Patent application title: HUMANIZED BCMA ANTIBODY AND BCMA-CAR-T CELLS
Inventors:
IPC8 Class: AC07K1628FI
USPC Class:
1 1
Class name:
Publication date: 2021-05-27
Patent application number: 20210155704
Abstract:
The present invention is directed to a humanized BCMA single-chain
variable fragment (scFv), comprising V.sub.H having the amino acid
sequence of SEQ ID NO: 3 and V.sub.L having the amino acid sequence of
SEQ ID NO: 5. The present invention is also directed to a BCMA chimeric
antigen receptor fusion protein comprising from N-terminus to C-terminus:
(i) a single-chain variable fragment (scFv) of the present invention,
(ii) a transmembrane domain, (iii) at least one co-stimulatory domains,
and (iv) an activating domain. This humanized BCMA-CAR-T cells have
specific killing activity against BCMA-positive tumor cells.Claims:
1.-11. (canceled)
12.-50. (canceled)
51. A nucleic acid, having a 5' end and a 3' end, encoding an anti-BCMA chimeric antigen receptor (CAR), comprising: an anti-BCMA single-chain variable fragment (scFv) comprising a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 3, and a light chain variable region VL) comprising the amino acid sequence of SEQ ID NO: 5; a transmembrane domain; a co-stimulatory domain; and an activating domain.
52. The nucleic acid of claim 51, further comprising a leader sequence at the 5' end.
53. The nucleic acid of claim 52, wherein the leader sequence comprises the nucleic acid sequence of SEQ ID NO: 7.
54. The nucleic acid of claim 51, further comprising a promoter at the 5' end.
55. The nucleic acid of claim 54, wherein the promoter comprises an EF1a promoter.
56. A vector, comprising the nucleic acid of claim 51.
57. The vector of claim 56, wherein the vector is a virus vector.
58. A method of making an anti-BCMA CAR-T cell, comprising: introducing into a T cell a nucleic acid encoding an anti-BCMA chimeric antigen receptor (CAR) comprising an anti-BCMA single-chain variable fragment (scFv) comprising a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 3, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 5; a transmembrane domain; a co-stimulatory domain; and an activating domain.
59. The method of claim 58, wherein the nucleic acid is introduced into the T cell in vitro.
60. The method of claim 58, wherein the nucleic acid is introduced into the T cell by a virus vector.
61. The method of claim 60, wherein the virus vector is selected from the group consisting of a retrovirus vector, an adenovirus vector, an adeno-associated virus (AAV) vector, a simian virus vector, a vaccinia virus vector, a Sendai virus vector, an Epstein-Barr virus (EBV) vector, and a HSV vector.
62. The nucleic acid of claim 51, wherein the transmembrane domain is a transmembrane domain selected from the group consisting of a T cell receptor .alpha. chain, a T cell receptor .beta. chain, a CD3 zeta chain, a CD28, a CD3.epsilon., a CD45, a CD4, a CDS, a CD8, a CD9, a CD16, a CD22, a CD33, a CD37, a CD64, a CD80, a CD86, a CD134, a CD137, an ICOS, a CD154, and a GITR.
63. The nucleic acid of claim 62, wherein the transmembrane domain comprises a transmembrane domain of a CD8.
64. The nucleic acid of claim 51, wherein the co-stimulatory domain is a costimulatory domain selected from the group consisting of a CD28, a 4-1BB, a GITR, an ICOS-1, a CD27, an OX-40, and a DAP10.
65. The nucleic acid of claim 64, wherein the co-stimulatory domain comprises a 4-1BB co-stimulatory domain.
66. The nucleic acid of claim 51, wherein the activating domain comprises a CD3 zeta activating domain.
67. The nucleic acid of claim 51, wherein the transmembrane domain comprises a transmembrane domain of a CD8, the co-stimulatory domain comprises a 4-1BB co-stimulatory domain, and the activating domain comprises a CD3 zeta activating domain.
68. The nucleic acid of claim 51, comprising the amino acid sequence of SEQ ID NO: 17.
69. The nucleic acid of claim 51, wherein the scFv further comprises a linker between the VH and the VL.
70. The nucleic acid of claim 69, comprising the amino acid sequence of SEQ ID NO: 14.
Description:
REFERENCE TO SEQUENCE LISTING, TABLE OR COMPUTER PROGRAM
[0001] The Sequence Listing is concurrently submitted herewith with the specification as an ASCII formatted text file via EFS-Web with a file name of Sequence Listing.txt with a creation date of Jan. 13, 2020, and a size of 4 kilobytes. The Sequence Listing filed via EFS-Web is part of the specification and is hereby incorporated in its entirety by reference herein.
FIELD OF THE INVENTION
[0002] The present invention relates to humanized BCMA antibody (PMC306) and BCMA-CAR-T cells specifically decreasing multiple myeloma tumor growth, which are useful in the field of adoptive immunity gene therapy for tumors.
BACKGROUND OF THE INVENTION
[0003] Immunotherapy is emerging as a highly promising approach for the treatment of cancer. T cells or T lymphocytes, the armed forces of our immune system, constantly look for foreign antigens and discriminate abnormal (cancer or infected cells) from normal cells. Genetically modifying T cells with CAR (Chimeric antigen receptor) constructs is the most common approach to design tumor-specific T cells. CAR-T cells targeting tumor-associated antigens (TAA) can be infused into patients (called adoptive cell transfer or ACT) representing an efficient immunotherapy approach [1, 2]. The advantage of CAR-T technology compared with chemotherapy or antibody is that reprogrammed engineered T cells can proliferate and persist in the patient ("a living drug") [1, 2].
[0004] CARs typically consist of a monoclonal antibody-derived single-chain variable fragment (scFv) at the N-terminal part, hinge, transmembrane domain and a number of intracellular co-activation domains: (i) CD28, (ii) CD137 (4-1BB), CD27, or other co-stimulatory domains, in tandem with an activation CD3-zeta domain (FIG. 1). The evolution of CARs went from first generation (with no co-stimulation domains) to second generation (with one co-stimulation domain) to third generation CAR (with several co-stimulation domains). Generating CARs with two costimulatory domains (the so-called 3.sup.rd generation CAR) have led to increased cytolytic CAR-T cell activity, improved persistence of CAR-T cells leading to its augmented antitumor activity.
BCMA
[0005] B cell maturation antigen (BCMA) is a cell surface receptor, also known as CD269 and tumor necrosis factor receptor superfamily member 17 (TNFRSF17), that is encoded by TNFRSF17 gene. This receptor is expressed mainly in mature B lymphocytes and in most cases overexpressed in multiple myeloma (MM) [4]. Current therapies to target BCMA in MM include monoclonal antibodies, bi-specific antibodies and T cellular immunotherapies, CAR-T therapies [4, 5].
[0006] The human BCMA protein consists of 184 amino-acids: 1-54-extracellular domain; 55-77-transmembrane domain; 78-184-cytoplasmic domain. The amino-acid sequence of BCMA is shown on FIG. 2. BCMA lacks signaling peptide and resembles other receptors BAFF Receptor and transmembrane activator and cyclophilin ligand interactor and calcium modulator (TACI) [4]. These receptors play major role in B cell maturation and differentiation into plasma cells. Their ligands include BAFF and APRIL which expression is increase in MM patients [4].
BRIEF DESCRIPTION OF THE DRAWINGS
[0007] FIG. 1 shows the structures of CAR [3]. The left panel shows the structure of first generation (no costimulatory domains). The middle panel shows the structure of the second generation (one co-stimulation domain of CD28 or 4-BB). The right panel shows the structure of the third generation (two or more co-stimulation domains).
[0008] FIG. 2 shows the amino-acid sequence of BCMA protein (SEQ ID NO: 1). Extracellular domain is underlined.
[0009] FIG. 3 shows the structure of humanized BCMA CAR construct.
[0010] FIG. 4 shows that humanized BCMA-CAR construct was detected by FACS analysis with fluorescently labeled recombinant BCMA protein. Humanized BCMA-CAR-positive cells were detected after transduction of lentiviral humanized BCMA-CAR into T cells.
[0011] FIGS. 5A-5B show that humanized BCMA-CAR-T cells killed CHO-BCMA cells but not CHO cells. XCelligence Real-time cytotoxicity assay was used for detection of humanized BCMA-CAR-T cell cytotoxicity. Normalized cell index is shown on Y-axis, and time is shown on X-axis. FIG. 5A shows CHO-BCMA target cells. on the right: From top to bottom: Mock CAR-T cells, T cells, target cells alone, and humanized CAR-T cells. FIG. 5B shows CHO target cells. From top to bottom on the right, Mock CAR-T cells, humanized BCMA CAR-T cells, T cells, and target cells alone.
[0012] FIG. 6 shows that humanized BCMA-CAR-T cells, secreted high level of IFN-gamma with CHO-BCMA-positive cells, but not with BCMA-negative CHO control cells. p<0.05 IFN-gamma secretion in CHO-BCMA cells of BCMA-CAR-T cells versus T cells and Mock CAR-T cells.
[0013] FIG. 7 shows humanized BCMA-CAR-T cells secreted high level of IFN-gamma against multiple myeloma cells but not against BCMA-negative K562 control cells. *p<0.05, IFN-gamma secretion in multiple myeloma cells of BCMA-CAR-T cells versus T cells and Mock-CAR-T cells.
[0014] FIG. 8A shows humanized BCMA-CAR-T cells significantly decreased RPMI8226 xenograft tumor growth. CAR-T cells were injected at day 7 and 20 by i.v 1.times.10{circumflex over ( )}7 cells/mice. Bars show average tumor volume +/-standard errors. *p<0.05, BCMA CAR-T cells vs Mock T cells.
[0015] FIG. 8B shows that humanized BCMA-CAR-T cells did not decrease mouse body weight. Bars show average mice body weight+/-standard deviations.
[0016] FIG. 8C shows that humanized BCMA-CAR-T cells, but not Mock-Car-T-cells, were detected in the mouse blood by FACS with BCMA recombinant protein. The peripheral blood cells were analyzed by flow cytometry at the end of the study for binding to human BCMA protein and antibodies specific for human T (CD4+/CD8+) cells. The percentage of cells binding to the CD4 antibody is shown on the left panel of FIG. 8C, and the percentage of those human T cells that also bound to the BCMA protein is shown on the right panel of FIG. 8C.
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0017] As used herein, a "chimeric antigen receptor (CAR)" is a receptor protein that has been engineered to give T cells the new ability to target a specific protein. The receptor is chimeric because they combine both antigen-binding and T-cell activating functions into a single receptor. CAR is a fused protein comprising an extracellular domain capable of binding to an antigen, a transmembrane domain, and at least one intracellular domain. The "chimeric antigen receptor (CAR)" is sometimes called a "chimeric receptor", a "T-body", or a "chimeric immune receptor (CIR)." The "extracellular domain capable of binding to an antigen" means any oligopeptide or polypeptide that can bind to a certain antigen. The "intracellular domain" means any oligopeptide or polypeptide known to function as a domain that transmits a signal to cause activation or inhibition of a biological process in a cell.
[0018] As used herein, a "domain" means one region in a polypeptide which is folded into a particular structure independently of other regions.
[0019] As used herein, "humanized antibodies" are antibodies derived from non-human species whose protein sequences have been modified to increase their similarity to antibody variants produced naturally in humans. For example, after a mouse antibody is developed, the DNA coding for that antibody can be sequenced. The DNA sequence corresponding to the antibody CDRs can then be determined. The CDR sequences can be inserted into a construct containing the DNA for a human antibody variant to prepare humanized antibodies.
[0020] As used herein, a "single chain variable fragment (scFv)" means a single chain polypeptide derived from an antibody which retains the ability to bind to an antigen. An example of the scFv includes an antibody polypeptide which is formed by a recombinant DNA technique and in which Fv regions of immunoglobulin heavy chain (H chain) and light chain (L chain) fragments are linked via a spacer sequence. Various methods for engineering an scFv are known to a person skilled in the art.
[0021] As used herein, a "tumor antigen" means a biological molecule having antigenicity, expression of which causes cancer.
[0022] The inventors have engineered humanized BCMA scFv starting from heavy and light chain variable regions of mouse monoclonal antibody derived from a mouse monoclonal antibody, clone 4C8A. Mouse 4C8A antibody exhibits strong and selective binding to human BCMA [6]. The inventors have produced BCMA-CAR-T cells based on humanized BCMA antibody to target cancer cells overexpressing BCMA tumor antigen. The BCMA-CAR-T cells of the present invention have high cytotoxic activity against several cancer cell lines.
[0023] The present invention is directed to a humanized anti-human BCMA antibody comprising V.sub.H having the amino acid of SEQ ID NO: 3 and V.sub.L having the amino acid of SEQ ID NO: 5.
[0024] In one embodiment, the humanized anti-human BCMA antibody is a single-chain variable fragment (scFv). ScFv can be V.sub.H-linker-V.sub.L or V.sub.L-linker-V.sub.H.
[0025] The present invention is also directed to a chimeric antigen receptor fusion protein comprising from N-terminus to C-terminus: (i) a single-chain variable fragment (scFv) against BCMA in which V.sub.H has the amino acid sequence of SEQ ID NO 3, and V.sub.L has the amino acid of SEQ ID NO: 5, (ii) a transmembrane domain, (iii) at least one co-stimulatory domains, and (iv) an activating domain.
[0026] In one embodiment, the CAR structure is shown in FIG. 2.
[0027] In one embodiment, the co-stimulatory domain is selected from the group consisting of CD28, 4-1BB, GITR, ICOS-1, CD27, OX-40 and DAP10. A preferred the co-stimulatory domain is CD28.
[0028] A preferred activating domain is CD3 zeta (CD3 Z or CD3.zeta.).
[0029] The transmembrane domain may be derived from a natural polypeptide, or may be artificially designed. The transmembrane domain derived from a natural polypeptide can be obtained from any membrane-binding or transmembrane protein. For example, a transmembrane domain of a T cell receptor .alpha. or .beta. chain, a CD3 zeta chain, CD28, CD3.epsilon., CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, ICOS, CD154, or a GITR can be used. The artificially designed transmembrane domain is a polypeptide mainly comprising hydrophobic residues such as leucine and valine. It is preferable that a triplet of phenylalanine, tryptophan and valine is found at each end of the synthetic transmembrane domain. Optionally, a short oligopeptide linker or a polypeptide linker, for example, a linker having a length of 2 to 10 amino acids can be arranged between the transmembrane domain and the intracellular domain. In one embodiment, a linker sequence having a glycine-serine continuous sequence can be used.
[0030] The present invention provides a nucleic acid encoding the BCMA-CAR. The nucleic acid encoding the CAR can be prepared from an amino acid sequence of the specified CAR by a conventional method. A base sequence encoding an amino acid sequence can be obtained from the aforementioned NCBI RefSeq IDs or accession numbers of GenBank for an amino acid sequence of each domain, and the nucleic acid of the present invention can be prepared using a standard molecular biological and/or chemical procedure. For example, based on the base sequence, a nucleic acid can be synthesized, and the nucleic acid of the present invention can be prepared by combining DNA fragments which are obtained from a cDNA library using a polymerase chain reaction (PCR).
[0031] A nucleic acid encoding the CAR of the present invention can be inserted into a vector, and the vector can be introduced into a cell. For example, a virus vector such as a retrovirus vector (including an oncoretrovirus vector, a lentivirus vector, and a pseudo type vector), an adenovirus vector, an adeno-associated virus (AAV) vector, a simian virus vector, a vaccinia virus vector or a sendai virus vector, an Epstein-Barr virus (EBV) vector, and a HSV vector can be used. A virus vector lacking the replicating ability so as not to self-replicate in an infected cell is preferably used.
[0032] For example, when a retrovirus vector is used, a suitable packaging cell based on a LTR sequence and a packaging signal sequence possessed by the vector can be selected for preparing a retrovirus particle using the packaging cell. Examples of the packaging cell include PG13 (ATCC CRL-10686), PA317 (ATCC CRL-9078), GP+E-86 and GP+envAm-12, and Psi-Crip. A retrovirus particle can also be prepared using a 293 cell or a 293T cell having high transfection efficiency. Many kinds of retrovirus vectors produced based on retroviruses and packaging cells that can be used for packaging of the retrovirus vectors are widely commercially available from many companies.
[0033] A CAR-T cell binds to a specific antigen via the CAR, thereby a signal is transmitted into the cell, and as a result, the cell is activated. The activation of the cell expressing the CAR is varied depending on the kind of a host cell and an intracellular domain of the CAR, and can be confirmed based on, for example, release of a cytokine, improvement of a cell proliferation rate, change in a cell surface molecule, or the like as an index. For example, release of a cytotoxic cytokine (a tumor necrosis factor, lymphotoxin, etc.) from the activated cell causes destruction of a target cell expressing an antigen. In addition, release of a cytokine or change in a cell surface molecule stimulates other immune cells, for example, a B cell, a dendritic cell, a NK cell, and a macrophage.
[0034] The cell expressing the CAR can be used as a therapeutic agent for a disease. The therapeutic agent comprises the cell expressing the CAR as an active ingredient, and it may further comprise a suitable excipient.
[0035] The inventors have generated CAR-T cells based on humanized BCMA ScFv sequence specifically targeting BCMA. The inventors have produced humanized BCMA-CAR-T cells to target cancer cells overexpressing BCMA tumor antigen. The humanized BCMA-CAR-T cells of the present invention secreted high level of cytokines against multiple myeloma cancer cells and kill CHO-BCMA-positive target cells but not control parental CHO cells.
[0036] The advantages of the humanized BCMA-ScFv of the present invention over the corresponding mouse ScFv include less immunogenicity to human due to the humanized BCMA scFv sequence. Thus, the humanized BCMA antibody of the present invention is highly potent and advantageous as therapeutic agents in many clinical applications.
[0037] The present humanized BCMA ScFv can be used for immunotherapy applications: toxin/drug-conjugated antibody, monoclonal therapeutic antibody, and CAR-T cell immunotherapy.
[0038] Humanized BCMA-CAR-T cells using the present humanized BCMA ScFv effectively target BCMA antigen in BCMA-positive cancer cell lines such as ovarian, colon, pancreatic, melanoma, cervical cancer, and other BCMA-positive cancers.
[0039] Humanized BCMA-CAR-T cells can be used in combination with different chemotherapy: checkpoint inhibitors, targeted therapies, small molecule inhibitors, and antibodies.
[0040] Humanized BCMA-CAR-T cells can be used clinically for BCMA-positive cancer cells.
[0041] Modifications of co-activation domains such as CD28, 4-1BB and others can be used to increase the efficacy of CAR-T cells. Tag-conjugated humanized BCMA scFv can be used for CAR generation.
[0042] Humanized BCMA-CAR-T cells can be used with different safety switches such as t-EGFR, RQR (Rituximab-CD34-Rituximab), inducible caspase-9 and other.
[0043] Third generation CAR-T or other co-activation signaling domains can be used with humanized BCMA-scFv to prepare BCMA-CAR-T.
[0044] The humanized BCMA CAR can be combined with CARs targeting other tumor antigens or tumor microenvironment, e.g., VEGFR-1-3, PDL-1. Bi-specific antibodies against BCMA and CD3, or other antigens can be generated for therapy.
[0045] The humanized BCMA-CAR can be used for generating other types of cells such as CAR-natural killer (NK) cells, BCMA-CAR-macrophages, allogenic CAR-T cells, gene-edited T cells, and other BCMA-CAR hematopoietic cells, which can target BCMA-positive cancers.
[0046] The present invention provides T cells, NK cells, macrophages, or hematopoietic cells, modified to express BCMA-CAR.
[0047] BCMA-CAR-T cells can be used against cancer stem cells and circulating tumor stem cells that are most resistant against chemotherapy and form aggressive tumors.
[0048] BCMA-CAR-T cells, BCMA-NK cells, BCMA-macrophages, and other cells can be used for targeting different types of cancers.
[0049] BCMA-CAR-T cells can be delivered intra-tumorally to patients for increased safety.
[0050] The following examples further illustrate the present invention. These examples are intended merely to be illustrative of the present invention and are not to be construed as being limiting.
EXAMPLES
Example 1. Humanized BCMA VH and VL and ScFv Sequences
[0051] The BCMA scFv was derived from hybridoma clones 4C8A (WO2019/195017). The sequences of heavy and light chain variable regions of mouse clone 4C8A were determined and used to construct a humanized scFv.
[0052] The structure of humanized BCMA (PMC306) scFv is: V.sub.H-linker-V.sub.L. Linker is G4Sx3.
[0053] The bold highlights the nucleotide sequence of humanized BCMA PMC306 ScFv clone: V.sub.H; the underlined highlights the nucleotide sequence of V.sub.L; in between (italicized) is the nucleotide sequence encoding a linker.
TABLE-US-00001 (SEQ ID NO: 2) caggtgcagctggtgcagagcggcgcggaagtgaaaaaaccgggcagcag cgtgaaagtgagctgcaaagcgagcggctatacctttaccagctatgtga tgcattgggtgcgccaggcgccgggccagggcctggaatggatgggctat attattccgtataacgatgcgaccaaatataacgaaaaatttaaaggccg cgtgaccattaccgcggataaaagcaccagcaccgcgtatatggaactga gcagcctgcgcagcgaagataccgcggtgtattattgcgcgcgctataac tatgatggctattttgatgtgtggggccagggcaccctggtgaccgtgag cagcggcggcggcggcagcggcggcggcggcagcggcggcggcggcagcg aaattgtgctgacccagagcccggcgaccctgagcctgagcccgggcgaa cgcgcgaccctgagctgccgcgcgagccagagcattagcgattatctgca ttggtatcagcagaaaccgggccaggcgccgcgcctgctgatttattatg cgagccagagcattaccggcattccggcgcgctttagcggcagcggcagc ggcaccgattttaccctgaccattagcagcctggaaccggaagattttgc ggtgtattattgccagaacggccatagctttccgccgacctttggcggcg gcaccaaagtggaaattaaa PMC306 VH amino acid sequence: (SEQ ID NO: 3) QVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYVVMHWVRQAPGQGLEWMG YIIPYNDATKYNEKFKGRVTITADKSTSTAYMELSSLRSEDTAVYYCARY NYDGYFDVWGQGTLVTVSS Linker amino acid sequence (SEQ ID NO: 4) GGGGSGGGGSGGGGS PMC306 VL amino acid sequence: (SEQ ID NO: 5) EIVLTQSPATLSLSPGERATLSCRASQSISDYLHWYQQKPGQAPRLLIYY ASQSITGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQNGHSFPPTFGG GTKVEIK Humanized BCMA (PMC306) scFv Protein: (SEQ ID NO: 6) Q V Q L V Q S G A E V K K P G S S V K V S C K A S G Y T F T S Y V M H W V R Q A P G Q G L E W M G Y I I P Y N D A T K Y N E K F K G R V T I T A D K S T S T A Y M E L S S L R S E D T A V Y Y C A R Y N Y D G Y F D V W G Q G T L V T V S S G G G G S G G G G S G G G G S E I V L T Q S P A T L S L S P G E R A T L S C R A S Q S I S D Y L H W Y Q Q K P G Q A P R L L I Y Y A S Q S I T G I P A R F S G S G S G T D F T L T I S S L E P E D F A V Y Y C Q N G H S F P P T F G G G T K V E I K
Example 2. Humanized BCMA-CAR Sequences
[0054] The scheme of humanized (PMC306) BCMA-CAR construct is shown on FIG. 3. Lentiviral vector with EF1a promoter was used for cloning of humanized scFv CAR sequences.
[0055] The BCMA-CAR structure includes human CD8 signaling peptide, humanized BCMA scFv (V.sub.H-Linker-V.sub.L), CD8 hinge, CD28 transmembrane, activation domains CD3 zeta (FIG. 3).
[0056] The nucleotide sequences and some of the amino acid sequences of CD8 signaling -BCMA scFv (V.sub.H-Linker-V.sub.L)-CD8 hinge-CD28 TM-CD28-CD3-zeta are shown below.
TABLE-US-00002 <CD8 leader> Nucleotide (SEQ ID NO: 7) ATGGCCTTACCAGTGACCGCCTTGCTCCTGCCGCTGGCCTTGCTGCTCCA CGCCGCCAGGCCG Amino Acid (SEQ ID NO: 8) MALPVTALLLPLALLLHAARP <Nhe I site> gctagc
Humanized BCMA, PMC 306 ScFv
[0057] V.sub.H-linker-V.sub.L, see Example 1 for nucleic acid sequences and amino acid sequences.
TABLE-US-00003 <XhoI restriction site> CTCGAG <CD8 hinge> Nucleotide (SEQ ID NO: 9) AAGCCCACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCAT CGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGAGCCGGCCAGCGGCGG GGGGCGCAGTGCACACGAGGGGGCTGGACTTCGCCAGTGAT Amino Acid (SEQ ID NO: 10) KPTTTPAPRPPTPAPTIASQPLSLRPEASRPAAGGAVHTRGLDFASD <aagccc> <CD28 transmembrane > Nucleotide (SEQ ID NO: 11) TTTTGGGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCT AGTAACAGTGGCCTTTATTATTTTCTGGGTG Amino Acid (SEQ ID NO: 12) FWVLVVVGGVLACYSLLVTVAFIIFWV <CD28 co-stimulatory> Nucleotide (SEQ ID NO: 13) AGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCC CCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCAC GCGACTTCGCAGCCTATCGCTCC Amino acid (SEQ ID NO: 14) RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS <CD3 zeta> stop codons underlined Nucleotide (SEQ ID NO: 15) AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCA GAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATG TTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAG AGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAA GATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGG GCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGAC ACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCTAAtag Amino acid (SEQ ID NO: 16) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQ RRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKD TYDALHMQALPPR <EcoRI restriction site> gaattc
[0058] Translated amino-acid sequence of humanized BCMA-CAR protein (SEQ ID NO: 17)
TABLE-US-00004 (SEQ ID NO: 17) M A L P V T A L L L P L A L L L H A A R P A S Q V Q L V Q S G A E V K K P G S S V K V S C K A S G Y T F T S Y V M H W V R Q A P G Q G L E W M G Y I I P Y N D A T K Y N E K F K G R V T I T A D K S T S T A Y M E L S S L R S E D T A V Y Y C A R Y N Y D G Y F D V W G Q G T L V T V S S G G G G S G G G G S G G G G S E I V L T Q S P A T L S L S P G E R A T L S C R A S Q S I S D Y L H W Y Q Q K P G Q A P R L L I Y Y A S Q S I T G I P A R F S G S G S G T D F T L T I S S L E P E D F A V Y Y C Q N G H S F P P T F G G G T K V E I K L E K P T T T P A P R P P T P A P T I A S Q P L S L R P E A S R P A A G G A V H T R G L D F A S D K P F W V L V V V G G V L A C Y S L L V T V A F I I F W V R S K R S R L L H S D Y M N M T P R R P G P T R K H Y Q P Y A P P R D F A A Y R S R V K F S R S A D A P A Y Q Q G Q N Q L Y N E L N L G R R E E Y D V L D K R R G R D P E M G G K P Q R R K N P Q E G L Y N E L Q K D K M A E A Y S E I G M K G E R R R G K G H D G L Y Q G L S T A T K D T Y D A L H M Q A L P P R
Example 3. CAR Lentivirus Production
[0059] Lentivirus was produced by the standard procedure using 293T cells as described in [7] The inventors generated humanized BCMA-ScFv-CAR constructs inside lentiviral vector cloned into Xba I and Eco R I sites of lentiviral vector. pCD510-FMC63-28z lentiviral CAR construct containing the humanized BCMA ScFv-CD28-CD3zeta insert--between the Xba I and Eco RI cloning sites.
[0060] The lentiviruses were generated in 293T cells and the titers were established by RT-PCR. Then equal dose of lentiviruses was used for transduction of T cells.
Example 4. Peripheral Blood Mononuclear Cell (PBMC) Isolation from Whole Blood
[0061] Whole blood (Stanford Hospital Blood Center, Stanford, Calif.) was collected from individual or mixed donors (depending on the amount of blood required) in 10 mL Heparin vacutainers (Becton Dickinson). Approximately 10 ml of whole anti-coagulated blood was mixed with sterile phosphate buffered saline (PBS) buffer for a total volume of 20 ml in a 50 ml centrifuge tube (PBS, pH 7.4, without Ca+2 and Mg+2). The blood/PBS (20 ml) was layered on top of 15 mL of Ficoll-Paque PLUS (GE Healthcare) in a conical centrifuge tube gently, and the sample was centrifuged at 400.times.g for 30-40 min at room temperature. The layer of cells containing peripheral blood mononuclear cells (PBMC) at the diluted plasma/Ficoll interface was removed, washed, and centrifuged at 200.times.g for 10 min at room temperature. Cells were counted with a hemocytomter. The PBMC were washed once with CAR-T media (AIM V-AlbuMAX(BSA) (Life Technologies), with 5% AB serum and 1.25 .mu.g/mL amphotericin B (Gemini Bioproducts, Woodland, Calif.), 100 U/mL penicillin, and 100 .mu.g/mL streptomycin) and used for experiments or were frozen at -80.degree. C.
Example 5. T-Cell Activation from PBMC
[0062] The isolated PBMC cells are resuspended in CAR-T medium with 300 U/mL huIL2 (from a 1000.times. stock; Invitrogen) and mixed with CD3-CD28 beads at a 1:1 bead-to-cell ratio. The cells are incubated at 37.degree. C. in the presence of CO2 for 24 hours before viral transduction.
Example 6. T-Cell Transduction and Expansion
[0063] Following activation of PBMC, cells were incubated for 24 hours at 37.degree. C., 5% CO.sub.2. To each well of 1.times.10.sup.6 cells, 5.times.10.sup.6 lentivirus and 2 .mu.L/mL of media of Transplus (Alstem, Richmond, Calif.) (a final dilution of 1:500) were added. Cells were incubated for an additional 24 hours before repeating the addition of virus. Cells were then grown in the continued presence of 300 U/ML of IL-2 fresh medium with IL-2 for a period of 12-14 days (total incubation time was dependent on the final umber of CAR-T cells required). Cells concentrations were analyzed every 2-3 days, with media being added at that time to dilute the cell suspension to 1.times.10.sup.6 cells/mL.
Example 7. Humanized BCMA-CAR-T Cells Expressed BCMA ScFv
[0064] We designed humanized BCMA-CAR-T cells with humanized BCMA-CAR construct shown in Example 2. We used Mock scFv with unrelated ScFv and generated Mock-CAR-T cells as a negative control. Humanized BCMA-CAR-positive cells were detected after transduction of lentiviral humanized BCMA CAR into T cells. (FIG. 4).
Example 8. Humanized BCMA-CAR-T Cells Killed CHO-BCMA Cells but not CHO Cells
[0065] We incubated humanized BCMA-CAR-T cells with target CHO-BCMA target cells and CHO (BCMA-negative) control cells. Humanized BCMA-CAR-T cells specifically killed CHO-BCMA cells (FIG. 5A) but not CHO cells (FIG. 5B). The results demonstrate high specificity of humanized BCMA-CAR-T cells to target BCMA antigen and to kill BCMA-positive cells.
Example 9. Humanized CAR-T Cells Secreted IFN-Gamma against Target CHO-BCMA Cells Significantly but not against CHO Cells
[0066] We collected supernatant after co-incubation of humanized BCMA-CAR-T cells and target CHO-BCMA and parental CHO cells and performed IFN-gamma assay. BCMA-CAR-T cells secreted IFN-gamma with CHO-BCMA cells but not with negative control CHO cells (FIG. 6). The results confirm specificity of humanized BCMA-CAR-T cells.
Example 10. Humanized CAR-T Cells Secreted High Levels of IFN-Gamma against BCMA-Positive RPMI8226 Multiple Myeloma Cells but not against BCMA-Negative K562 Leukemia Cells
[0067] We incubated BCMA-CAR-T cells with multiple myeloma cancer cells RPMI8266, and BCMA-negative K562 cells (chronic myelogenous leukemia cells) and performed ELISA with IFN-gamma using kit from Fisher, according to manufacturer's protocol. Humanized BCMA-CAR-T cells secreted high level of IFN-gamma against BCMA-positive multiple myeloma cancer cells but not against BCMA-negative K562 cells (FIG. 7). The level of killing and secretion of IFN-gamma was significantly higher with BCMA-CAR-T cells than with T cells and Mock CAR-T cells. This confirms specificity of humanized BCMA-CAR-T cells against hematological BCMA-positive cells.
Example 11. Humanized BCMA-CAR-T Cells Significantly Decreased RPMI8226 Xenograft Tumor Growth in Mouse Model In Vivo
[0068] Multiple myeloma RPMI8226 cells were injected subcutaneously into NSG mice (1.times.10{circumflex over ( )}7 cells/mice), and then humanized BCMA-CAR-T cells were injected twice by i.v. (1.times.10{circumflex over ( )}7 CAR-T cells/mice). Humanized BCMA-CAR-T cells significantly decreased RPMI8226 tumor growth in mice (FIG. 8A). Mice treated with humanized BCMA-CAR-T cells did not cause decreased mice body weight suggesting that CAR-T cells were not toxic to mice (FIG. 8B). No behavior or visual changes were observed during the study.
[0069] The peripheral blood cells were analyzed by flow cytometry at the end of the study for binding to human BCMA protein and antibodies specific for human T (CD4+/CD8+) cells. The percentage of cells binding to the CD4 mAb is shown on the left panel of FIG. 8C, and the percentage of those human T cells that also bound to the BCMA protein is shown on the right panel of FIG. 8C. The results show that humanized BCMA-CAR-T cells, but not Mock-Car-T-cells, were detected in the mouse blood by FACS with BCMA recombinant protein.
REFERENCES
[0070] 1. Maus, M. V., Haas, A. R., Beatty, G. L., Albelda, S. M., Levine, B. L., Liu, X., Zhao, Y., Kalos, M., and June, C. H. (2013). T cells expressing chimeric antigen receptors can cause anaphylaxis in humans. Cancer Immunol Res 1, 26-31.
[0071] 2. Maus, M. V., Grupp, S. A., Porter, D. L., and June, C. H. (2014). Antibody-modified T cells: CARs take the front seat for hematologic malignancies. Blood 123, 2625-2635.
[0072] 3. Golubovskaya V, Wu L. (2016) Different Subsets of T Cells, Memory, Effector Functions, and CAR-T Immunotherapy. Cancers, 15, 8 (3). PMID: 26999211
[0073] 4. Ali, S. A., Shi, V., Maric, I., Wang, M., Stroncek, D. F., Rose, J. J., Brudno, J. N., Stetler-Stevenson, M., Feldman, S. A., Hansen, B. G., et al. (2016). T cells expressing an anti-B-cell maturation antigen chimeric antigen receptor cause remissions of multiple myeloma. Blood 128, 1688-1700.
[0074] 5. Tai, Y. T., and Anderson, K. C. (2015). Targeting B-cell maturation antigen in multiple myeloma. Immunotherapy. 7(11):1187-99. doi: 10.2217/imt.15.77. Epub 2015 Sep. 15. Review. PMID: 26370838
[0075] 6. WO2019/195017
[0076] 7. Berahovich R, Xu S, Zhou H, Harto H, Xu Q, Garcia A, Liu F, Golubovskaya V M, Wu L. FLAG-tagged CD19-specific CAR-T cells eliminate CD19-bearing solid tumor cells in vitro and in vivo. Front Biosci (Landmark Ed). 2017 Jun. 1; 22: 1644-1654
Sequence CWU
1
1
171184PRTHomo sapiens 1Met Leu Gln Met Ala Gly Gln Cys Ser Gln Asn Glu Tyr
Phe Asp Ser1 5 10 15Leu
Leu His Ala Cys Ile Pro Cys Gln Leu Arg Cys Ser Ser Asn Thr 20
25 30Pro Pro Leu Thr Cys Gln Arg Tyr
Cys Asn Ala Ser Val Thr Asn Ser 35 40
45Val Lys Gly Thr Asn Ala Ile Leu Trp Thr Cys Leu Gly Leu Ser Leu
50 55 60Ile Ile Ser Leu Ala Val Phe Val
Leu Met Phe Leu Leu Arg Lys Ile65 70 75
80Asn Ser Glu Pro Leu Lys Asp Glu Phe Lys Asn Thr Gly
Ser Gly Leu 85 90 95Leu
Gly Met Ala Asn Ile Asp Leu Glu Lys Ser Arg Thr Gly Asp Glu
100 105 110Ile Ile Leu Pro Arg Gly Leu
Glu Tyr Thr Val Glu Glu Cys Thr Cys 115 120
125Glu Asp Cys Ile Lys Ser Lys Pro Lys Val Asp Ser Asp His Cys
Phe 130 135 140Pro Leu Pro Ala Met Glu
Glu Gly Ala Thr Ile Leu Val Thr Thr Lys145 150
155 160Thr Asn Asp Tyr Cys Lys Ser Leu Pro Ala Ala
Leu Ser Ala Thr Glu 165 170
175Ile Glu Lys Ser Ile Ser Ala Arg 1802720DNAHomo sapiens
2caggtgcagc tggtgcagag cggcgcggaa gtgaaaaaac cgggcagcag cgtgaaagtg
60agctgcaaag cgagcggcta tacctttacc agctatgtga tgcattgggt gcgccaggcg
120ccgggccagg gcctggaatg gatgggctat attattccgt ataacgatgc gaccaaatat
180aacgaaaaat ttaaaggccg cgtgaccatt accgcggata aaagcaccag caccgcgtat
240atggaactga gcagcctgcg cagcgaagat accgcggtgt attattgcgc gcgctataac
300tatgatggct attttgatgt gtggggccag ggcaccctgg tgaccgtgag cagcggcggc
360ggcggcagcg gcggcggcgg cagcggcggc ggcggcagcg aaattgtgct gacccagagc
420ccggcgaccc tgagcctgag cccgggcgaa cgcgcgaccc tgagctgccg cgcgagccag
480agcattagcg attatctgca ttggtatcag cagaaaccgg gccaggcgcc gcgcctgctg
540atttattatg cgagccagag cattaccggc attccggcgc gctttagcgg cagcggcagc
600ggcaccgatt ttaccctgac cattagcagc ctggaaccgg aagattttgc ggtgtattat
660tgccagaacg gccatagctt tccgccgacc tttggcggcg gcaccaaagt ggaaattaaa
7203118PRTHomo sapiens 3Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys
Lys Pro Gly Ser1 5 10
15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr
20 25 30Val Met His Trp Val Arg Gln
Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40
45Gly Tyr Ile Ile Pro Tyr Asn Asp Ala Thr Lys Tyr Asn Glu Lys
Phe 50 55 60Lys Gly Arg Val Thr Ile
Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr65 70
75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90
95Ala Arg Tyr Asn Tyr Asp Gly Tyr Phe Asp Val Trp Gly Gln Gly Thr
100 105 110Leu Val Thr Val Ser Ser
115415PRTArtificial Sequencesynthetic 4Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser1 5 10
155107PRTHomo sapiens 5Glu Ile Val Leu Thr Gln Ser Pro Ala
Thr Leu Ser Leu Ser Pro Gly1 5 10
15Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Ile Ser Asp
Tyr 20 25 30Leu His Trp Tyr
Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu Ile 35
40 45Tyr Tyr Ala Ser Gln Ser Ile Thr Gly Ile Pro Ala
Arg Phe Ser Gly 50 55 60Ser Gly Ser
Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro65 70
75 80Glu Asp Phe Ala Val Tyr Tyr Cys
Gln Asn Gly His Ser Phe Pro Pro 85 90
95Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys 100
1056240PRTHomo sapiens 6Gln Val Gln Leu Val Gln Ser Gly
Ala Glu Val Lys Lys Pro Gly Ser1 5 10
15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr
Ser Tyr 20 25 30Val Met His
Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35
40 45Gly Tyr Ile Ile Pro Tyr Asn Asp Ala Thr Lys
Tyr Asn Glu Lys Phe 50 55 60Lys Gly
Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr65
70 75 80Met Glu Leu Ser Ser Leu Arg
Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90
95Ala Arg Tyr Asn Tyr Asp Gly Tyr Phe Asp Val Trp Gly
Gln Gly Thr 100 105 110Leu Val
Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser 115
120 125Gly Gly Gly Gly Ser Glu Ile Val Leu Thr
Gln Ser Pro Ala Thr Leu 130 135 140Ser
Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln145
150 155 160Ser Ile Ser Asp Tyr Leu
His Trp Tyr Gln Gln Lys Pro Gly Gln Ala 165
170 175Pro Arg Leu Leu Ile Tyr Tyr Ala Ser Gln Ser Ile
Thr Gly Ile Pro 180 185 190Ala
Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile 195
200 205Ser Ser Leu Glu Pro Glu Asp Phe Ala
Val Tyr Tyr Cys Gln Asn Gly 210 215
220His Ser Phe Pro Pro Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys225
230 235 240763DNAHomo sapiens
7atggccttac cagtgaccgc cttgctcctg ccgctggcct tgctgctcca cgccgccagg
60ccg
63821PRTHomo sapiens 8Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala
Leu Leu Leu1 5 10 15His
Ala Ala Arg Pro 209141DNAHomo sapiens 9aagcccacca cgacgccagc
gccgcgacca ccaacaccgg cgcccaccat cgcgtcgcag 60cccctgtccc tgcgcccaga
ggcgagccgg ccagcggcgg ggggcgcagt gcacacgagg 120gggctggact tcgccagtga t
1411047PRTHomo sapiens 10Lys
Pro Thr Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala Pro Thr1
5 10 15Ile Ala Ser Gln Pro Leu Ser
Leu Arg Pro Glu Ala Ser Arg Pro Ala 20 25
30Ala Gly Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Ser
Asp 35 40 451181DNAHomo sapiens
11ttttgggtgc tggtggtggt tggtggagtc ctggcttgct atagcttgct agtaacagtg
60gcctttatta ttttctgggt g
811227PRTHomo sapiens 12Phe Trp Val Leu Val Val Val Gly Gly Val Leu Ala
Cys Tyr Ser Leu1 5 10
15Leu Val Thr Val Ala Phe Ile Ile Phe Trp Val 20
2513123DNAHomo sapiens 13aggagtaaga ggagcaggct cctgcacagt gactacatga
acatgactcc ccgccgcccc 60gggcccaccc gcaagcatta ccagccctat gccccaccac
gcgacttcgc agcctatcgc 120tcc
1231441PRTHomo sapiens 14Arg Ser Lys Arg Ser Arg
Leu Leu His Ser Asp Tyr Met Asn Met Thr1 5
10 15Pro Arg Arg Pro Gly Pro Thr Arg Lys His Tyr Gln
Pro Tyr Ala Pro 20 25 30Pro
Arg Asp Phe Ala Ala Tyr Arg Ser 35 4015345DNAHomo
sapiens 15agagtgaagt tcagcaggag cgcagacgcc cccgcgtacc agcagggcca
gaaccagctc 60tataacgagc tcaatctagg acgaagagag gagtacgatg ttttggacaa
gagacgtggc 120cgggaccctg agatgggggg aaagccgcag agaaggaaga accctcagga
aggcctgtac 180aatgaactgc agaaagataa gatggcggag gcctacagtg agattgggat
gaaaggcgag 240cgccggaggg gcaaggggca cgatggcctt taccagggtc tcagtacagc
caccaaggac 300acctacgacg cccttcacat gcaggccctg ccccctcgct aatag
34516113PRTHomo sapiens 16Arg Val Lys Phe Ser Arg Ser Ala Asp
Ala Pro Ala Tyr Gln Gln Gly1 5 10
15Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu
Tyr 20 25 30Asp Val Leu Asp
Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly Lys 35
40 45Pro Gln Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr
Asn Glu Leu Gln 50 55 60Lys Asp Lys
Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu65 70
75 80Arg Arg Arg Gly Lys Gly His Asp
Gly Leu Tyr Gln Gly Leu Ser Thr 85 90
95Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu
Pro Pro 100 105
110Arg17495PRTHomo sapiens 17Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro
Leu Ala Leu Leu Leu1 5 10
15His Ala Ala Arg Pro Ala Ser Gln Val Gln Leu Val Gln Ser Gly Ala
20 25 30Glu Val Lys Lys Pro Gly Ser
Ser Val Lys Val Ser Cys Lys Ala Ser 35 40
45Gly Tyr Thr Phe Thr Ser Tyr Val Met His Trp Val Arg Gln Ala
Pro 50 55 60Gly Gln Gly Leu Glu Trp
Met Gly Tyr Ile Ile Pro Tyr Asn Asp Ala65 70
75 80Thr Lys Tyr Asn Glu Lys Phe Lys Gly Arg Val
Thr Ile Thr Ala Asp 85 90
95Lys Ser Thr Ser Thr Ala Tyr Met Glu Leu Ser Ser Leu Arg Ser Glu
100 105 110Asp Thr Ala Val Tyr Tyr
Cys Ala Arg Tyr Asn Tyr Asp Gly Tyr Phe 115 120
125Asp Val Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Gly
Gly Gly 130 135 140Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Glu Ile Val Leu145 150
155 160Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser
Pro Gly Glu Arg Ala Thr 165 170
175Leu Ser Cys Arg Ala Ser Gln Ser Ile Ser Asp Tyr Leu His Trp Tyr
180 185 190Gln Gln Lys Pro Gly
Gln Ala Pro Arg Leu Leu Ile Tyr Tyr Ala Ser 195
200 205Gln Ser Ile Thr Gly Ile Pro Ala Arg Phe Ser Gly
Ser Gly Ser Gly 210 215 220Thr Asp Phe
Thr Leu Thr Ile Ser Ser Leu Glu Pro Glu Asp Phe Ala225
230 235 240Val Tyr Tyr Cys Gln Asn Gly
His Ser Phe Pro Pro Thr Phe Gly Gly 245
250 255Gly Thr Lys Val Glu Ile Lys Leu Glu Lys Pro Thr
Thr Thr Pro Ala 260 265 270Pro
Arg Pro Pro Thr Pro Ala Pro Thr Ile Ala Ser Gln Pro Leu Ser 275
280 285Leu Arg Pro Glu Ala Ser Arg Pro Ala
Ala Gly Gly Ala Val His Thr 290 295
300Arg Gly Leu Asp Phe Ala Ser Asp Lys Pro Phe Trp Val Leu Val Val305
310 315 320Val Gly Gly Val
Leu Ala Cys Tyr Ser Leu Leu Val Thr Val Ala Phe 325
330 335Ile Ile Phe Trp Val Arg Ser Lys Arg Ser
Arg Leu Leu His Ser Asp 340 345
350Tyr Met Asn Met Thr Pro Arg Arg Pro Gly Pro Thr Arg Lys His Tyr
355 360 365Gln Pro Tyr Ala Pro Pro Arg
Asp Phe Ala Ala Tyr Arg Ser Arg Val 370 375
380Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln Gln Gly Gln
Asn385 390 395 400Gln Leu
Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr Asp Val
405 410 415Leu Asp Lys Arg Arg Gly Arg
Asp Pro Glu Met Gly Gly Lys Pro Gln 420 425
430Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln
Lys Asp 435 440 445Lys Met Ala Glu
Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu Arg Arg 450
455 460Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu
Ser Thr Ala Thr465 470 475
480Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro Pro Arg
485 490 495
User Contributions:
Comment about this patent or add new information about this topic: