp Asp Asn Gln Lys
Trp Phe 275 280 285Ile Arg Asn Pro
29015291PRTClostridium botulinum serotype B 15Met Glu His Tyr Ser Thr
Ile Gln Asn Ser Leu Asn Asp Lys Ile Val1 5
10 15Thr Ile Ser Cys Lys Ala Asn Thr Asp Leu Phe Phe
Tyr Gln Val Pro 20 25 30Gly
Asn Gly Asn Val Ser Leu Phe Gln Gln Thr Arg Asn Tyr Leu Glu 35
40 45Arg Trp Arg Ile Ile Tyr Asp Ser Asn
Lys Ala Ala Tyr Lys Ile Lys 50 55
60Ser Met Asn Ile Tyr Asn Thr Asn Leu Val Leu Thr Trp Asn Ala Pro65
70 75 80Thr His Asn Ile Ser
Ala Leu Gln Asp Ser Asn Ala Asp Asn Gln Tyr 85
90 95Trp Leu Leu Leu Lys Asp Ile Gly Asn Asn Ser
Phe Ile Ile Ala Ser 100 105
110Tyr Lys Asn Pro Asn Leu Val Leu Tyr Ala Asp Thr Val Ala Arg Asn
115 120 125Leu Lys Leu Ser Thr Leu Asn
Asn Ser Ser Tyr Ile Lys Phe Ile Ile 130 135
140Glu Asp Tyr Val Ile Ser Asp Phe Lys Asn Phe Thr Cys Arg Ile
Ser145 150 155 160Pro Ile
Leu Ala Gly Gly Lys Val Val Gln Gln Val Ser Met Thr Asn
165 170 175Leu Ala Val Asn Leu Tyr Ile
Trp Asn Asn Asp Leu Asn Gln Lys Trp 180 185
190Thr Ile Ile Tyr Asn Glu Glu Lys Ala Ala Tyr Gln Phe Phe
Asn Lys 195 200 205Ile Leu Ser Asn
Gly Val Leu Thr Trp Ile Phe Ser Asp Gly Asn Thr 210
215 220Val Arg Val Ser Ser Ser Ala Gln Asn Asp Ala Gln
Tyr Trp Leu Ile225 230 235
240Asn Pro Val Ser Asp Asn Tyr Asp Arg Tyr Thr Ile Thr Asn Leu Arg
245 250 255Tyr Lys Thr Lys Val
Leu Asp Leu Tyr Gly Gly Gln Thr Ala Asp Gly 260
265 270Thr Thr Ile Gln Val Phe Asn Ser Asn Gly Gly Asp
Asn Gln Ile Trp 275 280 285Tyr Gly
Leu 29016286PRTClostridium botulinum serotype C1 16Met Ser Gln Thr Asn
Ala Asn Asp Leu Arg Asn Asn Glu Val Phe Phe1 5
10 15Ile Ser Pro Ser Asn Asn Thr Asn Lys Val Leu
Asp Lys Ile Ser Gln 20 25
30Ser Glu Val Lys Leu Trp Asn Lys Leu Ser Gly Ala Asn Gln Lys Trp
35 40 45Arg Leu Ile Tyr Asp Thr Asn Lys
Gln Ala Tyr Lys Ile Lys Val Met 50 55
60Asp Asn Thr Ser Leu Ile Leu Thr Trp Asn Ala Pro Leu Ser Ser Val65
70 75 80Ser Val Lys Thr Asp
Thr Asn Gly Asp Asn Gln Tyr Trp Tyr Leu Leu 85
90 95Gln Asn Tyr Ile Ser Arg Asn Val Ile Ile Arg
Asn Tyr Met Asn Pro 100 105
110Asn Leu Val Leu Gln Tyr Asn Ile Asp Asp Thr Leu Met Val Ser Thr
115 120 125Gln Thr Ser Ser Ser Asn Gln
Phe Phe Lys Phe Ser Asn Cys Ile Tyr 130 135
140Glu Ala Leu Asn Asn Arg Asn Cys Lys Leu Gln Thr Gln Leu Asn
Ser145 150 155 160Asp Arg
Phe Leu Ser Lys Asn Leu Asn Ser Gln Ile Ile Val Leu Trp
165 170 175Gln Trp Phe Asp Ser Ser Arg
Gln Lys Trp Ile Ile Glu Tyr Asn Glu 180 185
190Thr Lys Ser Ala Tyr Thr Leu Lys Cys Gln Glu Asn Asn Arg
Tyr Leu 195 200 205Thr Trp Ile Gln
Asn Ser Asn Asn Tyr Val Glu Thr Tyr Gln Ser Thr 210
215 220Asp Ser Leu Ile Gln Tyr Trp Asn Ile Asn Tyr Leu
Asp Asn Asp Ala225 230 235
240Ser Lys Tyr Ile Leu Tyr Asn Leu Gln Asp Thr Asn Arg Val Leu Asp
245 250 255Val Tyr Asn Ser Gln
Ile Ala Asn Gly Thr His Val Ile Val Asp Ser 260
265 270Tyr His Gly Asn Thr Asn Gln Gln Trp Ile Ile Asn
Leu Ile 275 280
28517285PRTClostridium botulinum serotype C1 17Met Ser Gln Thr Asn Ala
Asn Asp Leu Arg Asn Asn Glu Val Phe Phe1 5
10 15Ile Ser Pro Ser Asn Asn Thr Asn Lys Val Leu Asp
Lys Ile Ser Gln 20 25 30Ser
Glu Val Lys Leu Trp Asn Lys Leu Ser Gly Ala Asn Gln Lys Trp 35
40 45Arg Leu Ile Tyr Asp Thr Asn Lys Gln
Ala Tyr Lys Ile Lys Val Met 50 55
60Asp Asn Thr Ser Leu Ile Leu Thr Trp Asn Ala Pro Leu Ser Ser Val65
70 75 80Ser Val Lys Thr Asp
Thr Asn Gly Asp Asn Gln Tyr Trp Tyr Leu Leu 85
90 95Gln Asn Tyr Ile Ser Arg Asn Val Ile Ile Arg
Asn Tyr Met Asn Pro 100 105
110Asn Leu Val Leu Gln Tyr Asn Ile Asp Asp Thr Leu Met Val Ser Thr
115 120 125Gln Thr Ser Ser Ser Asn Gln
Phe Phe Lys Phe Ser Asn Cys Ile Tyr 130 135
140Glu Ser Phe Asn Asn Ser Thr Cys Lys Ile Gln Thr Ser Leu Thr
Ile145 150 155 160Lys Phe
Ile Asp Lys Asn Gln Asn Ser Asn Asn Val Thr Ile Trp Ser
165 170 175Trp Asn Asn Gly Asp Asn Gln
Lys Trp Lys Ile Leu Tyr Asn Glu Ser 180 185
190Lys Met Ala Tyr Thr Leu Thr Cys Ile Lys Asn Asn Glu Tyr
Leu Thr 195 200 205Trp Phe Ser Ser
Ile Gly Asn Asn Val Gly Thr Tyr Arg Thr Glu Gly 210
215 220Asn Asn Asp Gln Tyr Trp Phe Ile Asn Tyr Leu Asn
Asn Asp Ala Ser225 230 235
240Met Tyr Thr Ile Ser Asn Phe Ser Asn Gln Ser Lys Phe Leu Asp Val
245 250 255Val Asn Ser Gly Leu
Ala Asp Gly Thr Asn Val Gln Val Trp Asp Ser 260
265 270Asn Gly Thr Ser Ala Gln Lys Trp Ile Ile Thr Arg
Leu 275 280 28518286PRTClostridium
botulinum serotype D 18Met Ser Gln Thr Asn Ala Asn Asp Leu Arg Asn Asn
Glu Val Phe Phe1 5 10
15Ile Ser Pro Ser Asn Asn Thr Asn Lys Val Leu Asp Lys Ile Ser Gln
20 25 30Ser Glu Val Lys Leu Trp Asn
Lys Leu Ser Gly Ala Asn Gln Lys Trp 35 40
45Arg Leu Ile Tyr Asp Thr Asn Lys Gln Ala Tyr Thr Ile Lys Val
Met 50 55 60Asp Asn Thr Ser Leu Ile
Leu Thr Trp Asp Ala Pro Leu Ser Ser Val65 70
75 80Ser Val Lys Thr Asp Thr Asn Thr Asn Asn Gln
Tyr Trp Tyr Leu Leu 85 90
95Gln Asp Tyr Ile Ser Arg Asn Val Ile Leu Arg Asn Tyr Met Asn Pro
100 105 110Asn Leu Val Leu Gln Tyr
Asn Thr Asp Asp Thr Leu Ile Val Ser Thr 115 120
125Gln Thr Asn Ser Asn Asn Gln Phe Phe Lys Phe Ser Asn Cys
Ile Tyr 130 135 140Glu Ala Leu Asn Asn
Arg Asn Cys Lys Leu Gln Thr Gln Leu Asn Ser145 150
155 160Asp Arg Phe Leu Ser Lys Asn Leu Asn Ser
Gln Ile Ile Val Leu Trp 165 170
175Gln Trp Phe Asp Ser Ser Arg Gln Lys Trp Thr Ile Glu Tyr Asn Glu
180 185 190Thr Lys Ser Ala Tyr
Thr Leu Lys Cys Gln Glu Asn Asn Arg Tyr Leu 195
200 205Thr Trp Ile Gln Asn Ser Asn Asn Tyr Val Glu Thr
Tyr Gln Ser Thr 210 215 220Asp Ser Leu
Ile Gln Tyr Trp Asn Ile Asn Tyr Leu Asp Asn Asp Ala225
230 235 240Ser Lys Tyr Ile Leu Tyr Asn
Leu Gln Asp Thr Asn Arg Val Leu Asp 245
250 255Val Tyr Asn Ser Gln Thr Ala Asn Gly Thr His Val
Ile Val Asp Ser 260 265 270Tyr
His Gly Asn Thr Asn Gln Gln Trp Ile Ile Asn Leu Ile 275
280 28519146PRTClostridium botulinum serotype A
19Met Ser Val Glu Arg Thr Phe Leu Pro Asn Gly Asn Tyr Asn Ile Lys1
5 10 15Ser Ile Phe Ser Gly Ser
Leu Tyr Leu Asn Pro Val Ser Lys Ser Leu 20 25
30Thr Phe Ser Asn Glu Ser Ser Ala Asn Asn Gln Lys Trp
Asn Val Glu 35 40 45Tyr Met Ala
Glu Asn Arg Cys Phe Lys Ile Ser Asn Val Ala Glu Pro 50
55 60Asn Lys Tyr Leu Ser Tyr Asp Asn Phe Gly Phe Ile
Ser Leu Asp Ser65 70 75
80Leu Ser Asn Arg Cys Tyr Trp Phe Pro Ile Lys Ile Ala Val Asn Thr
85 90 95Tyr Ile Met Leu Ser Leu
Asn Lys Val Asn Glu Leu Asp Tyr Ala Trp 100
105 110Asp Ile Tyr Asp Thr Asn Glu Asn Ile Leu Ser Gln
Pro Leu Leu Leu 115 120 125Leu Pro
Asn Phe Asp Ile Tyr Asn Ser Asn Gln Met Phe Lys Leu Glu 130
135 140Lys Ile14520146PRTClostridium botulinum
serotype B 20Met Ser Ala Glu Arg Thr Phe Leu Pro Asn Gly Asn Tyr Asn Ile
Lys1 5 10 15Ser Ile Phe
Ser Gly Ser Leu Tyr Leu Ser Pro Val Ser Gly Ser Leu 20
25 30Thr Phe Ser Asn Glu Ser Ser Ala Asn Asn
Gln Lys Trp Asn Val Glu 35 40
45Tyr Met Ala Glu Asn Arg Cys Phe Lys Ile Ser Asn Val Ala Glu Pro 50
55 60Asn Lys Tyr Leu Ser Tyr Asp Asn Phe
Gly Phe Ile Ser Leu Asp Ser65 70 75
80Leu Ser Asn Arg Cys Tyr Trp Phe Pro Ile Lys Ile Ala Val
Asn Thr 85 90 95Tyr Ile
Met Leu Ser Leu Asn Lys Val Asn Glu Leu Asp Tyr Ala Trp 100
105 110Asp Ile Tyr Asp Thr Asn Glu Asn Ile
Leu Ser Gln Pro Leu Leu Leu 115 120
125Leu Pro Asn Phe Asp Ile Tyr Asn Ser Asn Gln Met Phe Lys Leu Glu
130 135 140Lys Ile14521146PRTClostridium
botulinum serotype C1 21Met Ser Ser Glu Arg Thr Phe Leu Pro Asn Gly Asn
Tyr Lys Ile Lys1 5 10
15Ser Leu Phe Ser Asn Ser Leu Tyr Leu Thr Tyr Ser Ser Gly Ala Leu
20 25 30Ser Phe Ser Asn Thr Ser Ser
Leu Asp Asn Gln Lys Trp Lys Leu Glu 35 40
45Tyr Ile Ser Ser Ser Asn Gly Phe Arg Phe Ser Asn Val Ala Glu
Pro 50 55 60Asn Lys Tyr Leu Ala Tyr
Asn Asp Tyr Gly Phe Ile Tyr Leu Ser Ser65 70
75 80Ser Ser Asn Asn Ser Leu Trp Asn Pro Ile Lys
Ile Ala Ile Asn Ser 85 90
95Tyr Ile Ile Cys Thr Leu Ser Ile Val Asn Val Thr Asp Tyr Ala Trp
100 105 110Thr Ile Tyr Asp Asn Asn
Asn Asn Ile Thr Asp Gln Pro Ile Leu Asn 115 120
125Leu Pro Asn Phe Asp Ile Asn Asn Ser Asn Gln Ile Leu Lys
Leu Glu 130 135 140Lys
Leu14522146PRTClostridium botulinum serotype D 22Met Ser Ser Glu Arg Thr
Phe Leu Pro Asn Gly Asn Tyr Lys Ile Lys1 5
10 15Ser Leu Phe Ser Asp Ser Leu Tyr Leu Thr Tyr Ser
Ser Gly Ser Leu 20 25 30Ser
Phe Leu Asn Thr Ser Ser Leu Asp Asn Gln Lys Trp Lys Leu Glu 35
40 45Tyr Ile Ser Ser Ser Asn Gly Phe Arg
Phe Ser Asn Val Ala Glu Pro 50 55
60Asn Lys Tyr Leu Ala Tyr Asn Asp Tyr Gly Phe Ile Tyr Leu Ser Ser65
70 75 80Ser Ser Asn Asn Ser
Leu Trp Asn Pro Ile Lys Ile Ala Ile Asn Ser 85
90 95Tyr Ile Ile Cys Thr Leu Ser Ile Val Asn Val
Thr Asp Tyr Ala Trp 100 105
110Thr Ile Tyr Asp Asn Asn Asn Asn Ile Thr Asp Gln Pro Ile Leu Asn
115 120 125Leu Pro Asn Phe Asp Ile Asn
Asn Ser Asn Gln Ile Leu Lys Leu Glu 130 135
140Lys Leu145231193PRTClostridium botulinum serotype A 23Met Asn Ile
Asn Asp Asn Leu Ser Ile Asn Ser Pro Val Asp Asn Lys1 5
10 15Asn Val Val Val Val Arg Ala Arg Lys
Thr Asp Thr Val Phe Lys Ala 20 25
30Phe Lys Val Ala Pro Asn Ile Trp Val Ala Pro Glu Arg Tyr Tyr Gly
35 40 45Glu Ser Leu Ser Ile Asp Glu
Glu Tyr Lys Val Asp Gly Gly Ile Tyr 50 55
60Asp Ser Asn Phe Leu Ser Gln Asp Ser Glu Lys Asp Lys Phe Leu Gln65
70 75 80Ala Ile Ile Thr
Leu Leu Lys Arg Ile Asn Ser Thr Asn Ala Gly Glu 85
90 95Lys Leu Leu Ser Leu Ile Ser Thr Ala Ile
Pro Phe Pro Tyr Gly Tyr 100 105
110Ile Gly Gly Gly Tyr Tyr Ala Pro Asn Met Ile Thr Phe Gly Ser Ala
115 120 125Pro Lys Ser Asn Lys Lys Leu
Asn Ser Leu Ile Ser Ser Thr Ile Pro 130 135
140Phe Pro Tyr Ala Gly Tyr Arg Glu Thr Asn Tyr Leu Ser Ser Glu
Asp145 150 155 160Asn Lys
Ser Phe Tyr Ala Ser Asn Ile Val Ile Phe Gly Pro Gly Ala
165 170 175Asn Ile Val Glu Asn Asn Thr
Val Phe Tyr Lys Lys Glu Asp Ala Glu 180 185
190Asn Gly Met Gly Thr Met Thr Glu Ile Trp Phe Gln Pro Phe
Leu Thr 195 200 205Tyr Lys Tyr Asp
Glu Phe Tyr Ile Asp Pro Ala Ile Glu Leu Ile Lys 210
215 220Cys Leu Ile Lys Ser Leu Tyr Phe Leu Tyr Gly Ile
Lys Pro Ser Asp225 230 235
240Asp Leu Val Ile Pro Tyr Arg Leu Arg Ser Glu Leu Glu Asn Ile Glu
245 250 255Tyr Ser Gln Leu Asn
Ile Val Asp Leu Leu Val Ser Gly Gly Ile Asp 260
265 270Pro Lys Phe Ile Asn Thr Asp Pro Tyr Trp Phe Thr
Asp Asn Tyr Phe 275 280 285Ser Asn
Ala Lys Lys Val Phe Glu Asp His Arg Asn Ile Tyr Glu Thr 290
295 300Glu Ile Glu Gly Asn Asn Ala Ile Gly Asn Asp
Ile Lys Leu Arg Leu305 310 315
320Lys Gln Lys Phe Arg Ile Asn Ile Asn Asp Ile Trp Glu Leu Asn Leu
325 330 335Asn Tyr Phe Ser
Lys Glu Phe Ser Ile Met Met Pro Asp Arg Phe Asn 340
345 350Asn Ala Leu Lys His Phe Tyr Arg Lys Gln Tyr
Tyr Lys Ile Asp Tyr 355 360 365Pro
Glu Asn Tyr Ser Ile Asn Gly Phe Val Asn Gly Gln Ile Asn Ala 370
375 380Gln Leu Ser Leu Ser Asp Arg Asn Gln Asp
Ile Ile Asn Lys Pro Glu385 390 395
400Glu Ile Ile Asn Leu Leu Asn Gly Asn Asn Val Ser Leu Met Arg
Ser 405 410 415Asn Ile Tyr
Gly Asp Gly Leu Lys Ser Thr Val Asp Asp Phe Tyr Ser 420
425 430Asn Tyr Lys Ile Pro Tyr Asn Arg Ala Tyr
Glu Tyr His Phe Asn Asn 435 440
445Ser Asn Asp Ser Ser Leu Asp Asn Val Asn Ile Gly Val Ile Asp Asn 450
455 460Ile Pro Glu Ile Ile Asp Val Asn
Pro Tyr Lys Glu Asn Cys Asp Lys465 470
475 480Phe Ser Pro Val Gln Lys Ile Thr Ser Thr Arg Glu
Ile Asn Thr Asn 485 490
495Ile Pro Trp Pro Ile Asn Tyr Leu Gln Ala Gln Asn Thr Asn Asn Glu
500 505 510Lys Phe Ser Leu Ser Ser
Asp Phe Val Glu Val Val Ser Ser Lys Asp 515 520
525Lys Ser Leu Val Tyr Ser Phe Leu Ser Asn Val Met Phe Tyr
Leu Asp 530 535 540Ser Ile Lys Asp Asn
Ser Pro Ile Asp Thr Asp Lys Lys Tyr Tyr Leu545 550
555 560Trp Leu Arg Glu Ile Phe Arg Asn Tyr Ser
Phe Asp Ile Thr Ala Thr 565 570
575Gln Glu Ile Asn Thr Asn Cys Gly Ile Asn Lys Val Val Thr Trp Phe
580 585 590Gly Lys Ala Leu Asn
Ile Leu Asn Thr Ser Asp Ser Phe Val Glu Glu 595
600 605Phe Gln Asn Leu Gly Ala Ile Ser Leu Ile Asn Lys
Lys Glu Asn Leu 610 615 620Ser Met Pro
Ile Ile Glu Ser Tyr Glu Ile Pro Asn Asp Met Leu Gly625
630 635 640Leu Pro Leu Asn Asp Leu Asn
Glu Lys Leu Phe Asn Ile Tyr Ser Lys 645
650 655Asn Thr Ala Tyr Phe Lys Lys Ile Tyr Tyr Asn Phe
Leu Asp Gln Trp 660 665 670Trp
Thr Gln Tyr Tyr Ser Gln Tyr Phe Asp Leu Ile Cys Met Ala Lys 675
680 685Arg Ser Val Leu Ala Gln Glu Thr Leu
Ile Lys Arg Ile Ile Gln Lys 690 695
700Lys Leu Ser Tyr Leu Ile Gly Asn Ser Asn Ile Ser Ser Asp Asn Leu705
710 715 720Ala Leu Met Asn
Leu Thr Thr Thr Asn Thr Leu Arg Asp Ile Ser Asn 725
730 735Glu Ser Gln Ile Ala Met Asn Asn Val Asp
Ser Phe Leu Asn Asn Ala 740 745
750Ala Ile Cys Val Phe Glu Ser Asn Ile Tyr Pro Lys Phe Ile Ser Phe
755 760 765Met Glu Gln Cys Ile Asn Asn
Ile Asn Ile Lys Thr Lys Glu Phe Ile 770 775
780Gln Lys Cys Thr Asn Ile Asn Glu Asp Glu Lys Leu Gln Leu Ile
Asn785 790 795 800Gln Asn
Val Phe Asn Ser Leu Asp Phe Glu Phe Leu Asn Ile Gln Asn
805 810 815Met Lys Ser Leu Phe Ser Ser
Glu Thr Ala Leu Leu Ile Lys Glu Glu 820 825
830Thr Trp Pro Tyr Glu Leu Val Leu Tyr Ala Phe Lys Glu Pro
Gly Asn 835 840 845Asn Val Ile Gly
Asp Ala Ser Gly Lys Asn Thr Ser Ile Glu Tyr Ser 850
855 860Lys Asp Ile Gly Leu Val Tyr Gly Ile Asn Ser Asp
Ala Leu Tyr Leu865 870 875
880Asn Gly Ser Asn Gln Ser Ile Ser Phe Ser Asn Asp Phe Phe Glu Asn
885 890 895Gly Leu Thr Asn Ser
Phe Ser Ile Tyr Phe Trp Leu Arg Asn Leu Gly 900
905 910Lys Asp Thr Ile Lys Ser Lys Leu Ile Gly Ser Lys
Glu Asp Asn Cys 915 920 925Gly Trp
Glu Ile Tyr Phe Gln Asp Thr Gly Leu Val Phe Asn Met Ile 930
935 940Asp Ser Asn Gly Asn Glu Lys Asn Ile Tyr Leu
Ser Asp Val Ser Asn945 950 955
960Asn Ser Trp His Tyr Ile Thr Ile Ser Val Asp Arg Leu Lys Glu Gln
965 970 975Leu Leu Ile Phe
Ile Asp Asp Asn Leu Val Ala Asn Glu Ser Ile Lys 980
985 990Glu Ile Leu Asn Ile Tyr Ser Ser Asn Ile Ile
Ser Leu Leu Ser Glu 995 1000
1005Asn Asn Pro Ser Tyr Ile Glu Gly Leu Thr Ile Leu Asn Lys Pro Thr
1010 1015 1020Thr Ser Gln Glu Val Leu Ser
Asn Tyr Phe Glu Val Leu Asn Asn Ser1025 1030
1035 1040Tyr Ile Arg Asp Ser Asn Glu Glu Arg Leu Glu Tyr
Asn Lys Thr Tyr 1045 1050
1055Gln Leu Tyr Asn Tyr Val Phe Ser Asp Lys Pro Ile Cys Glu Val Lys
1060 1065 1070Gln Asn Asn Asn Ile Tyr
Leu Thr Ile Asn Asn Thr Asn Asn Leu Asn 1075 1080
1085Leu Gln Ala Ser Lys Phe Lys Leu Leu Ser Ile Asn Pro Asn
Lys Gln 1090 1095 1100Tyr Val Gln Lys
Leu Asp Glu Val Ile Ile Ser Val Leu Asp Asn Met1105 1110
1115 1120Glu Lys Tyr Ile Asp Ile Ser Glu Asp
Asn Arg Leu Gln Leu Ile Asp 1125 1130
1135Asn Lys Asn Asn Ala Lys Lys Met Ile Ile Ser Asn Asp Ile Phe
Ile 1140 1145 1150Ser Asn Cys
Leu Thr Leu Ser Tyr Asn Gly Lys Tyr Ile Cys Leu Ser 1155
1160 1165Met Lys Asp Glu Asn His Asn Trp Met Ile Cys
Asn Asn Asp Met Ser 1170 1175 1180Lys
Tyr Leu Tyr Leu Trp Ser Phe Lys1185
1190241198PRTClostridium botulinum serotype A 24Met Asn Ile Asn Asp Asn
Leu Ser Ile Asn Ser Pro Val Asp Asn Lys1 5
10 15Asn Val Val Val Val Arg Ala Arg Lys Thr Asp Thr
Val Phe Lys Ala 20 25 30Phe
Lys Val Ala Pro Asn Ile Trp Val Ala Pro Glu Arg Tyr Tyr Gly 35
40 45Glu Ser Leu Ser Ile Asp Glu Glu Tyr
Lys Val Asp Gly Gly Ile Tyr 50 55
60Asp Ser Asn Phe Leu Ser Gln Asp Ser Glu Lys Asp Lys Phe Leu Gln65
70 75 80Ala Ile Ile Thr Leu
Leu Lys Arg Ile Asn Ser Thr Asn Ala Gly Glu 85
90 95Lys Leu Leu Ser Leu Ile Ser Thr Ala Ile Pro
Phe Pro Tyr Gly Tyr 100 105
110Ile Gly Gly Gly Tyr Tyr Ala Pro Asn Met Ile Thr Phe Gly Ser Ala
115 120 125Pro Lys Ser Asn Lys Lys Leu
Asn Ser Leu Ile Ser Ser Thr Ile Pro 130 135
140Phe Pro Tyr Ala Gly Tyr Arg Glu Thr Asn Tyr Leu Ser Ser Glu
Asp145 150 155 160Asn Lys
Ser Phe Tyr Ala Ser Asn Ile Val Ile Phe Gly Pro Gly Ala
165 170 175Asn Ile Val Glu Asn Asn Thr
Val Phe Tyr Lys Lys Glu Asp Ala Glu 180 185
190Asn Gly Met Gly Thr Met Thr Glu Ile Trp Phe Gln Pro Phe
Leu Thr 195 200 205Tyr Lys Tyr Asp
Glu Phe Tyr Ile Asp Pro Ala Ile Glu Leu Ile Lys 210
215 220Cys Leu Ile Lys Ser Leu Tyr Phe Leu Tyr Gly Ile
Lys Pro Ser Asp225 230 235
240Asp Leu Val Ile Pro Tyr Arg Leu Arg Ser Glu Leu Glu Asn Ile Glu
245 250 255Tyr Ser Gln Leu Asn
Ile Val Asp Leu Leu Val Ser Gly Gly Ile Asp 260
265 270Pro Lys Phe Ile Asn Thr Asp Pro Tyr Trp Phe Ile
Asp Asn Tyr Phe 275 280 285Ser Asn
Ala Lys Lys Val Phe Glu Asp His Arg Asn Ile Tyr Glu Thr 290
295 300Glu Ile Glu Gly Asn Asn Ala Ile Gly Asn Asp
Ile Lys Leu Arg Leu305 310 315
320Lys Gln Lys Phe Arg Ile Asn Ile Asn Asp Ile Trp Glu Leu Asn Leu
325 330 335Asn Tyr Phe Ser
Lys Glu Phe Ser Ile Met Met Pro Asp Arg Phe Asn 340
345 350Asn Ala Leu Lys His Phe Tyr Arg Lys Gln Tyr
Tyr Lys Ile Asp Tyr 355 360 365Pro
Glu Asn Tyr Ser Ile Asn Gly Phe Val Asn Gly Gln Ile Asn Ala 370
375 380Gln Leu Ser Leu Ser Asp Arg Asn Gln Asp
Ile Ile Asn Lys Pro Glu385 390 395
400Glu Ile Ile Asn Leu Leu Asn Gly Asn Asn Val Ser Leu Met Arg
Ser 405 410 415Asn Ile Tyr
Gly Asp Gly Leu Lys Ser Thr Val Asp Asp Phe Tyr Ser 420
425 430Asn Tyr Lys Ile Pro Tyr Asn Arg Ala Tyr
Glu Tyr His Phe Asn Asn 435 440
445Ser Asn Asp Ser Ser Leu Asp Asn Val Asn Ile Gly Val Ile Asp Asn 450
455 460Ile Pro Glu Ile Ile Asp Val Asn
Pro Tyr Lys Glu Asn Cys Asp Lys465 470
475 480Phe Ser Pro Val Gln Lys Ile Thr Ser Thr Arg Glu
Ile Asn Thr Asn 485 490
495Ile Pro Trp Pro Ile Asn Tyr Leu Gln Ala Gln Asn Thr Asn Asn Glu
500 505 510Lys Phe Ser Leu Ser Ser
Asp Phe Val Glu Val Val Ser Ser Lys Asp 515 520
525Lys Ser Leu Val Tyr Ser Phe Leu Ser Asn Val Met Phe Tyr
Leu Asp 530 535 540Ser Ile Lys Asp Asn
Ser Pro Ile Asp Thr Asp Lys Lys Tyr Tyr Leu545 550
555 560Trp Leu Arg Glu Ile Phe Arg Asn Tyr Ser
Phe Asp Ile Thr Ala Thr 565 570
575Gln Glu Ile Asn Thr Asp Cys Gly Ile Asn Lys Val Val Thr Trp Phe
580 585 590Gly Lys Ala Leu Asn
Ile Leu Asn Thr Ser Asp Ser Phe Val Glu Glu 595
600 605Phe Gln Asn Leu Gly Pro Ile Ser Leu Ile Asn Lys
Lys Glu Asn Leu 610 615 620Ser Met Pro
Lys Ile Glu Ile Asp Glu Ile Pro Asn Ser Met Leu Asn625
630 635 640Leu Ser Phe Lys Asp Leu Ser
Glu Asn Leu Phe Asn Ile Phe Ser Lys 645
650 655Asn Asn Ser Tyr Phe Glu Lys Ile Tyr Tyr Asp Phe
Leu Asp Gln Trp 660 665 670Trp
Thr Gln Tyr Tyr Ser Gln Tyr Phe Asp Leu Ile Cys Met Ala Lys 675
680 685Arg Ser Val Leu Ala Gln Glu Ser Leu
Ile Lys Lys Ile Ile Gln Lys 690 695
700Lys Leu Ser Tyr Leu Ile Gly Asn Ser Asn Ile Ser Ser Asp Asn Leu705
710 715 720Ala Leu Met Asn
Leu Thr Thr Thr Asn Thr Leu Arg Asp Ile Ser Asn 725
730 735Glu Ser Gln Ile Ala Met Asn Asn Val Asn
Asn Phe Leu Asn Asn Val 740 745
750Ala Ile Cys Val Phe Gln Thr Asn Ile Tyr Pro Lys Phe Ile Ser Phe
755 760 765Met Glu Gln Cys Ile Asn Asn
Ile Asn Lys Asn Thr Arg Glu Phe Ile 770 775
780Gln Lys Cys Thr Asn Ile Thr Glu Asn Glu Lys Leu Gln Leu Ile
Asn785 790 795 800Gln Asn
Ile Phe Ser Ser Leu Asp Phe Asp Phe Leu Asn Ile Glu Asn
805 810 815Leu Lys Ser Leu Phe Asn Ser
Glu Thr Gly Leu Leu Ile Lys Glu Glu 820 825
830Thr Ser Pro Tyr Glu Leu Val Leu Tyr Ala Phe Gln Glu Pro
Gly Asn 835 840 845Asn Ala Ile Gly
Asp Ala Ser Gly Lys Asn Thr Ser Ile Glu Tyr Ser 850
855 860Lys Asp Ile Gly Leu Val Tyr Gly Ile Asn Ser Asp
Ala Leu Tyr Leu865 870 875
880Asn Gly Ser Asn Gln Ser Ile Ser Phe Ser Asn Asp Phe Phe Glu Asn
885 890 895Gly Leu Thr Asn Ser
Phe Ser Ile Tyr Phe Trp Leu Arg Asn Leu Gly 900
905 910Lys Asp Thr Ile Lys Ser Lys Leu Ile Gly Ser Lys
Glu Asp Asn Cys 915 920 925Gly Trp
Glu Ile Tyr Phe Gln Asp Thr Gly Leu Val Phe Asn Met Ile 930
935 940Asp Ser Asn Gly Asn Glu Lys Asn Ile Tyr Leu
Ser Asp Val Ser Asn945 950 955
960Asn Ser Trp His Tyr Ile Thr Ile Ser Val Asp Arg Leu Lys Glu Gln
965 970 975Leu Leu Ile Phe
Ile Asp Asp Asn Leu Val Ala Asn Glu Ser Ile Lys 980
985 990Glu Ile Leu Asn Ile Tyr Ser Ser Asn Thr Ile
Ser Leu Val Asn Glu 995 1000
1005Asn Asn Pro Ile Tyr Val Glu Gly Leu Ser Ile Leu Asn Arg Ser Ile
1010 1015 1020Thr Ser Glu Glu Val Val Asn
Asn Tyr Phe Thr Tyr Leu Asn Asn Ser1025 1030
1035 1040Tyr Ile Arg Asp Ile Ser Gly Glu Arg Leu Glu Tyr
Asn Lys Thr Tyr 1045 1050
1055Glu Leu Tyr Asn Tyr Val Phe Pro Glu Ser Ser Leu Tyr Glu Val Thr
1060 1065 1070Glu Asn Asn Asn Ile Tyr
Leu Ser Ile Lys Asn Thr Asn Asn Leu Asn 1075 1080
1085Ile Gln Gly Ala Lys Phe Lys Leu Ile Asn Ile Asp Ala Asn
Lys Gln 1090 1095 1100Tyr Val Gln Lys
Trp Asp Glu Gly Val Val Cys Leu Leu Gly Asp Glu1105 1110
1115 1120Glu Lys Tyr Val Asp Ile Ser Ser Glu
Asn Asn Arg Ile Gln Leu Val 1125 1130
1135Ser Ser Lys Asp Thr Ala Lys Arg Ile Ile Phe Asn Asn Asp Ile
Phe 1140 1145 1150Arg Pro Asn
Cys Leu Thr Phe Ala Tyr Asn Asn Lys Tyr Leu Ser Leu 1155
1160 1165Ser Leu Arg Asp Arg Asn Tyr Asn Trp Met Ile
Cys Asn Asn Asn Asp 1170 1175 1180Asn
Ile Pro Lys Ala Ala His Leu Trp Ala Leu Lys Gly Ile1185
1190 1195251197PRTClostridium botulinum serotype B 25Met
Asn Ile Asn Asp Asn Leu Ser Ile Asn Ser Pro Val Asp Asn Lys1
5 10 15Asn Val Val Val Val Arg Ala
Arg Lys Thr Asp Thr Val Phe Lys Ala 20 25
30Phe Lys Val Ala Pro Asn Ile Trp Val Ala Pro Glu Arg Tyr
Tyr Gly 35 40 45Glu Ser Leu Ser
Ile Asp Glu Glu Tyr Lys Val Asp Gly Gly Ile Tyr 50 55
60Asp Ser Asn Phe Leu Ser Gln Asp Ser Glu Lys Asp Lys
Phe Leu Gln65 70 75
80Ala Ile Ile Thr Leu Leu Lys Arg Ile Asn Ser Thr Asn Ala Gly Glu
85 90 95Lys Leu Leu Ser Leu Ile
Ser Thr Ala Ile Pro Phe Pro Tyr Gly Tyr 100
105 110Ile Gly Gly Gly Tyr Tyr Ala Pro Asn Met Ile Thr
Phe Gly Ser Ala 115 120 125Pro Lys
Ser Asn Lys Lys Leu Asn Ser Leu Ile Ser Ser Thr Ile Pro 130
135 140Phe Pro Tyr Ala Gly Tyr Arg Glu Thr Asn Tyr
Leu Ser Ser Glu Asp145 150 155
160Asn Lys Ser Phe Tyr Ala Ser Asn Ile Val Ile Phe Gly Pro Gly Ala
165 170 175Asn Ile Val Glu
Asn Asn Thr Val Phe Tyr Lys Lys Glu Asp Ala Glu 180
185 190Asn Gly Met Gly Thr Met Thr Glu Ile Trp Phe
Gln Pro Phe Leu Thr 195 200 205Tyr
Lys Tyr Asp Glu Phe Tyr Ile Asp Pro Ala Ile Glu Leu Ile Lys 210
215 220Cys Leu Ile Lys Ser Leu Tyr Phe Leu Tyr
Gly Ile Lys Pro Ser Asp225 230 235
240Asp Leu Val Ile Pro Tyr Arg Leu Arg Ser Glu Leu Glu Asn Ile
Glu 245 250 255Tyr Ser Gln
Leu Asn Ile Val Asp Leu Leu Val Ser Gly Gly Ile Asp 260
265 270Pro Lys Phe Ile Asn Thr Asp Pro Tyr Trp
Phe Thr Asp Asn Tyr Phe 275 280
285Ser Asn Ala Lys Lys Val Phe Glu Asp His Arg Asn Ile Tyr Glu Thr 290
295 300Gln Ile Glu Gly Asn Asn Ala Ile
Gly Asn Asp Ile Lys Leu Arg Leu305 310
315 320Lys Gln Lys Phe Arg Ile Asn Ile Asn Asp Ile Trp
Glu Leu Asn Leu 325 330
335Asn Tyr Phe Ser Lys Glu Phe Ser Ile Met Met Pro Asp Arg Phe Asn
340 345 350Asn Ala Leu Lys His Phe
Tyr Arg Lys Gln Tyr Tyr Lys Ile Asp Tyr 355 360
365Pro Glu Asn Tyr Ser Ile Asn Gly Phe Val Asn Gly Gln Ile
Asn Val 370 375 380Gln Leu Ser Leu Ser
Asp Arg Asn Gln Asp Ile Ile Asn Lys Pro Glu385 390
395 400Glu Ile Ile Asn Leu Leu Asn Gly Asn Asn
Val Ser Leu Met Arg Ser 405 410
415Asn Ile Tyr Gly Asp Gly Leu Lys Ser Thr Val Asp Asp Phe Tyr Ser
420 425 430Asn Tyr Lys Ile Pro
Tyr Asn Arg Ala Tyr Glu Tyr His Phe Asn Asn 435
440 445Ser Asn Asp Ser Ser Leu Asp Asn Val Asn Ile Gly
Val Ile Asp Asn 450 455 460Ile Pro Glu
Ile Ile Asp Val Asn Pro Tyr Lys Glu Asn Cys Asp Lys465
470 475 480Phe Ser Pro Val Gln Lys Ile
Thr Ser Thr Arg Glu Ile Asn Thr Asn 485
490 495Ile Pro Trp Pro Ile Asn Tyr Leu Gln Ala Gln Asn
Thr Asn Asn Glu 500 505 510Lys
Phe Ser Leu Ser Ser Asp Phe Val Glu Val Val Ser Ser Lys Asp 515
520 525Lys Ser Leu Val Tyr Ser Phe Leu Ser
Asn Val Met Phe Tyr Leu Asp 530 535
540Ser Ile Lys Asp Asn Ser Pro Ile Asp Thr Asp Lys Lys Tyr Tyr Leu545
550 555 560Trp Leu Arg Glu
Ile Phe Arg Asn Tyr Ser Phe Asp Ile Thr Ala Thr 565
570 575Gln Glu Ile Asn Thr Asp Cys Gly Ile Asn
Lys Val Val Thr Trp Phe 580 585
590Gly Lys Ala Leu Asn Ile Leu Asn Thr Ser Asp Ser Phe Val Glu Glu
595 600 605Phe Gln Asn Leu Gly Pro Ile
Ser Leu Ile Asn Lys Lys Glu Asn Leu 610 615
620Ser Met Pro Ile Ile Glu Ile Tyr Gly Ile Pro Asn Asp Met Leu
Gly625 630 635 640Leu Pro
Leu Asn Asp Leu Asn Glu Lys Leu Phe Asn Ile Tyr Leu Lys
645 650 655Asn Ile Leu Tyr Phe Lys Lys
Val Tyr Phe Asn Phe Leu Asp Gln Trp 660 665
670Trp Thr Glu Tyr Tyr Ser Gln Tyr Phe Asp Leu Ile Cys Met
Ala Lys 675 680 685Gln Ser Ile Leu
Ala Gln Glu Lys Leu Ile Lys Gln Ile Ile Gln Asn 690
695 700Lys Leu Gln Asp Leu Phe Lys Ala Asp Ile Ser Met
Asp Lys Leu Asn705 710 715
720Leu Met Asn Leu Ala Thr Glu Lys Thr Phe Ile Asp Leu Ser Asn Glu
725 730 735Ser Gln Ile Ala Ile
Asn Asn Ile Asn Asp Phe Leu Asn Lys Ser Ala 740
745 750Ile Cys Val Phe Asp Thr Asn Ile Tyr Pro Lys Phe
Ile Ser Phe Met 755 760 765Glu Gln
Cys Ile Asn Ser Val Asn Ser Asn Val Thr Ala Phe Ile Gln 770
775 780Lys Cys Thr Asn Ile Thr Glu Asp Glu Lys Leu
Gln Leu Ile Lys Leu785 790 795
800Asn Thr Phe Met Asn Ile Asp Phe Glu Phe Phe Asp Ile Gln Ser Ile
805 810 815Lys Asp Leu Ile
Thr Ser Glu Thr Asp Leu Ile Lys Glu Glu Lys Glu 820
825 830Ser Asp Tyr Asn Leu Phe Leu Phe Thr Leu Gln
Glu Asp Asn Asn Lys 835 840 845Val
Ile Glu Asp Ile Ser Gly Lys Asn Thr Leu Val Lys Tyr Ser Asp 850
855 860Ser Ile Ser Leu Val Tyr Gly Val Asn Gly
Asp Ala Leu Tyr Leu Lys865 870 875
880Glu Pro Asp Glu Ser Val Ser Phe Ser Asn Lys Ala Phe Glu Asn
Gly 885 890 895Leu Thr Asn
Ser Phe Ser Ile Cys Phe Trp Leu Arg Asn Leu Gly Glu 900
905 910Asp Ile Ile Thr Ser Lys Leu Ile Glu Asn
Lys Ala Asp Asn Cys Gly 915 920
925Trp Glu Ile Tyr Phe Glu Asn Asn Gly Leu Val Phe Ser Ile Val Asp 930
935 940Cys Asn Gly Asn Glu Glu Asn Ile
Tyr Leu Ser Asp Val Ile Ser Lys945 950
955 960Asn Trp Tyr Tyr Ile Ser Ile Ser Ile Asp Arg Leu
Arg Asn Gln Leu 965 970
975Leu Ile Phe Ile Asn Asp Lys Leu Ile Ala Asn Gln Ser Ile Glu Gln
980 985 990Ile Leu Asn Ile Tyr Ser
Ser Asn Thr Ile Ser Leu Val Asn Glu Asn 995 1000
1005Asn Pro Ile Tyr Ile Glu Gly Leu Ser Ile Leu Asn Arg Ser
Ile Thr 1010 1015 1020Ser Glu Glu Val
Val Asn Asn Tyr Phe Ser Tyr Leu Asn Asn Ser Tyr1025 1030
1035 1040Ile Arg Asp Ile Ser Gly Glu Arg Leu
Glu Tyr Asn Lys Thr Tyr Glu 1045 1050
1055Leu Tyr Asn Tyr Val Phe Pro Glu Asn Ser Leu Tyr Glu Val Thr
Glu 1060 1065 1070Asn Asn Asn
Ile Tyr Leu Ser Ile Lys Asp Thr Asn Asn Leu Asn Ile 1075
1080 1085Gln Gly Ala Lys Phe Lys Leu Ile Asn Ile Asp
Ala Asn Lys Gln Tyr 1090 1095 1100Val
Gln Lys Trp Asp Glu Gly Val Val Cys Leu Leu Gly Asp Glu Glu1105
1110 1115 1120Lys Tyr Val Asp Ile Ser
Ser Glu Asn Asn Arg Ile Gln Leu Val Asn 1125
1130 1135Ser Lys Asp Thr Ala Lys Arg Ile Ile Phe Asn Asn
Asp Ile Phe Met 1140 1145
1150Pro Asn Cys Leu Thr Phe Ala Tyr Asn Asn Lys Tyr Leu Ser Leu Ser
1155 1160 1165Leu Arg Asp Arg Asn Tyr Asn
Trp Met Ile Cys Asn Asn Asn Asp Asn 1170 1175
1180Ile Pro Lys Ala Ala His Leu Trp Ala Leu Lys Gly Ile1185
1190 1195261193PRTClostridium botulinum serotype B
26Met Asp Ile Asn Asp Asp Leu Asn Ile Asn Ser Pro Val Asp Asn Lys1
5 10 15Asn Val Val Ile Val Arg
Ala Arg Lys Thr Asn Thr Phe Phe Lys Ala 20 25
30Phe Lys Val Ala Pro Asn Ile Trp Val Ala Pro Glu Arg
Tyr Tyr Gly 35 40 45Glu Pro Leu
His Ile Ala Glu Glu Tyr Lys Leu Asp Gly Gly Ile Tyr 50
55 60Asp Ser Asn Phe Leu Ser Gln Asp Ser Glu Arg Glu
Asn Phe Leu Gln65 70 75
80Ala Ile Ile Ile Leu Leu Lys Arg Ile Asn Asn Thr Ile Ser Gly Lys
85 90 95Gln Leu Leu Ser Leu Ile
Ser Thr Ala Ile Pro Phe Pro Tyr Gly Tyr 100
105 110Ile Gly Gly Gly Tyr Ser Ser Pro Asn Ile Phe Thr
Phe Gly Lys Thr 115 120 125Pro Arg
Thr Asn Lys Lys Leu Asn Ser Leu Val Thr Ser Thr Ile Pro 130
135 140Phe Pro Phe Gly Gly Tyr Arg Glu Thr Asn Tyr
Ile Glu Ser Gln Asn145 150 155
160Asn Lys Asn Phe Tyr Ala Ser Asn Ile Ile Ile Phe Gly Pro Gly Ser
165 170 175Asn Ile Val Glu
Asn Asn Val Ile Tyr Tyr Lys Lys Asn Asp Ala Glu 180
185 190Asn Gly Met Gly Thr Met Ala Glu Ile Val Phe
Gln Pro Leu Leu Thr 195 200 205Tyr
Lys Tyr Asn Lys Phe Tyr Ile Asp Pro Ala Met Glu Leu Thr Lys 210
215 220Cys Leu Ile Lys Ser Leu Tyr Phe Leu Tyr
Gly Ile Lys Pro Ser Gly225 230 235
240Asn Leu Val Val Pro Tyr Arg Leu Arg Thr Glu Leu Asp Asn Lys
Gln 245 250 255Phe Ser Gln
Leu Asn Ile Ile Asp Leu Leu Ile Ser Gly Gly Val Asp 260
265 270Leu Glu Phe Ile Asn Thr Asn Pro Tyr Trp
Phe Thr Asn Ser Tyr Phe 275 280
285Pro Asn Ser Ile Lys Met Phe Glu Lys Tyr Lys Asn Ile Tyr Lys Thr 290
295 300Glu Ile Glu Gly Asn Asn Ala Ile
Gly Asn Asp Ile Lys Leu Arg Leu305 310
315 320Lys Gln Lys Phe Gln Ile Asn Val Gln Asp Ile Trp
Asn Leu Asn Leu 325 330
335Asn Tyr Phe Cys Gln Ser Phe Asn Ser Ile Ile Pro Asp Arg Phe Ser
340 345 350Asn Ala Leu Lys His Phe
Tyr Arg Lys Gln Tyr Tyr Thr Met Asp Tyr 355 360
365Thr Asp Asn Tyr Asn Ile Asn Gly Phe Val Asn Gly Gln Ile
Asn Thr 370 375 380Lys Leu Pro Leu Ser
Asn Lys Asn Thr Asn Ile Ile Ser Lys Pro Glu385 390
395 400Lys Val Val Asn Leu Val Asn Glu Asn Asn
Ile Ser Leu Met Lys Ser 405 410
415Asn Ile Tyr Gly Asp Gly Leu Lys Gly Thr Thr Glu Asp Phe Tyr Ser
420 425 430Thr Tyr Lys Ile Pro
Tyr Asp Glu Glu Tyr Glu Tyr Arg Phe Asn Asp 435
440 445Ser Asp Asn Phe Pro Leu Asn Asn Ile Ser Ile Glu
Glu Val Asp Ser 450 455 460Ile Pro Glu
Ile Ile Asp Ile Asn Pro Tyr Lys Asp Asn Ser Asp Asn465
470 475 480Leu Val Phe Thr Gln Ile Thr
Ser Met Thr Glu Glu Val Thr Thr His 485
490 495Thr Ala Leu Ser Ile Asn Tyr Leu Gln Ala Gln Ile
Thr Asn Asn Glu 500 505 510Asn
Phe Thr Leu Ser Ser Asp Phe Ser Lys Val Val Ser Ser Lys Asp 515
520 525Lys Ser Leu Val Tyr Ser Phe Leu Asp
Asn Leu Met Ser Tyr Leu Glu 530 535
540Thr Ile Lys Asn Asp Arg Pro Ile His Thr Asp Lys Lys Tyr Tyr Leu545
550 555 560Trp Leu Lys Glu
Val Phe Lys Asn Tyr Ser Phe Asp Ile Asn Leu Thr 565
570 575Gln Glu Ile Asp Ser Met Cys Gly Ile Asn
Gln Val Val Leu Trp Phe 580 585
590Gly Lys Ala Leu Asn Ile Leu Asn Thr Ser Asn Ser Phe Val Glu Glu
595 600 605Tyr Gln Asp Ser Gly Ala Ile
Ser Leu Ile Ser Lys Lys Asp Asn Leu 610 615
620Arg Glu Pro Asn Ile Glu Ile Asp Asp Ile Ser Asp Ser Leu Leu
Gly625 630 635 640Leu Ser
Phe Lys Asp Leu Asn Asn Lys Leu Tyr Glu Ile Tyr Ser Lys
645 650 655Asn Ile Val Tyr Phe Lys Lys
Ile Tyr Phe Ser Phe Leu Asp Gln Trp 660 665
670Trp Thr Gln Tyr Tyr Ser Gln Tyr Phe Asp Leu Ile Cys Met
Ala Lys 675 680 685Lys Ser Ile Leu
Ala Gln Glu Thr Leu Ile Lys Lys Ile Ile Gln Lys 690
695 700Lys Leu Ser Tyr Leu Ile Gly Asn Ser Asn Ile Ser
Ser Asp Asn Leu705 710 715
720Ala Leu Met Asn Leu Thr Thr Thr Asn Thr Leu Arg Asp Ile Ser Asn
725 730 735Glu Ser Gln Ile Ala
Met Asn Asn Val Asp Ser Phe Leu Asn Ser Ala 740
745 750Ala Ile Cys Val Phe Glu Gly Asn Ile Tyr Pro Lys
Phe Ile Ser Phe 755 760 765Met Glu
Gln Cys Ile Asn Asn Ile Asn Lys Asn Thr Arg Glu Phe Ile 770
775 780Gln Lys Cys Thr Asn Ile Thr Glu Asn Glu Lys
Leu Gln Leu Ile Asn785 790 795
800Gln Asn Ile Phe Ser Ser Leu Asp Phe Asp Phe Leu Asn Ile Glu Asn
805 810 815Leu Lys Ser Leu
Phe Ser Ser Glu Thr Ala Leu Leu Ile Lys Glu Glu 820
825 830Thr Ser Pro Tyr Glu Leu Val Leu Tyr Ala Phe
Gln Glu Pro Asp Asn 835 840 845Asn
Ala Ile Gly Asp Ala Ser Ala Lys Asn Thr Ser Ile Glu Tyr Ser 850
855 860Lys Asp Ile Asp Leu Val Tyr Gly Ile Asn
Ser Asp Ala Leu Tyr Leu865 870 875
880Asn Gly Ser Asn Gln Ser Ile Ser Phe Ser Asn Asp Phe Phe Glu
Asn 885 890 895Gly Leu Thr
Asn Ser Phe Ser Ile Tyr Phe Trp Leu Arg Asn Leu Gly 900
905 910Lys Asp Thr Ile Lys Ser Lys Leu Ile Gly
Ser Lys Gly Asp Asn Cys 915 920
925Gly Trp Glu Ile Tyr Phe Gln Asp Thr Gly Leu Val Phe Asn Met Ile 930
935 940Asp Ser Asn Gly Asn Glu Lys Asn
Ile Tyr Leu Ser Asp Val Ser Asn945 950
955 960Asn Ser Trp His Tyr Ile Thr Ile Ser Val Asp Arg
Leu Lys Glu Gln 965 970
975Leu Leu Ile Phe Ile Asp Asp Asn Leu Val Ala Asn Glu Ser Ile Lys
980 985 990Glu Ile Leu Asn Ile Tyr
Ser Ser Asn Ile Ile Ser Leu Leu Ser Glu 995 1000
1005Asn Asn Pro Ser Tyr Ile Glu Gly Leu Thr Ile Leu Asn Lys
Pro Thr 1010 1015 1020Thr Ser Gln Glu
Val Leu Asn Asn Tyr Phe Lys Val Leu Asn Asn Ser1025 1030
1035 1040Tyr Ile Arg Asp Ser Asn Glu Glu Arg
Leu Glu Tyr Asn Lys Thr Tyr 1045 1050
1055Gln Leu Tyr Asn Tyr Val Phe Ser Asp Lys Pro Ile Cys Glu Val
Lys 1060 1065 1070Gln Asn Asn
Asn Ile Tyr Leu Thr Ile Asn Asn Thr Asn Asn Leu Asn 1075
1080 1085Leu Gln Pro Ser Lys Phe Lys Leu Leu Ser Ile
Asn Pro Asn Lys Gln 1090 1095 1100Tyr
Val Gln Lys Leu Asp Glu Val Ile Ile Ser Val Leu Gly Asn Met1105
1110 1115 1120Glu Lys Tyr Ile Asp Ile
Ser Glu Asp Asn Arg Leu Gln Leu Ile Asp 1125
1130 1135Asn Lys Asn Gly Ala Lys Lys Met Ile Ile Ser Asn
Asp Met Phe Ile 1140 1145
1150Ser Asn Cys Leu Thr Leu Ser Cys Gly Gly Lys Tyr Ile Cys Leu Ser
1155 1160 1165Met Lys Asp Glu Asn His Asn
Trp Met Ile Cys Asn Asn Asp Met Ser 1170 1175
1180Lys Tyr Leu Tyr Leu Trp Ser Phe Lys1185
1190271196PRTClostridium botulinum serotype C1 27Met Asp Ile Asn Asp Asp
Leu Asn Ile Asn Ser Pro Val Asp Asn Lys1 5
10 15Asn Val Val Ile Val Arg Ala Arg Lys Thr Asn Thr
Phe Phe Lys Ala 20 25 30Phe
Lys Val Ala Pro Asn Ile Trp Val Ala Pro Glu Arg Tyr Tyr Gly 35
40 45Glu Pro Leu Asp Ile Ala Glu Glu Tyr
Lys Leu Asp Gly Gly Ile Tyr 50 55
60Asp Ser Asn Phe Leu Ser Gln Asp Ser Glu Arg Glu Asn Phe Leu Gln65
70 75 80Ala Ile Ile Ile Leu
Leu Lys Arg Ile Asn Asn Thr Ile Ser Gly Lys 85
90 95Gln Leu Leu Ser Leu Ile Ser Thr Ala Ile Pro
Phe Pro Tyr Gly Tyr 100 105
110Ile Gly Gly Gly Tyr Ser Ser Pro Asn Ile Phe Thr Phe Gly Lys Thr
115 120 125Pro Lys Ser Asn Lys Lys Leu
Asn Ser Leu Val Thr Ser Thr Ile Pro 130 135
140Phe Pro Phe Gly Gly Tyr Arg Glu Thr Asn Tyr Ile Glu Ser Gln
Asn145 150 155 160Asn Lys
Asn Phe Tyr Ala Ser Asn Ile Ile Ile Phe Gly Pro Gly Ser
165 170 175Asn Ile Val Glu Asn Asn Val
Ile Tyr Tyr Lys Lys Asn Asp Ala Glu 180 185
190Asn Gly Met Gly Thr Met Ala Glu Ile Val Phe Gln Pro Leu
Leu Thr 195 200 205Tyr Lys Tyr Asn
Lys Phe Tyr Ile Asp Pro Ala Met Glu Leu Thr Lys 210
215 220Cys Leu Ile Lys Ser Leu Tyr Phe Leu Tyr Gly Ile
Lys Pro Ser Asp225 230 235
240Asn Leu Val Val Pro Tyr Arg Leu Arg Thr Glu Leu Asp Asn Lys Gln
245 250 255Phe Ser Gln Leu Asn
Ile Ile Asp Leu Leu Ile Ser Gly Gly Val Asp 260
265 270Leu Glu Phe Ile Asn Thr Asn Pro Tyr Trp Phe Thr
Asn Ser Tyr Phe 275 280 285Pro Asn
Ser Ile Lys Met Phe Glu Lys Tyr Lys Asn Ile Tyr Lys Thr 290
295 300Glu Ile Glu Gly Asn Asn Ala Ile Gly Asn Asp
Ile Lys Leu Arg Leu305 310 315
320Lys Gln Lys Phe Gln Ile Asn Val Gln Asp Ile Trp Asn Leu Asn Leu
325 330 335Asn Tyr Phe Cys
Gln Ser Phe Asn Ser Ile Ile Pro Asp Arg Phe Ser 340
345 350Asn Ala Leu Lys His Phe Tyr Arg Lys Gln Tyr
Tyr Thr Met Asp Tyr 355 360 365Thr
Asp Asn Tyr Asn Ile Asn Gly Phe Val Asn Gly Gln Ile Asn Thr 370
375 380Lys Leu Pro Leu Ser Asn Lys Asn Thr Asn
Ile Ile Ser Lys Pro Glu385 390 395
400Lys Val Val Asn Leu Val Asn Glu Asn Asn Ile Ser Leu Met Lys
Ser 405 410 415Asn Ile Tyr
Gly Asp Gly Leu Lys Gly Thr Thr Glu Asp Phe Tyr Ser 420
425 430Thr Tyr Lys Ile Pro Tyr Asn Glu Glu Tyr
Glu Tyr Arg Phe Asn Asp 435 440
445Ser Asp Asn Phe Pro Leu Asn Asn Ile Ser Ile Glu Glu Val Asp Ser 450
455 460Ile Pro Glu Ile Ile Asp Ile Asn
Pro Tyr Lys Asp Asn Ser Asp Asn465 470
475 480Leu Val Phe Thr Gln Ile Thr Ser Met Thr Glu Glu
Val Thr Thr His 485 490
495Thr Ala Leu Ser Ile Asn Tyr Leu Gln Ala Gln Ile Thr Asn Asn Glu
500 505 510Asn Phe Thr Leu Ser Ser
Asp Phe Ser Lys Val Val Ser Ser Lys Asp 515 520
525Lys Ser Leu Val Tyr Ser Phe Leu Asp Asn Leu Met Ser Tyr
Leu Glu 530 535 540Thr Ile Lys Asn Asp
Gly Pro Ile Asp Thr Asp Lys Lys Tyr Tyr Leu545 550
555 560Trp Leu Lys Glu Val Phe Lys Asn Tyr Ser
Phe Asp Ile Asn Leu Thr 565 570
575Gln Glu Ile Asp Ser Met Cys Gly Ile Asn Glu Val Val Leu Trp Phe
580 585 590Gly Lys Ala Leu Asn
Ile Leu Asn Thr Ser Asn Ser Phe Val Glu Glu 595
600 605Tyr Gln Asp Ser Gly Ala Ile Ser Leu Ile Ser Lys
Lys Asp Asn Leu 610 615 620Arg Glu Pro
Asn Ile Glu Ile Asp Asp Ile Ser Asp Ser Leu Leu Gly625
630 635 640Leu Ser Phe Lys Asp Leu Asn
Asn Lys Leu Tyr Glu Ile Tyr Ser Lys 645
650 655Asn Ile Val Tyr Phe Lys Lys Ile Tyr Phe Ser Phe
Leu Asp Gln Trp 660 665 670Trp
Thr Glu Tyr Tyr Ser Gln Tyr Phe Glu Leu Ile Cys Met Ala Lys 675
680 685Gln Ser Ile Leu Ala Gln Glu Ser Leu
Val Lys Gln Ile Val Gln Asn 690 695
700Lys Phe Thr Asp Leu Ser Lys Ala Ser Ile Pro Pro Asp Thr Leu Lys705
710 715 720Leu Ile Arg Glu
Thr Thr Glu Lys Thr Phe Ile Asp Leu Ser Asn Glu 725
730 735Ser Gln Ile Ser Met Asn Arg Val Asp Asn
Phe Leu Asn Lys Ala Ser 740 745
750Ile Cys Val Phe Val Glu Asp Ile Tyr Pro Lys Phe Ile Ser Tyr Met
755 760 765Glu Lys Tyr Ile Asn Asn Ile
Asn Ile Lys Thr Arg Glu Phe Ile Gln 770 775
780Arg Cys Thr Asn Ile Asn Asp Asn Glu Lys Ser Ile Leu Ile Asn
Ser785 790 795 800Tyr Thr
Phe Lys Thr Ile Asp Phe Lys Phe Leu Asp Ile Gln Ser Ile
805 810 815Lys Asn Phe Phe Asn Ser Gln
Val Glu Gln Val Met Lys Glu Ile Leu 820 825
830Ser Pro Tyr Gln Leu Leu Leu Phe Ala Ser Lys Gly Pro Asn
Ser Asn 835 840 845Ile Ile Glu Asp
Ile Ser Gly Lys Asn Thr Leu Ile Gln Tyr Thr Glu 850
855 860Ser Ile Glu Leu Val Tyr Gly Val Asn Gly Glu Ser
Leu Tyr Leu Lys865 870 875
880Ser Pro Asn Glu Thr Ile Lys Phe Ser Asn Lys Phe Phe Thr Asn Gly
885 890 895Leu Thr Asn Asn Phe
Thr Ile Cys Phe Trp Leu Arg Phe Thr Gly Lys 900
905 910Asn Asp Asp Lys Thr Arg Leu Ile Gly Asn Lys Val
Asn Asn Cys Gly 915 920 925Trp Glu
Ile Tyr Phe Glu Asp Asn Gly Leu Val Phe Glu Ile Ile Asp 930
935 940Ser Asn Gly Asn Gln Glu Ser Val Tyr Leu Ser
Asn Ile Ile Asn Asp945 950 955
960Asn Trp Tyr Tyr Ile Ser Ile Ser Val Asp Arg Leu Lys Asp Gln Leu
965 970 975Leu Ile Phe Ile
Asn Asp Lys Asn Val Ala Asn Val Ser Ile Asp Gln 980
985 990Ile Leu Ser Ile Tyr Ser Thr Asn Ile Ile Ser
Leu Val Asn Lys Asn 995 1000
1005Asn Ser Ile Tyr Val Glu Glu Leu Ser Val Leu Asp Asn Pro Ile Thr
1010 1015 1020Ser Glu Glu Val Ile Arg Asn
Tyr Phe Ser Tyr Leu Asp Asn Ser Tyr1025 1030
1035 1040Ile Arg Asp Ser Ser Lys Ser Leu Leu Glu Tyr Asn
Lys Asn Tyr Gln 1045 1050
1055Leu Tyr Asn Tyr Val Phe Pro Glu Thr Ser Leu Tyr Glu Val Asn Asp
1060 1065 1070Asn Asn Lys Ser Tyr Leu
Ser Leu Lys Asn Thr Asp Gly Ile Asn Ile 1075 1080
1085Ser Ser Val Lys Phe Lys Leu Ile Asn Ile Asp Glu Ser Lys
Val Tyr 1090 1095 1100Val Gln Lys Trp
Asp Glu Cys Ile Ile Cys Val Leu Asp Gly Thr Glu1105 1110
1115 1120Lys Tyr Leu Asp Ile Ser Pro Glu Asn
Asn Arg Ile Gln Leu Val Ser 1125 1130
1135Ser Lys Asp Asn Ala Lys Lys Ile Thr Val Asn Thr Asp Leu Phe
Arg 1140 1145 1150Pro Asp Cys
Ile Thr Phe Ser Tyr Asn Asp Lys Tyr Phe Ser Leu Ser 1155
1160 1165Leu Arg Asp Gly Asp Tyr Asn Trp Met Ile Cys
Asn Asp Asn Asn Lys 1170 1175 1180Val
Pro Lys Gly Ala His Leu Trp Ile Leu Glu Ser1185 1190
1195281196PRTClostridium botulinum serotype D 28Met Asp Ile Asn
Asp Asp Leu Asn Ile Asn Ser Pro Val Asp Asn Lys1 5
10 15Asn Val Val Ile Val Arg Ala Arg Lys Thr
Asn Thr Phe Phe Lys Ala 20 25
30Phe Lys Val Ala Pro Asn Ile Trp Val Ala Pro Glu Arg Tyr Tyr Gly
35 40 45Glu Pro Leu Asp Ile Ala Glu Glu
Tyr Lys Leu Asp Gly Gly Ile Tyr 50 55
60Asp Ser Asn Phe Leu Ser Gln Asp Ser Glu Arg Glu Asn Phe Leu Gln65
70 75 80Ala Ile Ile Thr Leu
Leu Lys Arg Ile Asn Asn Thr Ile Ser Gly Lys 85
90 95Gln Leu Leu Ser Leu Ile Ser Thr Ala Ile Pro
Phe Pro Tyr Gly Tyr 100 105
110Val Gly Gly Gly Tyr Ser Ser Pro Asn Ile Phe Thr Phe Gly Lys Thr
115 120 125Pro Lys Ser Asn Lys Lys Leu
Asn Ser Leu Val Thr Ser Thr Ile Pro 130 135
140Phe Pro Phe Gly Gly Tyr Arg Glu Thr Asn Tyr Ile Glu Ser Gln
Asn145 150 155 160Asn Lys
Asn Phe Tyr Ala Ser Asn Ile Val Ile Phe Gly Pro Gly Ser
165 170 175Asn Ile Val Glu Asn Asn Val
Ile Cys Tyr Lys Lys Asn Asp Ala Glu 180 185
190Asn Gly Met Gly Thr Met Ala Glu Ile Leu Phe Gln Pro Leu
Leu Thr 195 200 205Tyr Lys Tyr Asn
Lys Phe Tyr Ile Asp Pro Ala Met Glu Leu Thr Lys 210
215 220Cys Leu Ile Lys Ser Leu Tyr Phe Leu Tyr Gly Ile
Lys Pro Ser Asp225 230 235
240Asp Leu Val Val Pro Tyr Arg Leu Arg Thr Glu Leu Asp Asn Lys Gln
245 250 255Phe Ser Gln Leu Asn
Ile Ile Asp Leu Leu Ile Ser Gly Gly Val Asp 260
265 270Leu Glu Phe Ile Asn Thr Asn Pro Tyr Trp Phe Thr
Asn Ser Tyr Phe 275 280 285Ser Asn
Ser Ile Lys Met Phe Glu Lys Tyr Lys Asn Ile Tyr Glu Thr 290
295 300Glu Ile Glu Gly Asn Asn Ala Ile Gly Asn Asp
Ile Lys Leu Arg Leu305 310 315
320Lys Gln Lys Phe Gln Asn Ser Val Gln Asp Ile Trp Asn Leu Asn Leu
325 330 335Asn Tyr Phe Ser
Lys Glu Phe Asn Ser Ile Ile Pro Asp Arg Phe Ser 340
345 350Asn Ala Leu Lys His Phe Tyr Arg Lys Gln Tyr
Tyr Thr Met Asp Tyr 355 360 365Gly
Asp Asn Tyr Asn Ile Asn Gly Phe Val Asn Gly Gln Ile Asn Thr 370
375 380Lys Leu Pro Leu Ser Asp Lys Asn Thr Asn
Ile Ile Ser Lys Pro Glu385 390 395
400Lys Val Val Asn Leu Val Asn Ala Asn Asn Ile Ser Leu Met Lys
Ser 405 410 415Asn Ile Tyr
Gly Asp Gly Leu Lys Gly Thr Thr Glu Asp Phe Tyr Ser 420
425 430Thr Tyr Lys Ile Pro Tyr Asn Glu Glu Tyr
Glu Tyr Arg Phe Asn Asp 435 440
445Ser Asp Asn Phe Pro Leu Asn Asn Ile Ser Ile Glu Glu Val Asp Ser 450
455 460Ile Pro Glu Ile Ile Asp Ile Asn
Pro Tyr Lys Asp Asn Ser Asp Asp465 470
475 480Leu Leu Phe Thr Gln Ile Thr Ser Thr Thr Glu Glu
Val Ile Thr His 485 490
495Thr Ala Leu Pro Val Asn Tyr Leu Gln Ala Gln Ile Ile Thr Asn Glu
500 505 510Asn Phe Thr Leu Ser Ser
Asp Phe Ser Lys Val Val Ser Ser Lys Asp 515 520
525Lys Ser Leu Val Tyr Ser Phe Leu Asp Asn Leu Met Ser Tyr
Leu Glu 530 535 540Thr Ile Lys Asn Asp
Gly Pro Ile Asp Thr Asp Lys Lys Tyr Tyr Leu545 550
555 560Trp Leu Lys Glu Val Phe Lys Asn Tyr Ser
Phe Asp Ile Asn Leu Thr 565 570
575Gln Glu Ile Asp Ser Ser Cys Gly Ile Asn Glu Val Val Ile Trp Phe
580 585 590Gly Lys Ala Leu Asn
Ile Leu Asn Thr Ser Asn Ser Phe Val Glu Glu 595
600 605Tyr Gln Asn Ser Gly Pro Ile Ser Leu Ile Ser Lys
Lys Asp Asn Leu 610 615 620Ser Glu Pro
Asn Ile Glu Ile Asp Asp Ile Pro Asp Ser Leu Leu Gly625
630 635 640Leu Ser Phe Lys Asp Leu Asn
Asn Lys Leu Tyr Glu Ile Tyr Ser Lys 645
650 655Asn Arg Val Tyr Phe Arg Lys Ile Tyr Phe Asn Phe
Leu Asp Gln Trp 660 665 670Trp
Thr Glu Tyr Tyr Ser Gln Tyr Phe Glu Leu Ile Cys Met Ala Lys 675
680 685Gln Ser Ile Leu Ala Gln Glu Ser Val
Val Lys Gln Ile Ile Gln Asn 690 695
700Lys Phe Thr Asp Leu Ser Lys Ala Ser Ile Pro Pro Asp Thr Leu Lys705
710 715 720Leu Ile Lys Glu
Thr Thr Glu Lys Thr Phe Ile Asp Leu Ser Asn Glu 725
730 735Ser Gln Ile Ser Met Asn Arg Val Asp Asn
Phe Leu Asn Lys Ala Ser 740 745
750Ile Cys Val Phe Val Glu Asp Ile Tyr Pro Lys Phe Ile Ser Tyr Met
755 760 765Glu Lys Tyr Ile Asn Asn Ile
Asn Ile Lys Thr Arg Glu Phe Ile Gln 770 775
780Arg Cys Thr Asn Ile Asn Asp Asn Glu Lys Ser Ile Leu Ile Asn
Ser785 790 795 800Tyr Thr
Phe Lys Thr Ile Asp Phe Lys Phe Leu Asn Ile Gln Ala Ile
805 810 815Lys Asn Phe Phe Asn Ser Gln
Val Glu Gln Val Met Lys Glu Met Leu 820 825
830Ser Pro Tyr Gln Leu Leu Leu Phe Ala Thr Arg Gly Pro Asn
Ser Asn 835 840 845Ile Ile Glu Asp
Ile Ser Gly Lys Asn Thr Leu Ile Gln Tyr Thr Glu 850
855 860Ser Val Glu Leu Val Tyr Gly Val Asn Gly Glu Ser
Leu Tyr Leu Lys865 870 875
880Ser Pro Asn Glu Thr Val Glu Phe Ser Asn Asn Phe Phe Thr Asn Gly
885 890 895Leu Thr Asn Asn Phe
Thr Ile Cys Phe Trp Leu Arg Phe Thr Gly Lys 900
905 910Asp Asp Asp Lys Thr Arg Leu Ile Gly Asn Lys Val
Asn Asn Cys Gly 915 920 925Trp Glu
Ile Tyr Phe Glu Asp Asn Gly Leu Val Phe Glu Ile Ile Asp 930
935 940Ser Asn Gly Asn Gln Glu Ser Val Tyr Leu Ser
Asn Val Ile Asn Asn945 950 955
960Asn Trp Tyr Tyr Ile Ser Ile Ser Val Asp Arg Leu Lys Asp Gln Leu
965 970 975Leu Ile Phe Ile
Asn Asp Lys Asn Val Ala Asn Val Ser Ile Glu Gln 980
985 990Ile Leu Asn Ile Tyr Ser Thr Asn Val Ile Ser
Leu Val Asn Lys Asn 995 1000
1005Asn Ser Ile Tyr Val Glu Glu Leu Ser Val Leu Asp Lys Pro Val Ala
1010 1015 1020Ser Glu Glu Val Ile Arg Asn
Tyr Phe Ser Tyr Leu Asp Asn Ser Tyr1025 1030
1035 1040Ile Arg Asp Ser Ser Lys Ser Leu Leu Glu Tyr Asn
Lys Asn Tyr Gln 1045 1050
1055Leu Tyr Asn Tyr Val Phe Pro Glu Thr Ser Leu Tyr Glu Val Asn Asp
1060 1065 1070Asn Asn Lys Ser Tyr Leu
Ser Leu Lys Asn Thr Asp Gly Ile Asn Ile 1075 1080
1085Pro Ser Val Lys Phe Lys Leu Ile Asn Ile Asp Glu Ser Lys
Gly Tyr 1090 1095 1100Val Gln Lys Trp
Asp Glu Cys Ile Ile Cys Val Ser Asp Gly Thr Glu1105 1110
1115 1120Lys Tyr Leu Asp Ile Ser Pro Glu Asn
Asn Arg Ile Gln Leu Val Ser 1125 1130
1135Ser Lys Asp Asn Ala Lys Lys Ile Thr Val Asn Thr Asp Leu Phe
Arg 1140 1145 1150Pro Asp Cys
Ile Thr Phe Ser Tyr Asn Asp Lys Tyr Phe Ser Leu Ser 1155
1160 1165Leu Arg Asp Gly Asp Tyr Asn Trp Met Ile Cys
Asn Asp Asn Asn Lys 1170 1175 1180Val
Pro Lys Gly Ala His Leu Trp Ile Leu Lys Ser1185 1190
1195291162PRTClostridium botulinum serotype E 29Met Lys Ile Asn
Gly Asn Leu Asn Ile Asp Ser Pro Val Asp Asn Lys1 5
10 15Asn Val Ala Ile Val Arg Ser Arg Asn Gln
Met Phe Phe Lys Ala Phe 20 25
30Gln Val Ala Pro Asn Ile Trp Ile Val Pro Glu Arg Tyr Tyr Gly Glu
35 40 45Ser Leu Lys Ile Asn Glu Asp Gln
Lys Phe Asp Gly Gly Ile Tyr Asp 50 55
60Ser Asn Phe Leu Ser Thr Asn Asn Glu Lys Asp Asp Phe Leu Gln Ala65
70 75 80Thr Ile Lys Leu Leu
Gln Arg Ile Asn Asn Asn Val Val Gly Ala Lys 85
90 95Leu Leu Ser Leu Ile Ser Thr Ala Ile Pro Phe
Pro Tyr Glu Asn Asn 100 105
110Thr Glu Asp Tyr Arg Gln Thr Asn Tyr Leu Ser Ser Lys Asn Asn Glu
115 120 125His Tyr Tyr Thr Ala Asn Leu
Val Ile Phe Gly Pro Gly Ser Asn Ile 130 135
140Ile Lys Asn Asn Val Ile Tyr Tyr Lys Lys Glu Tyr Ala Glu Ser
Gly145 150 155 160Met Gly
Thr Met Leu Glu Ile Trp Phe Gln Pro Phe Leu Thr His Lys
165 170 175Tyr Asp Glu Phe Tyr Val Asp
Pro Ala Leu Glu Leu Ile Lys Cys Leu 180 185
190Ile Lys Ser Leu Tyr Tyr Leu Tyr Gly Ile Lys Pro Asn Asp
Asn Leu 195 200 205Asn Ile Pro Tyr
Arg Leu Arg Asn Glu Phe Asn Ser Leu Glu Tyr Ser 210
215 220Glu Leu Asn Met Ile Asp Phe Leu Ile Ser Gly Gly
Ile Asp Tyr Lys225 230 235
240Leu Leu Asn Thr Asn Pro Tyr Trp Phe Ile Asp Lys Tyr Phe Ile Asp
245 250 255Thr Ser Lys Asn Phe
Glu Lys Tyr Lys Asn Asp Tyr Glu Ile Lys Ile 260
265 270Lys Asn Asn Asn Tyr Ile Ala Asn Ser Ile Lys Leu
Tyr Leu Glu Gln 275 280 285Lys Phe
Lys Ile Asn Val Lys Asp Ile Trp Glu Leu Asn Leu Ser Tyr 290
295 300Phe Ser Lys Glu Phe Gln Ile Met Met Pro Glu
Arg Tyr Asn Asn Ala305 310 315
320Leu Asn His Tyr Tyr Arg Lys Glu Phe Tyr Val Ile Asp Tyr Phe Lys
325 330 335Asn Tyr Asn Ile
Asn Gly Phe Lys Asn Gly Gln Ile Lys Thr Lys Leu 340
345 350Pro Leu Ser Lys Tyr Asn Lys Glu Ile Ile Asn
Lys Pro Glu Leu Ile 355 360 365Val
Asn Leu Ile Asn Gln Asn Asn Thr Val Leu Met Lys Ser Asn Ile 370
375 380Tyr Gly Asp Gly Leu Lys Gly Thr Val Asp
Asn Phe Tyr Ser Asn Tyr385 390 395
400Ile Ile Pro Tyr Asn Leu Asn Tyr Glu His Ser Ile Asn Tyr Phe
Tyr 405 410 415Leu Asp Asn
Val Asn Ile Glu Glu Ile Glu Lys Ile Pro Pro Ile Asn 420
425 430Asp Glu Asp Ile Tyr Pro Tyr Arg Lys Asn
Ala Asp Thr Phe Ile Pro 435 440
445Val Tyr Asn Ile Thr Lys Ala Lys Glu Ile Asn Thr Thr Thr Pro Leu 450
455 460Pro Val Asn Tyr Leu Gln Ala Gln
Met Ile Asp Ser Asn Asp Ile Asn465 470
475 480Leu Ser Ser Asp Phe Leu Lys Val Ile Ser Ser Lys
Gly Ser Leu Val 485 490
495Tyr Ser Phe Leu Asn Asn Thr Met Asp Tyr Leu Glu Phe Ile Lys Tyr
500 505 510Asp Lys Pro Ile Asp Thr
Asp Lys Lys Tyr Tyr Lys Trp Leu Lys Ala 515 520
525Ile Phe Arg Asn Tyr Ser Leu Asp Ile Thr Glu Thr Gln Glu
Ile Ser 530 535 540Asn Gln Phe Gly Asp
Thr Lys Ile Ile Pro Trp Ile Gly Arg Ala Leu545 550
555 560Asn Ile Leu Asn Thr Asn Asn Ser Phe Val
Glu Glu Phe Lys Asn Leu 565 570
575Gly Pro Ile Ser Leu Ile Asn Lys Lys Glu Asn Ile Thr Ile Pro Lys
580 585 590Ile Lys Ile Asp Glu
Ile Pro Ser Ser Met Leu Asn Phe Ser Phe Lys 595
600 605Asp Leu Ser Glu Asn Leu Phe Asn Ile Tyr Cys Lys
Asn Asn Phe Tyr 610 615 620Leu Lys Lys
Ile Tyr Tyr Asn Phe Leu Asp Gln Trp Trp Thr Gln Tyr625
630 635 640Tyr Ser Gln Tyr Phe Asp Leu
Ile Cys Met Ala Ser Lys Ser Val Leu 645
650 655Ala Gln Glu Lys Leu Ile Lys Lys Leu Ile Gln Lys
Gln Leu Arg Tyr 660 665 670Leu
Met Glu Asn Ser Asn Ile Ser Ser Thr Asn Leu Ile Leu Ile Asn 675
680 685Leu Thr Thr Thr Asn Thr Leu Arg Asp
Ile Ser Asn Gln Ser Gln Ile 690 695
700Ala Ile Asn Asn Ile Asp Lys Phe Phe Asn Asn Ala Ala Met Cys Val705
710 715 720Phe Glu Asn Asn
Ile Tyr Pro Lys Phe Thr Ser Phe Met Glu Gln Cys 725
730 735Ile Lys Asn Ile Asn Lys Ser Thr Lys Glu
Phe Ile Leu Lys Cys Thr 740 745
750Asn Ile Asn Glu Thr Glu Lys Ser His Leu Ile Met Gln Asn Ser Phe
755 760 765Ser Asn Leu Asp Phe Asp Phe
Leu Asp Ile Gln Asn Met Lys Asn Leu 770 775
780Phe Asn Leu Tyr Thr Glu Leu Leu Ile Lys Glu Gln Thr Ser Pro
Tyr785 790 795 800Glu Leu
Ser Leu Tyr Ala Phe Gln Glu Gln Asp Asn Asn Val Ile Gly
805 810 815Asp Thr Ser Gly Lys Asn Thr
Leu Val Glu Tyr Pro Lys Asp Ile Gly 820 825
830Leu Val Tyr Gly Ile Asn Asn Asn Ala Ile His Leu Thr Gly
Ala Asn 835 840 845Gln Asn Ile Lys
Phe Thr Asn Asp Tyr Phe Glu Asn Gly Leu Thr Asn 850
855 860Asn Phe Ser Ile Tyr Phe Trp Leu Arg Asn Leu Lys
Gln Asn Thr Ile865 870 875
880Lys Ser Lys Leu Ile Gly Ser Lys Glu Asp Asn Cys Gly Trp Glu Ile
885 890 895Tyr Phe Glu Asn Asp
Gly Leu Val Phe Asn Ile Ile Asp Ser Asn Gly 900
905 910Asn Glu Lys Asn Ile Tyr Leu Ser Asn Ile Ser Asn
Lys Ser Trp His 915 920 925Tyr Ile
Val Ile Ser Ile Asn Arg Leu Lys Asp Gln Leu Leu Ile Phe 930
935 940Ile Asp Asn Ile Leu Val Ala Asn Glu Asp Ile
Lys Glu Ile Leu Asn945 950 955
960Ile Tyr Ser Ser Asp Ile Ile Ser Leu Leu Ser Asp Asn Asn Asn Val
965 970 975Tyr Ile Glu Gly
Leu Ser Val Leu Asn Lys Thr Ile Asn Ser Asn Glu 980
985 990Ile Leu Thr Asp Tyr Phe Ser Asp Leu Asn Asn
Ser Tyr Ile Arg Asn 995 1000
1005Phe Asp Glu Glu Ile Leu Gln Tyr Asn Arg Thr Tyr Glu Leu Phe Asn
1010 1015 1020Tyr Val Phe Pro Glu Ile Ala
Ile Asn Lys Ile Glu Gln Asn Asn Asn1025 1030
1035 1040Ile Tyr Leu Ser Ile Asn Asn Glu Asn Asn Leu Asn
Phe Lys Pro Leu 1045 1050
1055Lys Phe Lys Leu Leu Asn Thr Asn Pro Asn Lys Gln Tyr Val Gln Lys
1060 1065 1070Trp Asp Glu Val Ile Phe
Ser Val Leu Asp Gly Thr Glu Lys Tyr Leu 1075 1080
1085Asp Ile Ser Thr Thr Asn Asn Arg Ile Gln Leu Val Asp Asn
Lys Asn 1090 1095 1100Asn Ala Gln Ile
Phe Ile Ile Asn Asn Asp Ile Phe Ile Ser Asn Cys1105 1110
1115 1120Leu Thr Leu Thr Tyr Asn Asn Val Asn
Val Tyr Leu Ser Ile Lys Asn 1125 1130
1135Gln Asp Tyr Asn Trp Val Ile Cys Asp Leu Asn His Asp Ile Pro
Lys 1140 1145 1150Lys Ser Tyr
Leu Trp Ile Leu Lys Asn Ile 1155
1160301159PRTClostridium botulinum serotype F 30Met Lys Ile Asn Asn Asn
Phe Asn Ile Asp Ser Leu Ile Asp Asn Arg1 5
10 15Asp Val Ala Ile Val Arg Gly Arg Lys Thr Asp Thr
Phe Phe Lys Val 20 25 30Phe
Gln Val Ala Pro Asn Ile Trp Ile Ala Pro Glu Arg Tyr Tyr Gly 35
40 45Glu Ser Leu Asn Ile Asn Glu Asp Gln
Lys Ser Asp Gly Gly Ile Tyr 50 55
60Asp Ser Asn Phe Leu Ser Thr Asn Asp Glu Lys Asp Glu Phe Leu Gln65
70 75 80Ala Thr Val Lys Ile
Leu Gln Arg Ile Asn Asn Asn Val Ile Gly Ala 85
90 95Lys Leu Leu Ser Leu Ile Ser Thr Ala Ile Pro
Phe Pro Tyr Glu Tyr 100 105
110Lys Pro Gly Asp Tyr Arg Gln Thr Asn Tyr Leu Val Ser Lys Asp Asn
115 120 125Gln His Tyr Tyr Thr Ala Asn
Leu Val Ile Phe Gly Pro Gly Thr Asn 130 135
140Ile Val Glu Asn Asn Ala Ile Tyr Tyr Lys Lys Glu Asp Ser Glu
Asn145 150 155 160Gly Met
Gly Thr Met Ser Glu Ile Trp Phe Gln Pro Phe Leu Thr Tyr
165 170 175Lys Tyr Gly Gln Phe Tyr Val
Asp Pro Ala Leu Glu Leu Ile Lys Cys 180 185
190Leu Ile Lys Ser Leu Tyr Tyr Leu Tyr Gly Ile Lys Pro Ser
Asp Asp 195 200 205Leu Ser Ile Pro
Tyr Arg Leu Arg Ser Glu Leu Asn Ser Phe Glu Tyr 210
215 220Ser Glu Leu Asp Met Ile Asp Phe Leu Ile Ser Gly
Gly Thr Glu Tyr225 230 235
240Lys Leu Leu Asp Thr Asn Pro Tyr Trp Phe Thr Asp Asn Tyr Phe Ile
245 250 255Asp Ala Pro Lys Asn
Phe Glu Lys Tyr Lys Asn Asp Tyr Glu Thr Lys 260
265 270Ile Lys Asn Asn Asn Asp Ile Ala Asn Ser Ile Lys
Leu Tyr Leu Glu 275 280 285Gln Lys
Phe Lys Thr Asn Ala Gln Asp Ile Trp Glu Leu Asn Leu Ser 290
295 300Tyr Phe Ser Thr Glu Phe Glu Ile Met Met Pro
Glu Ile Phe Asn Asn305 310 315
320Ala Leu Asn His Tyr Tyr Arg Lys Glu Tyr Tyr Val Ile Asp Tyr Phe
325 330 335Lys Asn Tyr Asn
Ile Asn Gly Phe Ile Asn Gly Gln Ile Lys Thr Ile 340
345 350Leu Pro Leu Ser Lys Tyr Asn Lys Asn Ile Ile
Asn Lys Pro Glu Leu 355 360 365Val
Val Asn Leu Ile Asn Glu Asn Asn Thr Val Leu Met Lys Ser Asn 370
375 380Val Tyr Gly Asp Gly Leu Lys Gly Thr Met
Asp Asn Phe Tyr Ala Ala385 390 395
400Tyr Lys Ile Pro Tyr Asn Ile Gly Asp Glu Tyr His Ile Asn Tyr
Ser 405 410 415Tyr Leu Asn
Asn Val Asn Val Glu Glu Ile Asn Asn Ile Pro Pro Ile 420
425 430Asn Asp Ala Asp Ile Tyr Pro Tyr Arg Lys
Asn Ser Asp Pro Phe Ile 435 440
445Pro Val Tyr Asn Ile Thr Glu Thr Lys Glu Ile Asn Thr Thr Thr Pro 450
455 460Leu Ser Val Asn Tyr Leu Gln Ala
Gln Val Thr Asn Ser Asn Asp Ile465 470
475 480Ser Leu Ser Ser Asp Phe Ser Lys Val Ile Ser Ser
Lys Asp Arg Ser 485 490
495Leu Val Tyr Ser Phe Leu Asp Asn Thr Ile Asp Tyr Leu Asp Ser Ile
500 505 510Lys Tyr Asp Glu Pro Ile
Asp Thr Asp Lys Lys Tyr Tyr Leu Trp Leu 515 520
525Lys Glu Ile Phe Arg Asn Tyr Ser Phe Asp Met Thr Glu Thr
Gln Glu 530 535 540Val Asn Thr Pro Cys
Gly Ile Asn Lys Val Val Pro Trp Leu Gly Lys545 550
555 560Ala Leu Asn Ile Leu Asn Thr Gly Asn Ser
Phe Ile Glu Glu Phe Lys 565 570
575Ser Leu Gly Pro Ile Ser Leu Ile Asn Lys Lys Glu Asn Ile Thr Met
580 585 590Pro Lys Ile Glu Ile
Asp Glu Ile Pro Asn Ser Met Leu Asn Leu Ser 595
600 605Phe Lys Asp Leu Ser Glu Asn Leu Phe Asn Arg Phe
Ser Lys Asn Asn 610 615 620Ser Tyr Phe
Glu Lys Ile Tyr Tyr Asp Phe Leu Asp Gln Trp Trp Thr625
630 635 640Gln Tyr Tyr Ser Gln Tyr Phe
Asp Leu Ile Cys Met Ala Lys Lys Ser 645
650 655Ile Leu Ala Gln Glu Thr Leu Ile Lys Lys Ile Ile
Gln Lys Lys Leu 660 665 670Ser
Tyr Leu Ile Gly Asn Ser Asn Ile Ser Ser Asp Asn Leu Ala Leu 675
680 685Met Asn Leu Thr Thr Thr Asn Thr Leu
Arg Asp Ile Ser Asn Glu Ser 690 695
700Gln Ile Ala Met Asn Asn Val Asp Ser Phe Leu Asn Ser Ala Ala Ile705
710 715 720Cys Val Phe Glu
Gly Asn Ile Tyr Ser Lys Phe Ile Ser Phe Met Glu 725
730 735Gln Cys Ile Asn Asn Ile Asn Lys Asn Thr
Arg Glu Phe Ile Gln Lys 740 745
750Cys Thr Asn Ile Thr Glu Asn Glu Lys Leu Gln Leu Ile Asn Gln Asn
755 760 765Ile Phe Ser Ser Leu Asp Phe
Asp Phe Leu Asn Ile Glu Asn Leu Lys 770 775
780Ser Leu Phe Ser Ser Glu Thr Ala Leu Leu Ile Lys Glu Glu Thr
Ser785 790 795 800Pro Tyr
Glu Leu Val Leu Tyr Ala Phe Gln Glu Pro Asp Asn Asn Ala
805 810 815Ile Gly Asp Ala Ser Ala Lys
Asn Thr Ser Ile Glu Tyr Ser Lys Asp 820 825
830Ile Asp Leu Val Tyr Gly Ile Asn Ser Asp Ala Leu Tyr Leu
Asn Gly 835 840 845Ser Asn Gln Ser
Ile Ser Phe Ser Asn Asp Phe Phe Glu Asn Gly Leu 850
855 860Thr Asn Ser Phe Ser Ile Tyr Phe Trp Leu Arg Asn
Leu Gly Lys Asp865 870 875
880Thr Ile Lys Tyr Lys Leu Ile Gly Ser Lys Glu Asp Asn Cys Gly Trp
885 890 895Glu Ile Tyr Phe Gln
Asp Thr Gly Leu Val Phe Asn Met Ile Asp Ser 900
905 910Asn Gly Asn Glu Lys Asn Ile Tyr Leu Ser Asp Val
Ser Asn Asn Ser 915 920 925Trp His
Tyr Ile Thr Ile Ser Val Asp Arg Leu Lys Glu Gln Leu Leu 930
935 940Ile Phe Ile Asp Asp Asn Leu Val Ala Asn Glu
Ser Ile Lys Glu Ile945 950 955
960Leu Asn Ile Tyr Ser Ser Asn Ile Ile Ser Leu Leu Ser Glu Asn Lys
965 970 975Pro Ser Tyr Ile
Glu Gly Leu Thr Ile Leu Asn Lys Pro Thr Thr Ser 980
985 990Gln Glu Val Leu Asn Asn Tyr Phe Lys Val Leu
Asn Asn Ser Tyr Ile 995 1000
1005Arg Asp Ser Asn Glu Glu Arg Leu Glu Tyr His Lys Thr Tyr Gln Leu
1010 1015 1020Asp Asn Tyr Val Phe Ser Asp
Lys Pro Ile Cys Glu Val Lys Gln Asn1025 1030
1035 1040Asn Asn Ile Tyr Leu Thr Ile Asn Asn Thr Asn Asn
Leu Asn Leu Gln 1045 1050
1055Pro Ser Lys Phe Lys Leu Leu Ser Ile Asn Ser Asn Lys Gln Tyr Val
1060 1065 1070Gln Lys Phe Asp Glu Val
Ile Ile Ser Ile Leu Gly Asn Met Glu Lys 1075 1080
1085Tyr Ile Asp Ile Ser Glu Asp Asn Arg Leu Gln Leu Ile Asp
Asn Lys 1090 1095 1100Asn Gly Ala Lys
Lys Met Ile Ile Ser Asn Asp Met Phe Ile Ser Asn1105 1110
1115 1120Cys Leu Thr Leu Ser Cys Gly Gly Lys
Tyr Ile Cys Leu Ser Met Lys 1125 1130
1135Asp Glu Asn His Asn Trp Met Ile Cys Asn Asn Asp Met Ser Lys
Tyr 1140 1145 1150Leu Tyr Leu
Trp Ser Phe Lys 1155311165PRTClostridium botulinum serotype F
31Met Lys Ile Asn Asp Asp Leu Asn Ile Asn Ser Pro Val Asp Asn Lys1
5 10 15Asn Val Val Ile Val Arg
Ala Arg Lys Thr Asn Ile Phe Phe Lys Ala 20 25
30Phe Gln Val Ala Pro Asn Ile Trp Val Ala Pro Glu Arg
Tyr Tyr Gly 35 40 45Glu Pro Leu
Asn Ile Ser Asp Gln Glu Lys Ser Asp Gly Gly Ile Tyr 50
55 60Asp Glu Asn Phe Leu Lys Glu Asn Ser Glu Lys Glu
Glu Phe Leu Gln65 70 75
80Ala Ile Ile Leu Leu Leu Lys Arg Ile Asn Asn Asn Ile Ile Gly Gln
85 90 95Lys Leu Leu Ser Leu Met
Cys Thr Ser Ile Pro Phe Leu His Glu Tyr 100
105 110Lys Gln Gly Asp Tyr Arg Gln Ser Asn Tyr Leu Gly
Ser Lys Asn Ser 115 120 125Glu Tyr
Leu Tyr Ser Ala Asn Ile Val Ile Phe Gly Pro Gly Ser Asn 130
135 140Ile Val Lys Asn Asn Thr Ile Tyr Tyr Lys Lys
Asn Phe Ala Glu Asn145 150 155
160Gly Met Gly Thr Met Ala Glu Ile Leu Phe Gln Pro Phe Leu Thr Tyr
165 170 175Lys Tyr Asn Gln
Phe Tyr Ala Asp Pro Ala Leu Glu Leu Ile Lys Cys 180
185 190Leu Ile Lys Ala Ile Tyr Phe Leu Tyr Gly Ile
Lys Pro Asn Asp Asn 195 200 205Leu
Asn Ile Pro Tyr Arg Leu Arg Asn Glu Phe Ser Asn Val Glu Tyr 210
215 220Ser Glu Leu Asn Ile Ile Asp Phe Leu Ile
Ser Gly Gly Ile Asp Tyr225 230 235
240Lys Phe Ile Asn Thr Asn Pro Tyr Trp Phe Ile Asp Asn Tyr Phe
Ile 245 250 255Asp Val Pro
Lys Val Phe Glu Lys His Lys Asn Asp Tyr Glu Ile Asn 260
265 270Ile Lys Asn Asn Ser Glu Ile Gly Thr Ser
Ile Lys Leu Tyr Leu Glu 275 280
285Gln Lys Phe Lys Thr Asn Val Gln Asp Ile Trp Glu Leu Asn Leu Ser 290
295 300Tyr Phe Ser Lys Glu Phe Gln Ile
Met Met Pro Glu Lys His Asn Asn305 310
315 320Ala Leu Lys His Tyr Tyr Arg Lys Glu Tyr Tyr Lys
Ile Asn Tyr Ser 325 330
335Lys Gln Tyr Asp Ile Asn Gly Phe Val Asn Gly Gln Ile Ala Thr Lys
340 345 350Leu Leu Leu Ser Glu Lys
Asn Gln Tyr Ile Ile Asn Lys Pro Gln Leu 355 360
365Ile Ile Asn Leu Ile Asn Lys Ser Asn Asn Ser Leu Leu Met
Lys Ser 370 375 380Asn Ile Tyr Gly Asp
Gly Leu Asn Gly Thr Thr Asp Asn Phe Tyr Arg385 390
395 400Asn Tyr Lys Ile Pro Asp Asn Ile Ala Tyr
Gln Tyr His Pro Asn Asn 405 410
415Thr Tyr Leu Asp Asn Val Asn Ile Glu Glu Ile Asn Asn Ile Pro Gln
420 425 430Ile Thr Asp Ala Asp
Ile Tyr Pro Tyr Thr Asn Asn Cys Asp Thr Phe 435
440 445Ile Pro Ile Tyr Asn Ile Thr Gln Ser Arg Glu Ile
Asn Thr Thr Val 450 455 460Pro Tyr Ser
Ile Asn Tyr Leu Gln Ser Gln Ile Met Asn Ser Asp Asp465
470 475 480Ile Thr Leu Ser Ser Asp Phe
Trp Glu Val Val Cys Ser Asn Asp Lys 485
490 495Ser Leu Val Tyr Ser Tyr Leu Asp Asn Val Ile Asn
Tyr Leu Asp Ser 500 505 510Ile
Lys Asn Asn Thr Pro Ile Asn Thr Asp Lys Lys Tyr Tyr Leu Trp 515
520 525Leu Lys Glu Ile Phe Arg Asn Tyr Ser
Phe Asp Ile Thr Ala Thr Glu 530 535
540Glu Ile Thr Thr Glu Cys Gly Ile Asn Lys Ile Val Ser Trp Phe Gly545
550 555 560Lys Ala Phe Asn
Ile Leu Asn Thr Asp Asn Ser Phe Lys Ile Glu Phe 565
570 575Gln Asn Ser Gly Ala Ile Ala Leu Ile Asn
Lys Lys Asp Asn Ile Ile 580 585
590Ile Pro Lys Ile Glu Ile Asp Glu Met Pro Asn Ser Met Leu Asn Leu
595 600 605Ser Phe Glu Asp Leu Asn Glu
Gln Leu Tyr Ser Ile Tyr Ser Lys Asn 610 615
620Ile Thr Tyr Phe Lys Lys Ile Tyr Tyr Asn Phe Leu Asp Gln Trp
Trp625 630 635 640Thr Glu
Tyr Tyr Ser Gln Tyr Phe Asp Leu Ile Cys Met Ala Lys Lys
645 650 655Ser Ile Leu Ala Gln Glu Asn
Leu Ile Lys Lys Ile Ile Gln Lys Lys 660 665
670Ile Ser Tyr Leu Ile Gly Ala Ser Asn Ile Pro Asp Asp Ile
Leu Ala 675 680 685Val Met Arg Leu
Thr Thr Thr Asn Thr Leu Arg Asp Ile Ser Val Glu 690
695 700Ser Gln Ile Ala Met Asn Asn Leu Asn Asn Phe Leu
Asn Lys Ala Ala705 710 715
720Met Cys Val Phe Gln Ser Asn Ile Tyr Pro Lys Phe Ile Ser Phe Met
725 730 735Glu Gln Cys Ile Lys
His Ile Asn Lys Ser Thr Lys Glu Phe Ile Gln 740
745 750Lys Cys Thr Asn Ile Asn Glu Thr Glu Lys Leu Gln
Leu Ile Met Gln 755 760 765Asn Ser
Phe Ser Asn Leu Asp Phe Asp Phe Leu Asp Ile Gln Asn Met 770
775 780Lys Asn Leu Phe Asn Ser Tyr Thr Glu Leu Leu
Ile Lys Glu Gln Thr785 790 795
800Ser Pro Tyr Glu Leu Ser Leu Tyr Ala Phe Glu Glu Gln Asp Asn Asn
805 810 815Val Ile Gly Asp
Ala Ser Gly Lys Asn Thr Leu Val Glu Tyr Pro Lys 820
825 830Gly Ile Glu Leu Val Tyr Gly Ile Asn Asn Ser
Ala Leu Tyr Leu Asn 835 840 845Gly
Ser Asn Gln Ser Ile Ile Phe Thr Asn Asp Tyr Phe Glu Asn Gly 850
855 860Leu Thr Asn Ser Phe Ser Ile Tyr Phe Trp
Leu Arg Asn Leu Gly Gln865 870 875
880Asp Thr Ile Lys Ser Lys Leu Ile Gly Ser Lys Glu Tyr Asn Cys
Gly 885 890 895Trp Glu Ile
Tyr Phe Gln Glu Ile Gly His Val Phe Asn Met Ile Asp 900
905 910Ser Asn Gly Asn Glu Lys Asn Ile Tyr Leu
Ser Asp Val Ser Asn Asn 915 920
925Ser Trp His Tyr Ile Thr Ile Ser Val Asp Arg Leu Lys Glu Gln Leu 930
935 940Leu Ile Phe Ile Asp Asp Asn Leu
Val Val Asn Glu Ser Ile Lys Asp945 950
955 960Ile Leu Asn Ile Tyr Ser Ser Asn Ile Ile Ser Leu
Leu Ser Asp Asn 965 970
975Lys Ala Ser Tyr Ile Glu Gly Leu Thr Ile Leu Asn Lys Pro Thr Thr
980 985 990Gly Glu Glu Val Leu Arg
Asn Tyr Phe Lys Asn Leu Asn Asn Ser Tyr 995 1000
1005Val Arg Asp Ser Asn Asp Glu Arg Leu Glu Tyr Asn Lys Thr
Tyr Gln 1010 1015 1020Leu Tyr Asp Tyr
Val Phe Pro Asp Asn Pro Ile Cys Glu Val Lys Gln1025 1030
1035 1040Asp Asn Asn Ile Tyr Leu Thr Ile Asn
Asn Ile Asn Asn Leu Asn Met 1045 1050
1055Lys Pro Cys Lys Phe Lys Leu Leu Ser Ile Asn Ser Asn Lys Gln
Tyr 1060 1065 1070Val Gln Lys
Trp Asp Glu Val Ile Ile Ser Val Leu Tyr Asp Thr Glu 1075
1080 1085Lys Tyr Val Cys Ile Ser Asn Glu Asn Asn Arg
Val Lys Ile Ile Asp 1090 1095 1100Asn
Lys Ile Met Gln Val Lys Phe Ile Ile Ser Asn Asp Ile Phe Ile1105
1110 1115 1120Ser Asn Cys Leu Thr His
Ala His Asn Asn Lys Tyr Ile Cys Leu Ser 1125
1130 1135Met Lys Asp Glu Asn Tyr Asn Trp Met Ile Cys Asn
Asn Glu Ser Asn 1140 1145
1150Ile Pro Lys Lys Ala Tyr Leu Trp Ile Leu Lys Glu Val 1155
1160 1165321198PRTClostridium botulinum serotype
G 32Met Lys Ile Asn Ser Asn Leu Thr Ile Asn Ser Pro Ile Asp Asn Lys1
5 10 15Asn Val Val Ile Val
Arg Ala Arg Glu Thr Ser Lys Phe Phe Lys Ala 20
25 30Phe Lys Val Ala Pro Asn Ile Trp Val Ala Pro Glu
Arg Tyr Tyr Gly 35 40 45Glu Ser
Leu Ser Ile Glu Glu Ser Lys Lys Val Asn Gly Gly Val Tyr 50
55 60Asp Ser Asn Phe Leu Ser Gln Asn Asn Glu Lys
Asp Lys Phe Leu Gln65 70 75
80Ala Ile Ile Thr Leu Leu Lys Arg Ile Asn Ser Asn Ile Ala Gly Glu
85 90 95Lys Leu Leu Ser Leu
Val Ser Thr Ala Ile Pro Phe Pro Tyr Gly Tyr 100
105 110Ile Gly Gly Gly Tyr Tyr Cys Pro Asn Ile Val Thr
Phe Gly Ser Thr 115 120 125Ile Lys
Tyr Asn Lys Lys Ile Asn Ser Leu Ile Ser Thr Thr Ile Pro 130
135 140Phe Pro Tyr Gly Gly Tyr Arg Glu Thr Asn Tyr
Leu Ser Ser Lys Asp145 150 155
160Thr Glu Asn Phe Tyr Ala Ala Asn Ile Val Ile Phe Gly Pro Gly Ala
165 170 175Asn Ile Val Glu
Asn Asn Thr Val Phe Tyr Lys Lys Glu Asp Ala Glu 180
185 190Asn Gly Met Gly Thr Met Ala Glu Ile Cys Phe
Gln Pro Phe Leu Thr 195 200 205Tyr
Lys Tyr Asp Gln Phe Tyr Val Asp Pro Ala Leu Glu Leu Met Glu 210
215 220Cys Leu Ile Lys Ser Leu Tyr Phe Leu Tyr
Gly Ile Lys Pro Asn Asn225 230 235
240Asn Leu Thr Val Pro Tyr Arg Leu Arg Asn Glu Leu Ser Asn Ile
Glu 245 250 255Phe Ser Gln
Leu Ser Ile Val Asp Leu Leu Ile Ser Gly Gly Ile Asp 260
265 270Ser Lys Phe Ile Asn Thr Asp Pro Tyr Trp
Phe Ile Asp Ser Tyr Phe 275 280
285Ser Asn Ala Lys Thr Thr Phe Glu Glu His Lys Ser Ile Tyr Glu Thr 290
295 300Glu Ile Lys Gly Asn Asn Ala Ile
Gly Asn Asp Ile Lys Leu Arg Leu305 310
315 320Lys Gln Lys Phe Gln Thr Thr Val His Asp Ile Trp
Gln Leu Asn Leu 325 330
335Asp Tyr Phe Ser Lys Glu Phe Gln Ile Met Met Pro Tyr Arg Phe Asn
340 345 350Asn Ala Leu Lys Tyr Tyr
Tyr Arg Lys Glu Tyr Tyr Lys Ile Asp Tyr 355 360
365Pro Glu Lys Tyr Ser Ile Ala Gly Phe Val Asp Gly Gln Leu
Asn Thr 370 375 380Gln Leu Ser Leu Ser
Asp Lys Asn Gln Tyr Ile Ile Asn Lys Pro Glu385 390
395 400Leu Ile Val Asn Leu Ile Ser Glu Asn Asn
Ile Ser Leu Met Arg Ser 405 410
415Asn Ile Tyr Gly Asp Gly Leu Lys Tyr Thr Thr Asp Asn Phe Tyr Ser
420 425 430Thr Tyr Lys Ile Pro
Tyr Asn Arg Ala Tyr Glu Tyr His Phe Asn Asn 435
440 445Ser Ser Thr Ser Ser Leu Glu Asn Val Asn Val Glu
Glu Ile Ser Asn 450 455 460Ile Pro Glu
Ile Ile Asp Ile Asn Pro Tyr Arg Glu Asn Ser Asp Ile465
470 475 480Phe Ser Pro Val Glu Asn Ile
Ile Glu Thr Lys Glu Val Asn Thr Lys 485
490 495Thr Pro Trp Pro Ile Asn Tyr Leu Gln Ala Gln Ile
Pro Asn Asn Glu 500 505 510Glu
Phe Thr Leu Ser Ser Asp Phe Ser Gln Val Val Ser Tyr Lys Thr 515
520 525Gln Ser Leu Val Tyr Ser Phe Leu Ser
Asn Val Ile Ser Tyr Leu Asp 530 535
540Ser Val Lys Asp Thr Asn Pro Ile Asp Thr Asp Glu Lys Tyr Tyr Leu545
550 555 560Trp Leu Arg Glu
Ile Phe Arg Asn Tyr Ser Phe Asp Ile Thr Ala Ile 565
570 575Glu Glu Ile Asn Thr Ser Cys Gly Ile Asn
Lys Val Val Ser Trp Phe 580 585
590Gly Lys Ala Leu Asn Ile Leu Asn Thr Ser Asn Ser Phe Val Lys Glu
595 600 605Phe Lys Asn Leu Gly Pro Ile
Ser Leu Ile Asn Lys Lys Glu Asn Leu 610 615
620Ser Met Pro Ile Ile Glu Val Asn Glu Ile Pro Asn Asp Met Leu
Gly625 630 635 640Leu Ser
Leu Lys Asp Leu Asn Glu Lys Leu Phe Asn Ile Tyr Leu Lys
645 650 655Asn Ile Leu Tyr Phe Lys Lys
Val Tyr Phe Ser Phe Leu Asp Gln Trp 660 665
670Trp Thr Glu Tyr Tyr Ser Gln Tyr Phe Gly Leu Ile Cys Met
Ala Lys 675 680 685Gln Ser Ile Leu
Ala Gln Glu Asn Leu Ile Lys Lys Ile Val Gln Lys 690
695 700Lys Leu Ser Asp Leu Ser Lys Gln Ser Asn Ile Ser
Asn Glu Lys Leu705 710 715
720Asn Leu Met Asn Leu Thr Thr Glu Lys Thr Phe Ile Asp Leu Ser Asn
725 730 735Gln Ser Gln Ile Ala
Met Asn Asn Ile Asn Asn Phe Leu Asn Lys Ala 740
745 750Ala Ile Cys Val Phe Glu Ser Asn Ile Tyr Pro Lys
Phe Ile Ser Phe 755 760 765Met Glu
Gln Tyr Ile Asn Asn Ile Asn Ile Lys Thr Thr Ala Phe Ile 770
775 780Arg Lys Cys Thr Asn Ile Thr Glu Lys Glu Lys
Leu Gln Leu Ile Asn785 790 795
800Gln Asn Thr Phe Asn Asn Leu Asp Phe Glu Phe Phe Asp Ile Gln Thr
805 810 815Ile Glu Asn Leu
Leu Thr Ser Glu Thr Asn Leu Ile Ile Lys Glu Lys 820
825 830Thr Ser Pro Tyr Asp Leu Leu Leu Phe Ser Leu
Gln Glu Ala Asp Arg 835 840 845Lys
Val Ile Lys Asp Ile Ser Gly Lys Asp Thr Leu Val Gln Tyr Ser 850
855 860Asp Thr Ile Asp Leu Ser Tyr Gly Val Asn
Gly Asp Ala Leu Tyr Leu865 870 875
880Lys Glu Pro Asn Gln Ser Val Asn Phe Ser Asn Asn Ile Phe Glu
Asn 885 890 895Gly Leu Thr
Asn Ser Phe Ser Ile Cys Phe Trp Leu Arg Asn Leu Gly 900
905 910Gln Asp Asn Leu Ser Ser Asn Leu Ile Gly
Asn Ile Val Asn Asn Cys 915 920
925Gly Trp Gln Ile Tyr Phe Glu Asn Asn Gly Leu Val Phe Ser Met Val 930
935 940Asp Cys Asn Gly Asn Glu Lys Asn
Ile Tyr Leu Ser Asp Val Leu Ser945 950
955 960Lys Tyr Trp Tyr Tyr Ile Ser Val Ser Val Asp Arg
Leu Arg Asn Lys 965 970
975Leu Leu Ile Phe Ile Asn Asp Lys Leu Ile Val Asn Glu Ser Ile Glu
980 985 990Gln Ile Leu Asn Ile Tyr
Ser Ser Asn Ile Ile Ser Leu Val Asn Glu 995 1000
1005Asn Asn Pro Ile Cys Ile Glu Glu Leu Ser Ile Leu Asn Lys
Ala Leu 1010 1015 1020Thr Ser Glu Glu
Val Leu Asn Ser Tyr Phe Thr Asn Leu Asn Asn Ser1025 1030
1035 1040Tyr Ile Arg Asp Ser Tyr Gly Ala Arg
Leu Glu Tyr Asn Lys Asn Tyr 1045 1050
1055Glu Leu Tyr Asn Tyr Val Phe Pro Glu Asn Ser Leu Tyr Glu Val
Ile 1060 1065 1070Glu Asn Asn
Asn Met Tyr Leu Ser Ile Lys Asn Ile Lys Asn Thr Asn 1075
1080 1085Ile Leu Gly Ala Lys Phe Lys Leu Ile Asn Thr
Asp Glu Ser Lys Gln 1090 1095 1100Tyr
Val Gln Lys Trp Asp Glu Val Ile Ile Cys Val Leu Gly Asp Thr1105
1110 1115 1120Glu Lys Tyr Ala Asp Ile
Gln Ala Gly Asn Asn Arg Ile Gln Leu Val 1125
1130 1135Asn Ser Lys Asp Asn Ala Arg Lys Ile Ile Val Asn
Asn Asn Ile Phe 1140 1145
1150Arg Pro Asn Cys Val Leu Phe Ser Tyr Asn Asn Lys Tyr Leu Ser Leu
1155 1160 1165Ser Leu Arg Asn Arg Asn Tyr
Asn Trp Met Ile Cys Asn Asp Asn Ser 1170 1175
1180Phe Ile Pro Lys His Ala His Leu Trp Ile Leu Lys Lys Ile1185
1190 119533155PRTHomo sapiens 33Met Ala Glu Gly
Glu Ile Thr Thr Phe Thr Ala Leu Thr Glu Lys Phe1 5
10 15Asn Leu Pro Pro Gly Asn Tyr Lys Lys Pro
Lys Leu Leu Tyr Cys Ser 20 25
30Asn Gly Gly His Phe Leu Arg Ile Leu Pro Asp Gly Thr Val Asp Gly
35 40 45Thr Arg Asp Arg Ser Asp Gln His
Ile Gln Leu Gln Leu Ser Ala Glu 50 55
60Ser Val Gly Glu Val Tyr Ile Lys Ser Thr Glu Thr Gly Gln Tyr Leu65
70 75 80Ala Met Asp Thr Asp
Gly Leu Leu Tyr Gly Ser Gln Thr Pro Asn Glu 85
90 95Glu Cys Leu Phe Leu Glu Arg Leu Glu Glu Asn
His Tyr Asn Thr Tyr 100 105
110Ile Ser Lys Lys His Ala Glu Lys Asn Trp Phe Val Gly Leu Lys Lys
115 120 125Asn Gly Ser Cys Lys Arg Gly
Pro Arg Thr His Tyr Gly Gln Lys Ala 130 135
140Ile Leu Phe Leu Pro Leu Pro Val Ser Ser Asp145
150 15534155PRTHomo sapiens 34Met Ala Ala Gly Ser Ile Thr
Thr Leu Pro Ala Leu Pro Glu Asp Gly1 5 10
15Gly Ser Gly Ala Phe Pro Pro Gly His Phe Lys Asp Pro
Lys Arg Leu 20 25 30Tyr Cys
Lys Asn Gly Gly Phe Phe Leu Arg Ile His Pro Asp Gly Arg 35
40 45Val Asp Gly Val Arg Glu Lys Ser Asp Pro
His Ile Lys Leu Gln Leu 50 55 60Gln
Ala Glu Glu Arg Gly Val Val Ser Ile Lys Gly Val Cys Ala Asn65
70 75 80Arg Tyr Leu Ala Met Lys
Glu Asp Gly Arg Leu Leu Ala Ser Lys Cys 85
90 95Val Thr Asp Glu Cys Phe Phe Phe Glu Arg Leu Glu
Ser Asn Asn Tyr 100 105 110Asn
Thr Tyr Arg Ser Arg Lys Tyr Thr Ser Trp Tyr Val Ala Leu Lys 115
120 125Arg Thr Gly Gln Tyr Lys Leu Gly Ser
Lys Thr Gly Pro Gly Gln Lys 130 135
140Ala Ile Leu Phe Leu Pro Met Ser Ala Lys Ser145 150
15535206PRTHomo sapiens 35Met Ser Gly Pro Gly Thr Ala Ala Val
Ala Leu Leu Pro Ala Val Leu1 5 10
15Leu Ala Leu Leu Ala Pro Trp Ala Gly Arg Gly Gly Ala Ala Ala
Pro 20 25 30Thr Ala Pro Asn
Gly Thr Leu Glu Ala Glu Leu Glu Arg Arg Trp Glu 35
40 45Ser Leu Val Ala Leu Ser Leu Ala Arg Leu Pro Val
Ala Ala Gln Pro 50 55 60Lys Glu Ala
Ala Val Gln Ser Gly Ala Gly Asp Tyr Leu Leu Gly Ile65 70
75 80Lys Arg Leu Arg Arg Leu Tyr Cys
Asn Val Gly Ile Gly Phe His Leu 85 90
95Gln Ala Leu Pro Asp Gly Arg Ile Gly Gly Ala His Ala Asp
Thr Arg 100 105 110Asp Ser Leu
Leu Glu Leu Ser Pro Val Glu Arg Gly Val Val Ser Ile 115
120 125Phe Gly Val Ala Ser Arg Phe Phe Val Ala Met
Ser Ser Lys Gly Lys 130 135 140Leu Tyr
Gly Ser Pro Phe Phe Thr Asp Glu Cys Thr Phe Lys Glu Ile145
150 155 160Leu Leu Pro Asn Asn Tyr Asn
Ala Tyr Glu Ser Tyr Lys Tyr Pro Gly 165
170 175Met Phe Ile Ala Leu Ser Lys Asn Gly Lys Thr Lys
Lys Gly Asn Arg 180 185 190Val
Ser Pro Thr Met Lys Val Thr His Phe Leu Pro Arg Leu 195
200 20536204PRTHomo sapiens 36Met Gly Ser Pro Arg
Ser Ala Leu Ser Cys Leu Leu Leu His Leu Leu1 5
10 15Val Leu Cys Leu Gln Ala Gln His Val Arg Glu
Gln Ser Leu Val Thr 20 25
30Asp Gln Leu Ser Arg Arg Leu Ile Arg Thr Tyr Gln Leu Tyr Ser Arg
35 40 45Thr Ser Gly Lys His Val Gln Val
Leu Ala Asn Lys Arg Ile Asn Ala 50 55
60Met Ala Glu Asp Gly Asp Pro Phe Ala Lys Leu Ile Val Glu Thr Asp65
70 75 80Thr Phe Gly Ser Arg
Val Arg Val Arg Gly Ala Glu Thr Gly Leu Tyr 85
90 95Ile Cys Met Asn Lys Lys Gly Lys Leu Ile Ala
Lys Ser Asn Gly Lys 100 105
110Gly Lys Asp Cys Val Phe Thr Glu Ile Val Leu Glu Asn Asn Tyr Thr
115 120 125Ala Leu Gln Asn Ala Lys Tyr
Glu Gly Trp Tyr Met Ala Phe Thr Arg 130 135
140Lys Gly Arg Pro Arg Lys Gly Ser Lys Thr Arg Gln His Gln Arg
Glu145 150 155 160Val His
Phe Met Lys Arg Leu Pro Arg Gly His His Thr Thr Glu Gln
165 170 175Ser Leu Arg Phe Glu Phe Leu
Asn Tyr Pro Pro Phe Thr Arg Ser Leu 180 185
190Arg Gly Ser Gln Arg Thr Trp Ala Pro Glu Pro Arg
195 20037208PRTHomo sapiens 37Met Ala Pro Leu Gly Glu Val
Gly Asn Tyr Phe Gly Val Gln Asp Ala1 5 10
15Val Pro Phe Gly Asn Val Pro Val Leu Pro Val Asp Ser
Pro Val Leu 20 25 30Leu Ser
Asp His Leu Gly Gln Ser Glu Ala Gly Gly Leu Pro Arg Gly 35
40 45Pro Ala Val Thr Asp Leu Asp His Leu Lys
Gly Ile Leu Arg Arg Arg 50 55 60Gln
Leu Tyr Cys Arg Thr Gly Phe His Leu Glu Ile Phe Pro Asn Gly65
70 75 80Thr Ile Gln Gly Thr Arg
Lys Asp His Ser Arg Phe Gly Ile Leu Glu 85
90 95Phe Ile Ser Ile Ala Val Gly Leu Val Ser Ile Arg
Gly Val Asp Ser 100 105 110Gly
Leu Tyr Leu Gly Met Asn Glu Lys Gly Glu Leu Tyr Gly Ser Glu 115
120 125Lys Leu Thr Gln Glu Cys Val Phe Arg
Glu Gln Phe Glu Glu Asn Trp 130 135
140Tyr Asn Thr Tyr Ser Ser Asn Leu Tyr Lys His Val Asp Thr Gly Arg145
150 155 160Arg Tyr Tyr Val
Ala Leu Asn Lys Asp Gly Thr Pro Arg Glu Gly Thr 165
170 175Arg Thr Lys Arg His Gln Lys Phe Thr His
Phe Leu Pro Arg Pro Val 180 185
190Asp Pro Asp Lys Val Pro Glu Leu Tyr Lys Asp Ile Leu Ser Gln Ser
195 200 20538216PRTHomo sapiens 38Met
Gly Ala Ala Arg Leu Leu Pro Asn Leu Thr Leu Cys Leu Gln Leu1
5 10 15Leu Ile Leu Cys Cys Gln Thr
Gln Gly Glu Asn His Pro Ser Pro Asn 20 25
30Phe Asn Gln Tyr Val Arg Asp Gln Gly Ala Met Thr Asp Gln
Leu Ser 35 40 45Arg Arg Gln Ile
Arg Glu Tyr Gln Leu Tyr Ser Arg Thr Ser Gly Lys 50 55
60His Val Gln Val Thr Gly Arg Arg Ile Ser Ala Thr Ala
Glu Asp Gly65 70 75
80Asn Lys Phe Ala Lys Leu Ile Val Glu Thr Asp Thr Phe Gly Ser Arg
85 90 95Val Arg Ile Lys Gly Ala
Glu Ser Glu Lys Tyr Ile Cys Met Asn Lys 100
105 110Arg Gly Lys Leu Ile Gly Lys Pro Ser Gly Lys Ser
Lys Asp Cys Val 115 120 125Phe Thr
Glu Ile Val Leu Glu Asn Asn Tyr Thr Ala Phe Gln Asn Ala 130
135 140Arg His Glu Gly Trp Phe Met Ala Phe Thr Arg
Gln Gly Arg Pro Arg145 150 155
160Gln Ala Ser Arg Ser Arg Gln Asn Gln Arg Glu Ala His Phe Ile Lys
165 170 175Arg Leu Tyr Gln
Gly Gln Leu Pro Phe Pro Asn His Ala Glu Lys Gln 180
185 190Lys Gln Phe Glu Phe Val Gly Ser Ala Pro Thr
Arg Arg Thr Lys Arg 195 200 205Thr
Arg Arg Pro Gln Pro Leu Thr 210 21539207PRTHomo
sapiens 39Met Tyr Ser Ala Pro Ser Ala Cys Thr Cys Leu Cys Leu His Phe
Leu1 5 10 15Leu Leu Cys
Phe Gln Val Gln Val Leu Val Ala Glu Glu Asn Val Asp 20
25 30Phe Arg Ile His Val Glu Asn Gln Thr Arg
Ala Arg Asp Asp Val Ser 35 40
45Arg Lys Gln Leu Arg Leu Tyr Gln Leu Tyr Ser Arg Thr Ser Gly Lys 50
55 60His Ile Gln Val Leu Gly Arg Arg Ile
Ser Ala Arg Gly Glu Asp Gly65 70 75
80Asp Lys Tyr Ala Gln Leu Leu Val Glu Thr Asp Thr Phe Gly
Ser Gln 85 90 95Val Arg
Ile Lys Gly Lys Glu Thr Glu Phe Tyr Leu Cys Met Asn Arg 100
105 110Lys Gly Lys Leu Val Gly Lys Pro Asp
Gly Thr Ser Lys Glu Cys Val 115 120
125Phe Ile Glu Lys Val Leu Glu Asn Asn Tyr Thr Ala Leu Met Ser Ala
130 135 140Lys Tyr Ser Gly Trp Tyr Val
Gly Phe Thr Lys Lys Gly Arg Pro Arg145 150
155 160Lys Gly Pro Lys Thr Arg Glu Asn Gln Gln Asp Val
His Phe Met Lys 165 170
175Arg Tyr Pro Lys Gly Gln Pro Glu Leu Gln Lys Pro Phe Lys Tyr Thr
180 185 190Thr Val Thr Lys Arg Ser
Arg Arg Ile Arg Pro Thr His Pro Ala 195 200
205405PRTArtificial SequenceSITE(1)...(5)Bovine enterokinase
cleavage site 40Asp Asp Asp Asp Lys1 5417PRTArtificial
SequenceSITE(1)...(7)Tobacco Etch Virus cleavage site 41Glu Asn Leu Tyr
Phe Gln Gly1 5427PRTArtificial SequenceSITE(1)...(7)Tobacco
Etch Virus cleavage site 42Glu Asn Leu Tyr Phe Gln Ser1
5437PRTArtificial SequenceSITE(1)...(7)Tobacco Etch Virus cleavage site
43Glu Asn Ile Tyr Thr Gln Gly1 5447PRTArtificial
SequenceSITE(1)...(7)Tobacco Etch Virus cleavage site 44Glu Asn Ile Tyr
Thr Gln Ser1 5457PRTArtificial SequenceSITE(1)...(7)Tobacco
Etch Virus cleavage site 45Glu Asn Ile Tyr Leu Gln Gly1
5467PRTArtificial SequenceSITE(1)...(7)Tobacco Etch Virus cleavage site
46Glu Asn Ile Tyr Leu Gln Ser1 5477PRTArtificial
SequenceSITE(1)...(7)Tobacco Etch Virus cleavage site 47Glu Asn Val Tyr
Phe Gln Gly1 5487PRTArtificial SequenceSITE(1)...(7)Tobacco
Etch Virus cleavage site 48Glu Asn Val Tyr Ser Gln Ser1
5497PRTArtificial SequenceSITE(1)...(7)Tobacco Etch Virus cleavage site
49Glu Asn Val Tyr Ser Gln Gly1 5507PRTArtificial
SequenceSITE(1)...(7)Tobacco Etch Virus cleavage site 50Glu Asn Val Tyr
Ser Gln Ser1 5517PRTArtificial SequenceSITE(1)...(7)Human
Rhinovirus 3C cleavage site 51Glu Ala Leu Phe Gln Gly Pro1
5527PRTArtificial SequenceSITE(1)...(7)Human Rhinovirus 3C cleavage site
52Glu Val Leu Phe Gln Gly Pro1 5537PRTArtificial
SequenceSITE(1)...(7)Human Rhinovirus 3C cleavage site 53Glu Leu Leu Phe
Gln Gly Pro1 5547PRTArtificial SequenceSITE(1)...(7)Human
Rhinovirus 3C cleavage site 54Asp Ala Leu Phe Gln Gly Pro1
5557PRTArtificial SequenceSITE(1)...(7)Human Rhinovirus 3C cleavage site
55Asp Val Leu Phe Gln Gly Pro1 5567PRTArtificial
SequenceSITE(1)...(7)Human Rhinovirus 3C cleavage site 56Asp Leu Leu Phe
Gln Gly Pro1 55798PRTArtificial
SequenceSITE(1)...(98)SUMO/ULP-1 cleavage site 57Met Ala Asp Ser Glu Val
Asn Gln Glu Ala Lys Pro Glu Val Lys Pro1 5
10 15Glu Val Lys Pro Glu Thr His Ile Asn Leu Lys Val
Ser Asp Gly Ser 20 25 30Ser
Glu Ile Phe Phe Lys Ile Lys Lys Thr Thr Pro Leu Arg Arg Leu 35
40 45Met Glu Ala Phe Ala Lys Arg Gln Gly
Lys Glu Met Asp Ser Leu Arg 50 55
60Phe Leu Tyr Asp Gly Ile Arg Ile Gln Ala Asp Gln Thr Pro Glu Asp65
70 75 80Leu Asp Met Glu Asp
Asn Asp Ile Ile Glu Ala His Arg Glu Gln Ile 85
90 95Gly Gly584PRTArtificial
SequenceSITE(1)...(4)Thrombin cleavage site 58Gly Val Arg
Gly1594PRTArtificial SequenceSITE(1)...(4)Thrombin cleavage site 59Ser
Ala Arg Gly1604PRTArtificial SequenceSITE(1)...(4)Thrombin cleavage site
60Ser Leu Arg Gly1614PRTArtificial SequenceSITE(1)...(4)Thrombin cleavage
site 61Asp Gly Arg Ile1624PRTArtificial SequenceSITE(1)...(4)Thrombin
cleavage site 62Gln Gly Lys Ile1636PRTArtificial
SequenceSITE(1)...(6)Thrombin cleavage site 63Leu Val Pro Arg Gly Ser1
5646PRTArtificial SequenceSITE(1)...(6)Thrombin cleavage site
64Leu Val Pro Lys Gly Ser1 5656PRTArtificial
SequenceSITE(1)...(6)Thrombin cleavage site 65Phe Ile Pro Arg Thr Phe1
5666PRTArtificial SequenceSITE(1)...(6)Thrombin cleavage site
66Val Leu Pro Arg Ser Phe1 5676PRTArtificial
SequenceSITE(1)...(6)Thrombin cleavage site 67Ile Val Pro Arg Ser Phe1
5686PRTArtificial SequenceSITE(1)...(6)Thrombin cleavage site
68Ile Val Pro Arg Gly Tyr1 5696PRTArtificial
SequenceSITE(1)...(6)Thrombin cleavage site 69Val Val Pro Arg Gly Val1
5706PRTArtificial SequenceSITE(1)...(6)Thrombin cleavage site
70Val Leu Pro Arg Leu Ile1 5716PRTArtificial
SequenceSITE(1)...(6)Thrombin cleavage site 71Val Met Pro Arg Ser Leu1
5726PRTArtificial SequenceSITE(1)...(6)Thrombin cleavage site
72Met Phe Pro Arg Ser Leu1 5734PRTArtificial
SequenceSITE(1)...(4)Coagulation Factor Xa cleavage site 73Ile Asp Gly
Arg1744PRTArtificial SequenceSITE(1)...(4)Coagulation Factor Xa cleavage
site 74Ile Glu Gly Arg1755PRTArtificial SequenceDOMAIN(1)...(5)Flexible
spacer 75Gly Gly Gly Gly Ser1 5765PRTArtificial
SequenceDOMAIN(1)...(5)Flexible spacer 76Glu Ala Ala Ala Lys1
5778PRTArtificial SequencePEPTIDE(1)...(8)FLAG epitope-binding region
77Asp Tyr Lys Asp Asp Asp Asp Lys1 5789PRTArtificial
SequencePEPTIDE(1)...(9)Human Influenza virus hemagluttinin (HA)
epitope-binding region 78Tyr Pro Tyr Asp Val Pro Asp Tyr Ala1
57910PRTArtificial SequencePEPTIDE(1)...(10)Human p62 c-Myc
epitope-binding region 79Glu Gln Lys Leu Ile Ser Glu Glu Asp Leu1
5 108011PRTArtificial
SequencePEPTIDE(1)...(11)Vesicular Stomatitis Virus Glycoprotein (VSV-G)
epitope-binding region 80Tyr Thr Asp Ile Glu Met Asn Arg Leu Gly Lys1
5 10816PRTArtificial
SequencePEPTIDE(1)...(6)Substance P epitope-binding region 81Gln Phe Phe
Gly Leu Met1 58211PRTArtificial
SequencePEPTIDE(1)...(11)Glycoprotein-D precursor of Herpes simplex
virus epitope-binding region 82Gln Pro Glu Leu Ala Pro Glu Asp Pro Glu
Asp1 5 108314PRTArtificial
SequencePEPTIDE(1)...(14)V5 epitope-binding region 83Gly Lys Pro Ile Pro
Asn Pro Leu Leu Gly Leu Asp Ser Thr1 5
10846PRTArtificial SequencePEPTIDE(1)...(6)AU1 epitope-binding region
84Asp Thr Tyr Arg Tyr Ile1 5856PRTArtificial
SequencePEPTIDE(1)...(6)AU5 epitope-binding region 85Thr Asp Phe Tyr Leu
Lys1 5866PRTArtificial SequencePEPTIDE(1)...(6)HIS
epitope-binding region 86His His His His His His1
58723PRTInfluenza A virus 87Gly Leu Phe Gly Ala Ile Ala Gly Phe Ile Glu
Asn Gly Trp Glu Gly1 5 10
15Met Ile Asp Gly Trp Tyr Gly 208823PRTInfluenza A virus
88Gly Ile Phe Gly Ala Ile Ala Gly Phe Ile Glu Asn Gly Trp Glu Gly1
5 10 15Met Ile Asp Gly Trp Tyr
Gly 208923PRTInfluenza A virus 89Gly Leu Phe Gly Ala Ile Ala
Gly Phe Ile Glu Asn Gly Trp Glu Gly1 5 10
15Met Val Asp Gly Trp Tyr Gly
209023PRTInfluenza A virus 90Gly Ile Phe Gly Ala Ile Ala Gly Phe Ile Glu
Asn Gly Trp Glu Gly1 5 10
15Met Val Asp Gly Trp Tyr Gly 209123PRTInfluenza A virus
91Gly Leu Phe Gly Ala Ile Ala Gly Phe Ile Glu Asn Gly Trp Glu Gly1
5 10 15Leu Ile Asp Gly Trp Tyr
Gly 209226PRTSemliki Forest virus 92Asp Tyr Gln Cys Lys Val
Tyr Thr Gly Val Tyr Pro Phe Met Trp Gly1 5
10 15Gly Ala Tyr Cys Phe Cys Asp Ser Glu Asn
20 259326PRTGetah virus 93Asp Tyr Gln Cys Gln Val Tyr
Thr Gly Val Tyr Pro Phe Met Trp Gly1 5 10
15Gly Ala Tyr Cys Phe Cys Asp Thr Glu Asn 20
259426PRTEastern equine encephalitis virus 94Asp Tyr Gln
Cys Gln Val Phe Thr Gly Val Tyr Pro Phe Met Trp Gly1 5
10 15Gly Ala Tyr Cys Phe Cys Asp Thr Glu
Asn 20 259526PRTEastern equine encephalitis
virus 95Asp Tyr Gln Cys Gln Val Phe Ser Gly Val Tyr Pro Phe Met Trp Gly1
5 10 15Gly Ala Tyr Cys
Phe Cys Asp Thr Glu Asn 20 259626PRTEastern
equine encephalitis virus 96Asp Tyr Gln Cys Gln Val Phe Thr Gly Ser Tyr
Pro Phe Met Trp Gly1 5 10
15Gly Ala Tyr Cys Phe Cys Asp Thr Glu Asn 20
259726PRTEastern equine encephalitis virus 97Asp Tyr Gln Cys Gln Val Phe
Thr Gly Val Tyr Pro Phe Met Trp Gly1 5 10
15Gly Ala Tyr Cys Phe Cys Asp Thr Glu Asp 20
259826PRTEastern equine encephalitis virus 98Asp Tyr Gln
Cys Gln Val Phe Ala Gly Val Tyr Pro Phe Met Trp Gly1 5
10 15Gly Ala Tyr Cys Phe Cys Asp Thr Glu
Asn 20 259926PRTEastern equine encephalitis
virus 99Asp Tyr Gln Cys Gln Val Phe Ala Gly Ile Tyr Pro Phe Met Trp Gly1
5 10 15Gly Ala Tyr Cys
Phe Cys Asp Thr Glu Asn 20
2510026PRTChikungunya virus 100Asp Tyr Ser Cys Lys Val Phe Thr Gly Val
Tyr Pro Phe Met Trp Gly1 5 10
15Gly Ala Tyr Cys Phe Cys Asp Thr Glu Asn 20
2510126PRTO'nyong-nyong virus 101Asp Tyr Asn Cys Lys Val Phe Thr Gly
Val Tyr Pro Phe Met Trp Gly1 5 10
15Gly Ala Tyr Cys Phe Cys Asp Ala Glu Asn 20
2510226PRTVenezuelan equine encephalitis virus 102Asp Glu Gln Cys
Lys Val Phe Thr Gly Val Tyr Pro Phe Met Trp Gly1 5
10 15Gly Ala Tyr Cys Phe Cys Asp Ser Glu Asn
20 2510326PRTVenezuelan equine encephalitis
virus 103Asp Glu Gln Cys Lys Val Phe Thr Gly Val Tyr Pro Phe Met Trp Gly1
5 10 15Gly Ala Tyr Cys
Phe Cys Asp Ala Glu Asn 20
2510426PRTVenezuelan equine encephalitis virus 104Asp Glu Gln Cys Gln Val
Phe Thr Gly Val Tyr Pro Phe Met Trp Gly1 5
10 15Gly Ala Tyr Cys Phe Cys Asp Ser Glu Asn
20 2510526PRTVenezuelan equine encephalitis virus 105Asp
Glu Gln Cys Lys Val Phe Thr Gly Val Tyr Pro Phe Met Trp Gly1
5 10 15Gly Ala Tyr Cys Phe Cys Asp
Thr Glu Asn 20 2510626PRTVenezuelan equine
encephalitis virus 106Asp Glu Gln Cys Lys Val Phe Ser Gly Val Tyr Pro Phe
Met Trp Gly1 5 10 15Gly
Ala Tyr Cys Phe Cys Asp Thr Glu Asn 20
2510726PRTVenezuelan equine encephalitis virus 107Asp Glu Lys Cys Lys Val
Phe Thr Gly Val Tyr Pro Phe Met Trp Gly1 5
10 15Gly Ala Tyr Cys Phe Cys Asp Thr Glu Asn
20 2510826PRTVenezuelan equine encephalitis virus 108Asp
Glu His Cys Lys Val Phe Thr Gly Val Tyr Pro Phe Met Trp Gly1
5 10 15Gly Ala Tyr Cys Phe Cys Asp
Thr Glu Asn 20 2510926PRTVenezuelan equine
encephalitis virus 109Asp Glu Gln Cys Lys Val Phe Ala Gly Val Tyr Pro Phe
Met Trp Gly1 5 10 15Gly
Ala Tyr Cys Phe Cys Asp Thr Glu Asn 20
2511026PRTUna virus 110Asp Tyr Arg Cys Gln Thr Tyr Thr Gly Val Tyr Pro
Phe Leu Trp Gly1 5 10
15Gly Ala Tyr Cys Phe Cys Asp Thr Glu Asn 20
2511126PRTMayaro virus 111Glu Tyr Lys Cys Ala Val Phe Thr Gly Val Tyr Pro
Phe Met Trp Gly1 5 10
15Gly Ala Tyr Cys Phe Cys Asp Ser Glu Asn 20
2511226PRTBarmah Forest virus 112Asp Tyr Lys Cys Ser Val Phe Thr Gly Val
Tyr Pro Phe Met Trp Gly1 5 10
15Gly Ala Tyr Cys Phe Cys Asp Thr Glu Asn 20
2511326PRTAura virus 113Asp Tyr Thr Cys Lys Val Phe Thr Gly Val Tyr
Pro Phe Leu Trp Gly1 5 10
15Gly Ala Gln Cys Phe Cys Asp Ser Glu Asn 20
2511426PRTNdumu virus 114Asp Tyr Gln Cys Arg Val Asp Ser Gly Val Tyr Pro
Tyr Met Trp Gly1 5 10
15Gly Ala Tyr Cys Phe Cys Ser Ser Glu Asn 20
2511526PRTHighlands J virus 115Asp Tyr Thr Cys Arg Val Phe Gly Gly Val
Tyr Pro Phe Met Trp Gly1 5 10
15Gly Ala Gln Cys Phe Cys Asp Ser Glu Asn 20
2511626PRTFort Morgan virus 116Asp Tyr Ala Cys Arg Val Phe Gly Gly
Val Tyr Pro Phe Met Trp Gly1 5 10
15Gly Ala Gln Cys Phe Cys Asp Thr Glu Asn 20
2511726PRTSindbis virus 117Asp Tyr Asn Cys Lys Val Phe Gly Gly
Val Tyr Pro Phe Met Trp Gly1 5 10
15Gly Ala Gln Cys Phe Cys Asp Ser Glu Asn 20
2511826PRTSindbis virus 118Asp Tyr Thr Cys Lys Val Phe Gly Gly
Val Tyr Pro Phe Met Trp Gly1 5 10
15Gly Ala Gln Cys Phe Cys Asp Ser Glu Asn 20
2511921PRTVesicular stomatitis virus 119Val Ser Phe Asn Pro Gly
Phe Pro Pro Gln Ser Cys Gly Tyr Gly Thr1 5
10 15Val Thr Asp Ala Glu 2012021PRTVesicular
stomatitis virus 120Val Ser Phe Asn Pro Gly Phe Pro Pro Gln Ser Cys Gly
Tyr Gly Ser1 5 10 15Val
Thr Asp Ala Glu 2012121PRTVesicular stomatitis virus 121Val
Gly Phe Asn Pro Gly Phe Pro Pro Gln Ser Cys Gly Tyr Gly Thr1
5 10 15Val Thr Asp Ala Glu
2012221PRTVesicular stomatitis virus 122Ile Ser Phe Asn Pro Gly Phe Pro
Pro Gln Ser Cys Gly Tyr Gly Ser1 5 10
15Val Thr Asp Ala Glu 2012321PRTVesicular
stomatitis virus 123Ile Ser Leu Asn Pro Gly Phe Pro Pro Gln Ser Cys Gly
Tyr Gly Ser1 5 10 15Val
Thr Asp Ala Glu 2012421PRTVesicular stomatitis virus 124Thr
Trp Leu Asn Pro Gly Phe Pro Pro Gln Ser Cys Gly Tyr Ala Thr1
5 10 15Val Thr Asp Ala Glu
2012521PRTVesicular stomatitis virus 125Ile Trp Ile Asn Pro Gly Phe Pro
Pro Gln Ser Cys Gly Tyr Ala Thr1 5 10
15Val Thr Asp Ala Glu 2012621PRTPiry virus 126Ser
Leu Ile Asn Leu Gly Phe Pro Pro Glu Ser Cys Gly Tyr Ala Thr1
5 10 15Val Thr Asp Ser Glu
2012721PRTIsfahan virus 127Thr Leu Met Tyr Pro Gly Phe Pro Pro Glu Ser
Cys Gly Tyr Ala Ser1 5 10
15Ile Thr Asp Ser Glu 2012821PRTChandipura virus 128Thr Leu
Val Ser Pro Gly Phe Pro Pro Glu Ser Cys Gly Tyr Ala Ser1 5
10 15Val Thr Asp Ser Glu
2012921PRTCocal virus 129Thr Trp Met Ser Pro Gly Phe Pro Pro Gln Asn Cys
Gly Tyr Ala Thr1 5 10
15Val Thr Asp Ser Val 2013025PRTSendai virus 130Phe Phe Gly
Ala Val Ile Gly Thr Ile Ala Leu Gly Val Ala Thr Ser1 5
10 15Ala Gln Ile Thr Ala Gly Ile Ala Leu
20 2513125PRTSendai virus 131Phe Phe Gly Ala Val
Ile Gly Thr Ile Ala Leu Gly Val Ala Thr Ser1 5
10 15Ala Gln Ile Thr Thr Gly Ile Ala Leu
20 2513225PRTHuman parainfluenza virus 1 132Phe Phe Gly
Ala Val Ile Gly Thr Ile Ala Leu Gly Val Ala Thr Ala1 5
10 15Ala Gln Ile Thr Ala Gly Ile Ala Leu
20 2513325PRTHuman parainfluenza virus 3 133Phe
Phe Gly Gly Val Ile Gly Thr Ile Ala Leu Gly Val Ala Thr Ser1
5 10 15Ala Gln Ile Thr Ala Ala Val
Ala Leu 20 2513425PRTBeilong virus 134Phe Trp
Gly Ala Ile Ile Gly Gly Val Ala Leu Gly Val Ala Thr Ser1 5
10 15Ala Gln Ile Thr Ala Gly Val Ala
Leu 20 2513525PRTMurayama virus 135Phe Val
Gly Ala Ile Ile Gly Thr Val Ala Leu Gly Val Ala Thr Ser1 5
10 15Ala Gln Ile Thr Ala Ala Val Ala
Leu 20 2513625PRTMossman virus 136Phe Phe Gly
Ala Val Ile Ala Gly Val Ala Leu Gly Val Ala Thr Ala1 5
10 15Ala Gln Val Thr Ala Gly Val Ala Leu
20 2513725PRTCanine distemper virus 137Phe Ala
Gly Val Val Leu Ala Gly Val Ala Leu Gly Val Ala Thr Ala1 5
10 15Ala Gln Ile Thr Ala Gly Ile Ala
Leu 20 2513825PRTCanine distemper virus
138Phe Ala Gly Val Val Leu Ala Gly Ala Ala Leu Gly Val Ala Thr Ala1
5 10 15Ala Gln Ile Thr Ala Gly
Ile Ala Leu 20
2513925PRTPeste-des-petits-ruminants virus 139Phe Val Gly Ala Val Leu Ala
Gly Val Ala Leu Gly Val Ala Thr Ala1 5 10
15Ala Gln Ile Thr Ala Gly Val Ala Leu 20
2514025PRTPeste-des-petits-ruminants virus 140Phe Ala Gly Ala
Val Leu Ala Gly Val Ala Leu Gly Val Ala Thr Ala1 5
10 15Ala Gln Ile Thr Ala Gly Val Ala Leu
20 2514125PRTPeste-des-petits-ruminants virus 141Phe
Ala Gly Ala Val Leu Ala Gly Val Ala Leu Gly Val Ala Thr Arg1
5 10 15Ala Gln Ile Thr Ala Gly Val
Ala Leu 20 2514225PRTAvian paramyxovirus 2
142Phe Val Gly Ala Ile Ile Gly Ser Val Ala Leu Gly Val Ala Thr Ala1
5 10 15Ala Gln Ile Thr Ala Ala
Val Ala Leu 20 2514325PRTPhocine distemper
virus 143Phe Ala Gly Val Val Ile Ala Gly Ala Ala Leu Gly Val Ala Thr Ala1
5 10 15Ala Gln Ile Thr
Ala Gly Val Ala Leu 20 2514425PRTSimian virus
5 144Phe Ala Gly Val Val Ile Gly Leu Ala Ala Leu Gly Val Ala Thr Ala1
5 10 15Ala Gln Val Thr Ala
Ala Val Ala Leu 20 2514525PRTSimian virus 41
145Phe Ala Gly Val Val Val Gly Leu Ala Ala Leu Gly Val Ala Thr Ala1
5 10 15Ala Gln Val Thr Ala Ala
Val Ala Val 20 2514625PRTDolphin
morbillivirus 146Phe Ala Gly Val Val Leu Ala Gly Val Ala Leu Gly Val Ala
Thr Ala1 5 10 15Ala Gln
Ile Thr Ala Gly Val Ala Leu 20
2514725PRTNewcastle disease virus 147Phe Ile Gly Ala Val Ile Gly Ser Val
Ala Leu Gly Val Ala Thr Ser1 5 10
15Ala Gln Ile Thr Ala Ala Ala Ala Leu 20
2514825PRTNewcastle disease virus 148Phe Ile Gly Ala Ile Ile Gly Ser
Ile Ala Leu Gly Val Ala Thr Ser1 5 10
15Ala Gln Ile Thr Ala Ala Ala Ala Leu 20
2514925PRTNewcastle disease virus 149Phe Ile Gly Ala Ile Ile Gly
Ser Val Ala Leu Gly Val Ala Thr Ser1 5 10
15Ala Gln Ile Thr Ala Ala Ala Ala Leu 20
2515025PRTNewcastle disease virus 150Phe Ile Gly Ala Ile Ile
Gly Ser Val Ala Leu Gly Ile Ala Thr Ser1 5
10 15Ala Gln Ile Thr Ala Ala Ala Ala Leu 20
2515125PRTNewcastle disease virus 151Phe Ile Gly Ala Val
Ile Gly Ser Val Ala Leu Gly Val Ala Thr Ala1 5
10 15Val Gln Ile Thr Ala Ala Ala Ala Leu
20 2515225PRTNewcastle disease virus 152Phe Ile Gly Ala
Ile Ile Gly Ser Val Ala Leu Gly Val Ala Thr Ala1 5
10 15Ala Gln Ile Thr Ala Ala Ser Ala Leu
20 2515325PRTNewcastle disease virus 153Phe Ile Gly
Ala Ile Ile Gly Ser Val Ala Leu Gly Val Ala Thr Asp1 5
10 15Ala Gln Ile Thr Ala Ala Ser Ala Leu
20 2515425PRTNewcastle disease virus 154Phe Ile
Gly Ala Ile Ile Gly Ser Val Ala Leu Gly Val Ala Thr Pro1 5
10 15Ala Gln Ile Thr Ala Ala Ser Ala
Leu 20 2515525PRTNewcastle disease virus
155Phe Ile Gly Ala Ile Ile Gly Gly Val Ala Leu Gly Val Ala Thr Ala1
5 10 15Ala Gln Ile Thr Ala Ala
Ser Ala Leu 20 2515625PRTNewcastle disease
virus 156Phe Ile Gly Ala Ile Ile Gly Ser Val Ala Leu Gly Val Ala Thr Ser1
5 10 15Ala Gln Ile Thr
Ala Ala Thr Ala Leu 20 2515725PRTNewcastle
disease virus 157Leu Ile Gly Ala Ile Ile Gly Gly Val Ala Leu Gly Val Ala
Thr Ala1 5 10 15Ala Gln
Ile Thr Ala Ala Ser Ala Leu 20
2515825PRTPigeon paramyxovirus-1 158Phe Ile Gly Ala Ile Ile Gly Ser Val
Ala Leu Gly Val Ala Lys Ser1 5 10
15Ala Gln Ile Thr Ala Ala Ala Ala Leu 20
2515921PRTPneumonia virus 159Phe Leu Gly Leu Ile Leu Gly Leu Gly Ala
Ala Val Thr Ala Gly Val1 5 10
15Ala Leu Ala Lys Thr 2016025PRTHendra virus 160Leu Ala
Gly Val Val Met Ala Gly Ile Ala Ile Gly Ile Ala Thr Ala1 5
10 15Ala Gln Ile Thr Ala Gly Val Ala
Leu 20 2516125PRTNipah virus 161Leu Ala Gly
Val Ile Met Ala Gly Val Ala Ile Gly Ile Ala Thr Ala1 5
10 15Ala Gln Ile Thr Ala Gly Val Ala Leu
20 2516225PRTHuman metapneumovirus 162Gln Ser
Arg Phe Val Leu Gly Ala Ile Ala Leu Gly Val Ala Thr Thr1 5
10 15Ala Ala Val Thr Ala Gly Ile Ala
Ile 20 25
User Contributions:
Comment about this patent or add new information about this topic: