04th week of 2017 patent applcation highlights part 25 |
Patent application number | Title | Published |
20170022467 | A Method And Apparatus For Measuring Biological Activity With Single Cell Resolution - A method and apparatus for carrying out measurements on single cells, either one or many single cells at a time in order to characterize the cellular response to stimuli in a perfused liquid. The apparatus for performing the respirometry includes a double-barrel pipette probe. | 2017-01-26 |
20170022468 | Modular Incubator - A modular incubator comprising a housing structure divided into cells and having several incubator modules, each of which can be housed, in a removable manner, in a relative cell and is provided with an incubation chamber to incubate microbiological or cellular cultures. Each cell has a first group of connectors and each incubator module has a second group of connectors, each of which can be coupled to a corresponding connector of the first group of connectors of the relative cell when the incubator module is housed in said cell. The first group of connectors has at least one pneumatic connector communicating with at least one source of aeriform substance, and the second group of connectors has a corresponding pneumatic connector communicating with the relative incubation chamber to allow the aeriform substance to be introduced into the incubation chamber. | 2017-01-26 |
20170022469 | CELL CULTURING APPARATUS - A cell culturing apparatus according to the present invention includes a culture-medium retaining unit that retains a culture medium for culturing a cell, a culture bag provided with a feed port and a discharge port, a culture-medium feeding unit that connects the culture-medium retaining unit and the feed port and that feeds the culture medium from the culture-medium retaining unit to the culture bag, a negative-pressure supplying unit that supplies negative pressure to the discharge port, and a waste retaining unit that retains the culture medium from the discharge port. | 2017-01-26 |
20170022470 | METHOD OF MICROBIOLOGICAL ANALYSIS OF A SAMPLE IN A UNIQUE CONTAINER - The present invention relates to a method of analysis comprising the preparation and the analysis of a sample in a flexible container without direct handling of the sample and without reopening the flexible container at the end of the preparation of the sample, and also to a container and a kit that enable the implementation of this method. | 2017-01-26 |
20170022471 | METHOD FOR CELL CULTURE - A method for stem or progenitor cell culture. More precisely, the invention relates to a method for cell culture using one or more IαI (inter-alpha trypsin inhibitor or inter-alpha inhibitor) protein(s) or part(s) thereof as a component in a cell culture media or a coating on a cell culture surface material. Furthermore the invention relates to a cell culture media and a cell culture coating/matrix provided with one or more IαI proteins(s) or part(s) thereof. | 2017-01-26 |
20170022472 | EXPANSION OF STEM CELLS IN HOLLOW FIBER BIOREACTORS - The invention is directed to producing large numbers of cells using hollow fiber bioreactor technology. The cells are non-embryonic stem, non-germ cells that can be characterized by one or more of the following: extended replication in culture and markers of extended replication, such as telomerase, markers of pluripotentiality, and broad differentiation potential, without being transformed. | 2017-01-26 |
20170022473 | METHOD OF CULTURING PLURIPOTENT STEM CELL, AND POLYPEPTIDE TO BE USED THEREFOR - A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues. | 2017-01-26 |
20170022474 | PDX1-EXPRESSING DORSAL AND VENTRAL FOREGUT ENDODERM - Disclosed herein are cell cultures comprising dorsal and/or ventral PDX1-positive foregut endoderm cells and methods of producing the same. Also disclosed herein are cell populations comprising substantially purified dorsal and/or ventral PDX1-positive foregut endoderm cells as well as methods for enriching, isolating and purifying dorsal and/or ventral PDX1-positive foregut endoderm cells from other cell types. Methods of identifying differentiation factors capable of promoting the differentiation of dorsal and/or ventral PDX1-positive foregut endoderm cells, are also disclosed. | 2017-01-26 |
20170022475 | MODULATING CELL PROLIFERATION AND PLURIPOTENCY - Disclosed herein are compositions, systems, and methods for modulating proliferation, differentiation and pluripotency of cells. | 2017-01-26 |
20170022476 | METHOD FOR GENERATING ENDOTHELIAL COLONY FORMING CELL-LIKE CELLS - The present disclosure relates generally to methods and compositions useful in cell and tissue biology and therapeutics. In particular, an in vitro method for differentiating pluripotent cells into endothelial colony forming cell-like cells (ECFC-like cells) is provided. A purified human cell population of NRP-1+CD31+ ECFC-like cells is provided, wherein at least some of the cells in the population have a high proliferation potential. Therapeutic and test agent screening methods for using the cell populations of the present disclosure are provided. | 2017-01-26 |
20170022477 | ANIMAL CELL CULTURE MEDIUM AND CULTURE CONTAINER - A culture medium for animal cells for enhancing a metabolism activity of the TCA cycle (tricarboxylic acid cycle) in respiration of the animal cells includes, as effective components, amino acids metabolized to succinyl CoA that is an element constituting the TCA cycle at a concentration of 2.3 mmol/L to 6.0 mmol/L. | 2017-01-26 |
20170022478 | METHODS OF PRODUCING T CELL POPULATIONS ENRICHED FOR STABLE REGULATORY T-CELLS - The present invention provides methods for producing cell populations enriched for stable, regulatory T cells (Tregs). In particular, the invention relates to methods for culturing T cells such that the final culture is enriched for stable, regulatory T cells. It also relates to methods for stabilizing regulatory T cells. Also provided are compositions enriched for stable, regulatory T cells, which are useful for treating individuals in need of such treatment. The methods and compositions disclosed herein can also be used to treat an individual suffering from an immune-mediated disease. | 2017-01-26 |
20170022479 | METHODS FOR PURIFYING ADENOVIRUS VECTORS - Methods of purifying an adenovirus from an impure preparation are provided. In some embodiments, a combination of mixed mode chromatography and anion exchange chromatography is used to purify the adenovirus. | 2017-01-26 |
20170022480 | METHODS FOR PURIFICATION OF A VIRUS PRODUCED IN VITRO AND CLEARANCE ASSAY FOR THE VIRUS - A method of purification of non-enveloped or pseudo-enveloped virus produced in vitro uses a composition with at least one detergent. A method of purification can use multiple detergents, and a method of determining the presence and/or level of a non-enveloped or pseudo-enveloped virus in a sample includes treating with at least one detergent. | 2017-01-26 |
20170022481 | METHOD FOR GENERATING HIGH-TITER HEPATITIS E VIRUS STOCKS AND TITRATION ASSAY FOR HEPATITIS E VIRUS - Polybrene as an additive in cell culture medium is used in methods for the generation of high-titer hepatitis E virus stocks and assays for titration of hepatitis E virus. A cell culture medium containing polybrene is used for high-titer HEV generation, a method for determining the presence and/or the level of HEV in a sample, and an HEV titration assay using polybrene. | 2017-01-26 |
20170022482 | Virus Filtration of Liquid Factor VII Compositions - The present invention relates to a novel method for improving the viral safety of liquid Factor VII compositions, in particular those comprising active Factor VII polypeptides (a Factor VIIa polypeptide). | 2017-01-26 |
20170022483 | Preparation of Stabilized Catalase Enzymes with a Surfactant - There is provided a method of producing a stabilized microcrystalline cellulose powder containing catalase enzyme. In the method, cellulose is thoroughly mixed with phosphate borate and catalase, rinsed with water and a surfactant added. The stabilized powder may be mixed with various skin solutions (lotions, ointments and the like). The catalase enzyme can catalyze the reaction of peroxide to oxygen. | 2017-01-26 |
20170022484 | ENGINEERED BIOCATALYSTS AND METHODS FOR SYNTHESIZING CHIRAL AMINES - The present disclosure provides engineered transaminase polypeptides for the production of amines, polynucleotides encoding the engineered transaminases, host cells capable of expressing the engineered transaminases, and methods of using the engineered transaminases to prepare compounds useful in the production of active pharmaceutical agents. | 2017-01-26 |
20170022485 | NOVEL ISOFORM OF ANAPLASTIC LYMPHOMA KINASE AND ITS USES - The present invention relates to a | 2017-01-26 |
20170022486 | A method for producing a phytase variant with improved thermal stability, and a phytase variant and the use thereof - The present invention relates to the field of genetic engineering, in particular, the present invention relates to a method for producing a phytase variant with an improved thermal stability, and a phytase variant and the use thereof. The phytase variant contains at least one proline modification, compared to the phytase from | 2017-01-26 |
20170022487 | SYNTHETIC CATALYTIC MIMICS OF ESTERASES, LIPASES OR DESATURASES - Novel synthetic catalytic structures or “synzymes,” e.g., fatty acid modified polypeptides, with catalytic properties are provided. It is believed that these synthetic catalytic structures mimic some of the precise conformational changes necessary for catalytic activities seen in enzymes. The catalytic properties of these synthetic catalytic structures or synzymes can be further improved by the application of controlled external forces, e.g., electric fields, or fluidized bed. | 2017-01-26 |
20170022488 | COMPOSITIONS AND METHODS COMPRISING SEQUENCES HAVING MEGANUCLEASE ACTIVITY - Compositions and methods comprising polynucleotides and polypeptides having meganuclease activity are provided. Further provided are nucleic acid constructs, yeast, plants, plant cells, explants, seeds and grain having the meganuclease sequences. Various methods of employing the meganuclease sequences are provided. Such methods include, for example, methods for producing a meganuclease with increased activity at a wide range of temperatures, methods for producing a yeast, plant, plant cell, explant or seed comprising a meganuclease with increased activity. | 2017-01-26 |
20170022489 | HYBRID POLYPEPTIDES HAVING CELLOBIOHYDROLASE ACTIVITY AND POLYNUCLEOTIDES ENCODING SAME - The present invention relates to hybrid polypeptides having cellobiohydrolase activity. The present invention also relates to polynucleotides encoding the hybrid polypeptides; nucleic acid constructs, vectors, and host cells comprising the polynucleotides; and processes of using the hybrid polypeptides. | 2017-01-26 |
20170022490 | USE AND PRODUCTION OF STORAGE-STABLE NEUTRAL METALLOPROTEASE - The present invention provides methods and compositions comprising at least one neutral metalloprotease enzyme that has improved storage stability. In some embodiments, the neutral metalloprotease finds use in cleaning and other applications. In some particularly preferred embodiments, the present invention provides methods and compositions comprising neutral metalloprotease(s) obtained from | 2017-01-26 |
20170022491 | METHOD FOR REGULATING ACID RESISTANCE OF MICROBES - Provided are a method for regulating acid resistance of a microorganism by suppressing the expression of the fadD gene therein and a screening method for a microorganism having acid resistance by using the expression level of the fadD gene as an index. A method for regulating acid resistance of a microorganism, including suppressing the expression of fadD gene present in the microorganism. | 2017-01-26 |
20170022492 | METHOD OF ISOLATING NUCLEIC ACID FROM SPECIMENS IN LIQUID-BASED CYTOLOGY PRESERVATIVES CONTAINING FORMALDEHYDE - Method, composition, kit and system for isolating amplifiable nucleic acid from specimens preserved in a liquid-based cytology preservative that contains formaldehyde. The technique relies on the use of 2-imidazolidone and a protease enzyme, such as proteinase K, at elevated temperatures. Advantageously, RNA can be isolated and used as a template in nucleic acid amplification reactions. | 2017-01-26 |
20170022493 | COMPOSITIONS AND METHODS FOR DNA AND RNA EXTRACTION FROM TISSUE SAMPLES - Methods and reagents are provided for the rapid extraction of nucleic acids from a cell or tissue sample. In certain embodiments the sample comprises a formalin fixed paraffin embedded sample (e.g., a FFPET sample), or a fine needle aspirate and/or a cell/tissue smear. In some embodiments, the methods comprise incubating one or more sections of said tissue sample in a lysis solution comprising a buffer sufficient to maintain the pH of said solution at a pH ranging from about pH 4 to about pH 9; a chaotropic agent; a chelating agent; and a detergent; where the incubating is at a temperature ranging from about 50° C. to about 100° C.; and recovering the nucleic acid from said lysis solution. | 2017-01-26 |
20170022494 | TWO-HYBRID BASED SCREEN TO IDENTIFY DISRUPTIVE RESIDUES AT MULTIPLE PROTEIN INTERFACES - The present invention is based, at least in part, on the development of a mating-based yeast two-hybrid screen that allows simultaneous screening for mutations that disrupt yeast two-hybrid interactions between a protein and multiple interacting partners. By coupling PCR mutagenesis and homologous recombination/gapped plasmid repair with a mating-based assay, the present invention allows screening for unique mutations that disrupt interaction with one partner, but not others. It also allows identification of specific mutations that may lie at protein-protein interfaces common to two or more partners, without employing multiple rounds of screening. In addition to screening against multiple interacting partners, the present invention removes the need for a two-step selection because truncations, frameshifts, or any mutations that affect folding are eliminated as disruptions that affect all protein partners. The methods of the present invention are named “Hotspot” because of its ability to identify “hotspot residues” in protein-protein interfaces. | 2017-01-26 |
20170022495 | REDUCTION OF OFF-TARGET RNA INTERFERENCE TOXICITY - The present invention is directed to RNA interference (RNAi) molecules targeted against a nucleic acid sequence, and methods of using these RNAi molecules to reduce off-target toxicity. | 2017-01-26 |
20170022496 | AVIAN INFLUENZA VIRUS MIRNA, AND APPRAISAL, DETECTION, AND APPLICATION THEREOF - The present invention relates to an avian influenza virus miRNA and the identification, detection and application thereof. In particular, a kind of specific microRNA, miR-HA-3 | 2017-01-26 |
20170022497 | Polyconjugates for Delivery of RNAi triggers to Tumor Cells In Vivo - The present invention is directed compositions for delivery of RNA interference (RNAi) triggers to integrin positive tumor cells in vivo. The compositions comprise RGD ligand-targeted amphipathic membrane active polyamines reversibly modified with enzyme cleavable dipeptide-amidobenzyl-carbonate masking agents. Modification masks membrane activity of the polymer while reversibility provides physiological responsiveness. The reversibly modified polyamines (dynamic polyconjugate or conjugate) are further covalently linked to an RNAi trigger. | 2017-01-26 |
20170022498 | METHOD OF REGULATING GENE EXPRESSION - The present invention relates, in general, to gene expression and, in particular, to a method of inhibiting the expression of a target gene and to constructs suitable for use in such a method. | 2017-01-26 |
20170022499 | METHODS AND COMPOSITIONS FOR THE PRODUCTION OF GUIDE RNA - Various aspects and embodiments of the present disclosure relate to methods and compositions that combine multiple mammalian RNA regulatory strategies, including RNA triple helix structures, introns, microRNAs, and ribozymes with Cas-based CRISPR transcription factors and ribonuclease-based RNA processing in human cells. The methods and compositions of the present disclosure, in some embodiments, enable multiplexed production of proteins and multiple guide RNAs from a single compact RNA-polymerase-II-expressed transcript for efficient modulation of synthetic constructs and endogenous human promoters. | 2017-01-26 |
20170022500 | A TARGETING MOLECULE AND A USE THEREOF - Provided are: a targeting molecule targeting a target cell which is selected from the group consisting of a stellate cell, a myofibroblast, a cancer-associated fibroblast, a tumor cell and a cell expressing STRA6, said targeting molecule being selected from the group consisting of (1) a peptide containing an amino acid sequence in the cell-binding region of RBP, (2) a variant peptide of the aforesaid peptide (1), said variant peptide having a comparable targetability to peptide (1), and (3) a peptide mimetic having a comparable targetability to peptide (1) or peptide (2); a targeting agent, a carrier, a complex and a medicinal composition each comprising the targeting molecule; a method for treating, examining, diagnosing or monitoring a disease related to the aforesaid target cell; a method for labeling, detecting or imaging the target cell, etc. | 2017-01-26 |
20170022501 | METHOD OF TREATING KELOIDS OR HYPERTROPHIC SCARS USING ANTISENSE COMPOUNDS TARGETING CONNECTIVE TISSUE GROWTH FACTOR (CTGF) - This invention provides methods of preventing formation of, or treating, fibrotic lesions, including skin scars such as keloids and hypertrophic scars which comprise administering to the subject by one or more injection a compound which comprises a modified oligonucleotide, such as a modified antisense oligonucleotide, siRNA, or oligodeoxyribonucleotide, which inhibits expression of protein involved in fibrosis. Dosing of the antisense using an intradermal threading technique is also described. | 2017-01-26 |
20170022502 | Oligomers - Certain disclosed oligomers induce exon skipping during processing of myostatin pre-mRNA. The oligomers may be in a vector or encoded by the vector. The vector is used for inducing exon skipping during processing of myostatin pre-mRNA. A therapeutically effective amount of the oligomer may be administered to a subject patient such that exon skipping during processing of myostatin pre-mRNA is induced. The administration to a subject may be used in order to increase or maintain muscle mass, or slowing degeneration of muscle mass in the subject. The administration to a subject may ameliorate muscle wasting conditions, such as muscular dystrophy. Examples of such muscular dystrophies which may be so treated include Becker's muscular dystrophy, congenital muscular dystrophy, Duchenne muscular dystrophy, distal muscular dystrophy, Emery-Dreifuss muscular dystrophy, facioscapulohumeral muscular dystrophy (FSHD), limb-girdle muscular dystrophy, myotonic muscular dystrophy, and oculopharyngeal muscular dystrophy | 2017-01-26 |
20170022503 | METHODS OF MODULATING WARS2 - The present invention provides methods and agents for modulating WARS2 expression, WARS2 activity, or a combination thereof, thereby modulating angiogenesis. Also provided herein are methods for identifying individuals who could benefit from agents that modulate WARS2 expression, WARS2 activity, or a combination thereof. | 2017-01-26 |
20170022504 | Polycomb-Associated Non-Coding RNAs - This invention relates to long non-coding RNAs (lncRNAs), libraries of those ncRNAs that bind chromatin modifiers, such as Polycomb Repressive Complex 2, inhibitory nucleic acids and methods and compositions for targeting lncRNAs. | 2017-01-26 |
20170022505 | SMALL MOLECULE CONJUGATES FOR INTRACELLULAR DELIVERY OF BIOLOGICALLY ACTIVE COMPOUNDS - The invention provides novel compounds and conjugates of these compounds useful for the delivery of biologically active substances. Further novel design criteria for chemically stabilized siRNA particular useful when covalently attached to a delivery polymer to achieve in vivo mRNA knock down are disclosed therein. | 2017-01-26 |
20170022506 | Methods of Producing a Secreted Protein - The invention is directed to methods of producing a polypeptide or a variant thereof, wherein the polypeptide or variant thereof is dependent on LIMP-2 for trafficking, localization, stabilization and/or sorting of the polypeptide in the cell. In general, the methods comprise culturing a lysosomal integral membrane protein II (LIMP-2) deficient cell which expresses the polypeptide or the variant thereof under conditions in which the polypeptide or the variant thereof is produced. | 2017-01-26 |
20170022507 | CRISPR/CAS-RELATED METHODS AND COMPOSITIONS FOR TREATING CYSTIC FIBROSIS - CRISPR/CAS-related compositions and methods for treatment of Cystic Fibrosis (CF). | 2017-01-26 |
20170022508 | MICROORGANISMS FOR THE PRODUCTION OF ANILINE - A non-naturally occurring microbial organism having an aniline pathway includes at least one exogenous nucleic acid encoding an aniline pathway enzyme expressed in a sufficient amount to produce aniline. The aniline pathway includes (1) an aminodeoxychorismate synthase, an aminodeoxychorismate lyase, and a 4-aminobenzoate carboxylyase or (2) an anthranilate synthase and an anthranilate decarboxylase. A method for producing aniline, includes culturing these non-naturally occurring microbial organisms under conditions and for a sufficient period of time to produce aniline. | 2017-01-26 |
20170022509 | SYNTHETIC MRNA LEADERS - The present invention provides a synthetic mRNA leader for enhancing the expression of a gene encoding a desired protein, vectors comprising said synthetic mRNA leader and methods of producing a desired gene product using said synthetic mRNA leader and vector, said method comprising expressing said gene using a synthetic mRNA leader which comprises from 5′ to 3′: (i) a first mRNA leader sequence element; (ii) a spacer region; and (iii) a second mRNA leader sequence element; wherein said first mRNA leader sequence element is a modified transcription-stimulating mRNA leader capable of enhancing transcription of a gene relative to an unmodified reference mRNA leader sequence and/or said second mRNA leader element is a modified translation-stimulating mRNA leader capable of enhancing the translation of a gene transcript relative to an unmodified reference mRNA leader sequence. | 2017-01-26 |
20170022510 | Attenuated Mannheimia haemolytica - This disclosure provides attenuated | 2017-01-26 |
20170022511 | GENE TARGETING USING MUTANT AGROBACTERIUM STRAINS - The present invention provides methods and compositions for enhancing the efficiency of | 2017-01-26 |
20170022512 | METHODS TO INCREASE PHOTOSYNTHETIC RATES IN PLANTS - Disclosed herein are transgenic plants and plant cells having increased photosynthetic rate, increased biomass production, and/or improved cold tolerance compared to control plants (such as non-transgenic plants of the same species as the transgenic plants). In some examples, the transgenic plants/plant cells contain a plant transformation vector including a nucleic acid encoding a pyruvate orthophosphate dikinase (PPDK) polypeptide. Also disclosed herein are methods for making the transgenic plants, for instance by introducing into progenitor cells of the plant a plant transformation vector including a nucleic acid that encodes a PPDK polypeptide, and growing the transformed progenitor cells to produce a transgenic plant, in which the PPDK nucleic acid is expressed. Further disclosed herein are PPDK-encoding nucleic acids, PPDK polypeptides, and plant transformation vectors of use in producing the transgenic plants or plant cells. | 2017-01-26 |
20170022513 | GENE IMPLICATED IN ABIOTIC STRESS TOLERANCE AND GROWTH ACCELERATING AND USE THEREOF - The present invention provides a method for improving the tolerance of a plant to an abiotic stress and a method for promoting growing of a plant, comprising a nucleotide sequence encoding the AtSRP ( | 2017-01-26 |
20170022514 | WHEAT PLANTS HAVING INCREASED RESISTANCE TO IMIDAZOLINONE HERBICIDES - The present invention is directed to wheat plants having increased resistance to an imidazolinone herbicide. More particularly, the present invention includes wheat plants containing one or more IMI nucleic acids such as a Teal IMI cultivar. The nucleic acids are preferably located on or derived from different genomes. The present invention also includes seeds produced by these wheat plants and methods of controlling weeds in the vicinity of these wheat plants. | 2017-01-26 |
20170022515 | NOVEL HERBICIDE RESISTANCE GENES - The subject invention provides novel plants that are not only resistant to 2,4-D and other phenoxy auxin herbicides, but also to aryloxyphenoxypropionate herbicides. Heretofore, there was no expectation or suggestion that a plant with both of these advantageous properties could be produced by the introduction of a single gene. The subject invention also includes plants that produce one or more enzymes of the subject invention alone or “stacked” together with another herbicide resistance gene, preferably a glyphosate resistance gene, so as to provide broader and more robust weed control, increased treatment flexibility, and improved herbicide resistance management options. More specifically, preferred enzymes and genes for use according to the subject invention are referred to herein as AAD (aryloxyalkanoate dioxygenase) genes and proteins. No α-ketoglutarate-dependent dioxygenase enzyme has previously been reported to have the ability to degrade herbicides of different chemical classes and modes of action. This highly novel discovery is the basis of significant herbicide tolerant crop trait opportunities as well as development of selectable marker technology. The subject invention also includes related methods of controlling weeds. The subject invention enables novel combinations of herbicides to be used in new ways. Furthermore, the subject invention provides novel methods of preventing the formation of, and controlling, weeds that are resistant (or naturally more tolerant) to one or more herbicides such as glyphosate. | 2017-01-26 |
20170022516 | BARLEY PLANTS HAVING INCREASED RESISTANCE TO IMIDAZOLINONE HERBICIDES - The present invention is directed to barley plants having increased resistance to an imidazolinone herbicide. The present invention also includes seeds produced by these barley plants and methods of controlling weeds in the vicinity of these barley plants. | 2017-01-26 |
20170022517 | NOVEL CLASS OF GLYPHOSATE RESISTANCE GENES - The present disclosure relates to a novel class of EPSPS enzymes, and nucleic acids useful in encoding the same. | 2017-01-26 |
20170022518 | SPT6 NUCLEIC ACID MOLECULES TO CONTROL INSECT PESTS - This disclosure concerns nucleic acid molecules and methods of use thereof for control of insect pests through RNA interference-mediated inhibition of target coding and transcribed non-coding sequences in insect pests, including coleopteran pests. The disclosure also concerns methods for making transgenic plants that express nucleic acid molecules useful for the control of insect pests, and the plant cells and plants obtained thereby. | 2017-01-26 |
20170022519 | STABLE EPISOMES BASED ON NON-INTEGRATIVE LENTIVIRAL VECTORS - The invention relates to non-integrative lentiviral vectors and their use for the stable transgenesis of both dividing and no-dividing eukaryotic cells. The invention also provides methods for obtaining these vectors, the use of these vectors for the production of recombinant lentiviruses, and the use of these recombinant lentiviruses for obtaining a cell able to stably produce a product of interest. | 2017-01-26 |
20170022520 | MULLER CELL-SPECIFIC PROMOTER - The present invention provides an isolated nucleic acid molecule comprising, or consisting of, the nucleic acid sequence of SEQ ID NO:1 or a nucleic acid sequence of at least 400 bp having at least 80% identity to said sequence of SEQ ID NO:1, wherein said isolated nucleic acid molecule specifically leads to the expression in Muller cells of a gene when operatively linked to a nucleic acid sequence coding for said gene. | 2017-01-26 |
20170022521 | NANOPARTICLE MEDIATED DELIVERY OF SEQUENCE SPECIFIC NUCLEASES - Provided are methods for introducing a sequence-specific nuclease into a plant cell comprising a cell wall. Methods are provided for genetically or otherwise modifying plants and for treating or preventing disease in plant cells comprising a cell wall. | 2017-01-26 |
20170022522 | PRODUCTION OF BIOGAS FROM ORGANIC MATERIALS - Waste or organic material is compressed at a pressure sufficient to burst cells, for example 50 bar or more, and separated into a dry fraction and a wet fraction. The wet fraction is treated in an anaerobic digester to produce biogas after removing grit. The wet fraction is diluted, preferably with sludge, before it is degritted. Optionally, floatables are removed from the fraction before it is added to the digester. | 2017-01-26 |
20170022523 | BIOMASS LIQUEFACTION PROCESSES, AND USES OF SAME - Described are processes for the liquefaction of lignocellulosic biomass under the digestive action of dicarboxylic acid(s). Such digests can exhibit enhanced flowability, reduced volume, and significant biomass conversion to dissolved components, and can in some embodiments be further liquefied by contact with an enzyme. Products resultant of these steps can be used for their sugar content to manufacture biofuels or other products. | 2017-01-26 |
20170022524 | COMPOSITIONS AND METHODS FOR THE BIOSYNTHESIS OF 1,4-BUTANEDIOL AND ITS PRECURSORS - The invention provides a non-naturally occurring microbial biocatalyst including a microbial organism having a 4-hydroxybutanoic acid (4-HB) biosynthetic pathway having at least one exogenous nucleic acid encoding 4-hydroxybutanoate dehydrogenase, succinyl-CoA synthetase, CoA-dependent succinic semialdehyde dehydrogenase, or α-ketoglutarate decarboxylase, wherein the exogenous nucleic acid is expressed in sufficient amounts to produce monomeric 4-hydroxybutanoic acid (4-HB). Also provided is a non-naturally occurring microbial biocatalyst including a microbial organism having 4-hydroxybutanoic acid (4-HB) and 1,4-butanediol (BDO) biosynthetic pathways, the pathways include at least one exogenous nucleic acid encoding 4-hydroxybutanoate dehydrogenase, succinyl-CoA synthetase, CoA-dependent succinic semialdehyde dehydrogenase, 4-hydroxybutyrate:CoA transferase, 4-butyrate kinase, phosphotransbutyrylase, α-ketoglutarate decarboxylase, aldehyde dehydrogenase, alcohol dehydrogenase or an aldehyde/alcohol dehydrogenase, wherein the exogenous nucleic acid is expressed in sufficient amounts to produce 1,4-butanediol (BDO). Additionally provided is a method for the production of 4-HB. The method includes culturing a non-naturally occurring microbial organism having a 4-hydroxybutanoic acid (4-HB) biosynthetic pathway including at least one exogenous nucleic acid encoding 4-hydroxybutanoate dehydrogenase, succinyl-CoA synthetase, CoA-dependent succinic semialdehyde dehydrogenase or α-ketoglutarate decarboxylase under substantially anaerobic conditions for a sufficient period of time to produce monomeric 4-hydroxybutanoic acid (4-HB). Further provided is a method for the production of BDO. The method includes culturing a non-naturally occurring microbial biocatalyst, comprising a microbial organism having 4-hydroxybutanoic acid (4-HB) and 1,4-butanediol (BDO) biosynthetic pathways, the pathways including at least one exogenous nucleic acid encoding 4-hydroxybutanoate dehydrogenase, succinyl-CoA synthetase, CoA-dependent succinic semialdehyde dehydrogenase, 4-hydroxybutyrate:CoA transferase, 4-hydroxybutyrate kinase, phosphotranshydroxybutyrylase, α-ketoglutarate decarboxylase, aldehyde dehydrogenase, alcohol dehydrogenase or an aldehyde/alcohol dehydrogenase for a sufficient period of time to produce 1,4-butanediol (BDO). The 4-HB and/or BDO products can be secreted into the culture medium. | 2017-01-26 |
20170022525 | METHOD FOR PRODUCING METHACRYLIC ACID ESTER AND NOVEL METHACRYLIC ACID ESTER SYNTHETASE - Provided is a method for producing a methacrylic acid ester using a biocatalyst, said method comprising a step of reacting an alcohol or a phenol with methacrylyl-CoA in the presence of an alcohol acyltransferase originated from a plant selected from the group consisting of a plant belonging to the genus | 2017-01-26 |
20170022526 | METHOD FOR PRODUCING RARE FATTY ACID USING NOVEL ENZYME, AND NOVEL RARE FATTY ACID - The present invention provides production of hydroxylated fatty acid by a hydration reaction using a novel enzyme derived from | 2017-01-26 |
20170022527 | ENGINEERED IMINE REDUCTASES AND METHODS FOR THE REDUCTIVE AMINATION OF KETONE AND AMINE COMPOUNDS - The present disclosure provides engineered polypeptides having imine reductase activity, polynucleotides encoding the engineered imine reductases, host cells capable of expressing the engineered imine reductases, and methods of using these engineered polypeptides with a range of ketone and amine substrate compounds to prepare secondary and tertiary amine product compounds. | 2017-01-26 |
20170022528 | METHOD FOR PRODUCING ANILINE DERIVATIVE BY FERMENTATION FROM CARBON SOURCE - Provided is a method for producing an aniline derivative by fermentation from a carbon source such as glucose. The method comprises the following steps: production of microorganisms capable of producing 1.8 g/L or more of 4-aminophenylalanine (4APhe) under prescribed culture conditions by introducing at least three exogenous genes into microorganisms having the ability to biosynthesize 4-aminophenylpyruvic acid from chorismic acid; and production of at least one aniline derivative selected from the group consisting of 4-aminophenylalanine (4APhe), 4-aminocinnamic acid (4ACA), 2-(4-aminophenyl)aldehyde, 4-aminophenylacetic acid, and 4-aminophenethylethanol (4APE) by bringing these microorganisms into contact with a carbon source under conditions suited to the growth and/or maintenance of these microorganisms. | 2017-01-26 |
20170022529 | SYSTEMS AND METHODS FOR PRODUCING A SUGAR STREAM - An improved dry grind system and method for producing a sugar stream from grains or similar carbohydrate sources and/or residues, such as for biofuel production. In particular, a sugar/carbohydrate stream, which includes a desired Dextrose Equivalent (DE) where DE describes the degree of conversion of starch to dextrose (aka glucose) and/or has had removed therefrom an undesirable amount of unfermentable components, can be produced after saccharification and prior to fermentation (or other sugar conversion process), with such sugar stream being available for biofuel production, e.g., alcohol production, or other processes. In addition, the systems and methods also can involve the removal of certain grain components, e.g., corn kernel components, including protein, oil and/or fiber, prior to fermentation or other conversion systems. In other words, sugar stream production and/or grain component separation occurs on the front end of the system and method. | 2017-01-26 |
20170022530 | PROCESSING BIOMASS - Provided are methods of inducing enzymes, and for treating cellulosic and lignocellulosic biomass with the enzyme. | 2017-01-26 |
20170022531 | A PROCESS FOR PRODUCTION OF A PROTEIN OF INTEREST IN A MICROBIAL HOST ORGANISM - A process for production of a protein of interest in a microbial host organism comprising the steps of: | 2017-01-26 |
20170022532 | Method for Awakening Silent Gene Clusters in Bacteria and Discovery of Cryptic Metabolites - The majority of clinically used antibiotics and anticancer agents are derived from bacterial small molecules. These molecules are produced by dedicated biosynthetic gene clusters, sets of genes that are responsible for the step-wise generation of the target small molecule. Recent investigations have indicated, to the surprise of many experts, that the majority of these biosynthetic genes are inactive or ‘silent’ for unknown reasons. Thus under typical bacterial culturing conditions, these genes are not expressed and consequently the bioactive small molecule products are not synthesized. Disclosed is a method for high throughput screening of elicitors of cryptic metabolites, a method for producing cryptic metabolites, and a new family of cryptic metabolites, the acybolins, as well as their complete structural elucidation. | 2017-01-26 |
20170022533 | DEVICES, SYSTEMS AND METHODS FOR SAMPLE PREPARATION - Devices, systems and methods including a sonicator for sample preparation are provided. A sonicator may be used to mix, resuspend, aerosolize, disperse, disintegrate, or de-gas a solution. A sonicator may be used to disrupt a cell, such as a pathogen cell in a sample. Sample preparation may include exposing pathogen-identifying material by sonication to detect, identify, or measure pathogens. A sonicator may transfer ultrasonic energy to the sample solution by contacting its tip to an exterior wall of a vessel containing the sample. Multipurpose devices including a sonicator also include further components for additional actions and assays. Devices, and systems comprising such devices, may communicate with a laboratory or other devices in a system for sample assay and analysis. Methods utilizing such devices and systems are provided. The improved sample preparation devices, systems and methods are useful for analyzing samples, e.g. for diagnosing patients suffering from infection by pathogens. | 2017-01-26 |
20170022534 | METHOD AND MEDIUM FOR DETECTING SHIGA TOXIN-PRODUCING ESCHERICHIA COLI BACTERIA - The present invention relates to a method for specific and direct detection of Shiga toxin-producing | 2017-01-26 |
20170022535 | METHOD AND APPARATUS FOR DETECTING AND QUANTIFYING BACTERIAL SPORES ON A SURFACE - A method and an apparatus for detecting and quantifying bacterial spores on a surface. In accordance with the method: bacterial spores are transferred from a place of origin to a test surface, the test surface comprises lanthanide ions. Aromatic molecules are released from the bacterial spores; a complex of the lanthanide ions and aromatic molecules is formed on the test surface, the complex is excited to generate a characteristic luminescence on the test surface; the luminescence on the test surface is detected and quantified. | 2017-01-26 |
20170022536 | URINE METABOLITE MONITORING DEVICE AND MANAGEMENT SYSTEM - A simple and painless device and management system for measuring and analyzing levels of metabolites in urine. The portable, electronic device is easily placed inside a toilet and can wirelessly transmit the collected and synthesized data to smart mobile devices and alert other individuals of dangerous levels detected by the device. The device is self-cleaning and requires no manipulation by the user. | 2017-01-26 |
20170022537 | LUMINESCENCE MEASUREMENT OF BIOLOGIAL SAMPLES UTILIZING DUAL REAGENTS - In a method for measuring luminescence of a biological sample utilizing two different luminescence reagents, the sample is agitated to improve mixing with the second luminescence reagent, allowing for a shorter delay time between injection of the second reagent and measurement of the resulting luminescence activity. The improved mixing may also allow for a shorter measurement time, thereby improving throughput when assaying a large number of samples. | 2017-01-26 |
20170022538 | MULTIPLE-EMULSION NUCLEIC ACID AMPLIFICATION - Multiple-emulsion nucleic acid amplification allows nucleic acids contained in biological systems to be detected, quantitated and/or sorted based on their sequence as detected with nucleic acid amplification techniques, e.g., PCR. The nucleic acids can be free floating or contained within living or nonliving structures, including particles, viruses, and cells. The nucleic acids can include, e.g., DNA or RNA. Systems and devices for use in practicing methods of the disclosure are also provided. | 2017-01-26 |
20170022539 | CHIP FOR ANALYSIS OF TARGET SUBSTANCE - The present invention provides a chip for analysis of a target substance that is compact and allows analysis of a target substance with less time and effort. The chip for analysis of a target substance includes a first flexible substrate | 2017-01-26 |
20170022540 | BIOINK FOR THREE-DIMENSIONAL BIOMATERIAL PRINTING - A method of creating “bioink” has been proposed, which increases the shelf-life and transportability of biological materials for use in bioprinting applications. The current invention also contemplates a composition of biomaterials admixed with trehalose to dehydrate the biomaterials for preservation and transportation. The dehydrated biomaterials can then be rehydrated for use in bioprinting. | 2017-01-26 |
20170022541 | COMPOSITE LIQUID CELLS - A sample handling method may include drawing an encapsulating liquid from an encapsulating-liquid input; discharging the drawn encapsulating liquid (a) onto a free surface of a carrier liquid in a carrier-liquid conduit comprising a stabilisation feature and (b) proximate to the stabilisation feature, the encapsulating liquid being immiscible with the carrier liquid, so that the discharged encapsulating liquid does not mix with the carrier liquid, floats on top of the carrier liquid, and is immobilised by the stabilisation feature; drawing a sample liquid from a sample-liquid input; and discharging the drawn sample liquid, the sample liquid being immiscible with the encapsulating liquid and with the carrier liquid, so that the sample liquid does not mix with the encapsulating liquid or with the carrier liquid. | 2017-01-26 |
20170022542 | METHODS FOR CULTURE AND IDENTIFICATION OF MYCROBACTERIUM AVIUM SUBSPECIES IN CROHN'S DISEASE - Method and media for diagnosing Crohn's disease are provided. A method of diagnosing Crohn's disease in patients includes: obtaining a sample from an individual; culturing the sample to determine the presence or absence of | 2017-01-26 |
20170022543 | METHODS AND KITS TO IDENTIFY KLEBSIELLA STRAINS - Embodiments of the invention provide a method of detecting one or more strains of | 2017-01-26 |
20170022544 | NUCLEOTIDE SEQUENCE, UNIVERSAL REVERSE PRIMER, UNIVERSAL RT PRIMER, METHOD FOR DESIGNING PRIMER AND miRNA DETECTION METHOD - A nucleotide sequence having SEQ ID NO:1, a universal reverse primer having SEQ ID NO:2, a universal RT primer, a method for designing primer, and a miRNA detection method are provided. In the miRNA detection method, the universal RT primer is used for the cDNA synthesis of a miRNA sample and the universal reverse primer is used for cDNA molecule amplification in qPCR quantitative detection. The universal reverse primer sequence, the nucleotide sequence, and the design rules are used in the method for designing primer, so as to design a primer for qPCR quantitative detection. | 2017-01-26 |
20170022545 | RNA MICROARRAY FOR DETECTING INTERACTION BETWEEN PROTEIN AND RNA CONTAINING A HIGHER-ORDER STRUCTURE - Interaction with a protein is detected by using an RNA probe containing the following sequences;
| 2017-01-26 |
20170022546 | DETECTION AND QUANTIFICATION OF METHYLATION IN DNA - Provided are methods and systems for characterizing a biomolecular parameter of a polynucleotide. A polynucleotide of interest from a sample comprising a heterogeneous mixture of polynucleotides is concentrated and provided to a first fluid compartment of a solid-state nanopore. An electric potential is established across the solid-state nanopore to force the polynucleotide of interest from a first fluid compartment to a second fluid compartment via the nanopore. A passage parameter output is monitored during passage of the polynucleotide of interest through the nanopore, wherein the passage parameter output depends on the biomolecular parameter status of the polynucleotide of interest. In this manner, the methods and systems are compatible with a wide range of applications, including epigenetic modifications to DNA indicative of a disease state such as cancer, in an integrated, reliable and low cost system. | 2017-01-26 |
20170022547 | AMPLIFICATION OF NANOPARTICLE BASED ASSAY - An automated multiplex detector system includes: (a) a nucleic acid amplification compartment for amplifying nucleic acid of one or more targets in a sample, and (b) an analysis compartment in fluid communication with the amplification compartment, the analysis compartment housing a nanoparticle-based multiplex detector capable of using the amplified nucleic acid of the amplification compartment and producing a signal that correlates with the presence of the one or more targets in the sample. | 2017-01-26 |
20170022548 | USE OF A POROUS CAPILLARY MEMBRANE FOR DETERMINING THE AMOUNT OF ROLLING CIRCLE AMPLIFICATION PRODUCTS - A method of sample analysis is provided. In certain embodiments, the method may comprise: (a) filtering a liquid sample containing rolling circle amplification (RCA) products using a porous capillary membrane, thereby producing an array of the RCA products on the membrane; wherein the sample contains at least a first population of RCA products and a second population of RCA products, wherein the first and second populations of labeled RCA products are distinguishably labeled; and (b) determining the amount of the first labeled population of RCA products and the amount of the second labeled population of RCA products in an area of the membrane. | 2017-01-26 |
20170022549 | Multi-Channel Optical Measurement Instrument - A receptacle having a plurality of interconnected chambers arranged to permit multiple process steps or processes to be performed independently or simultaneously. The receptacles are manufactured to separate liquid from dried reagents and to maintain the stability of the dried reagents. An immiscible liquid, such as an oil, is included to control loading of process materials, facilitate mixing and reconstitution of dried reagents, limit evaporation, control heating of reaction materials, concentrate solid support materials to prevent clogging of fluid connections, provide minimum volumes for fluid transfers, and to prevent process materials from sticking to chamber surfaces. The receptacles can be adapted for use in systems having a processing instrument that includes an actuator system for selectively moving fluid substances between chambers and a detector. The actuator system can be arranged to concentrate an analyte present in a sample. The detector can be used to detect an optical signal emitted by the contents of the receptacle. | 2017-01-26 |
20170022550 | AMPLIFICATION AND DETECTION OF NUCLEIC ACIDS - The present disclosure relates to a sample assessment device. By way of example, the sample assessment device may include a substrate including a sample application region; an amplification region comprising a plurality of amplification reagents; a waste region comprising an entrance fluidically coupled to the amplification region and extending away from the amplification region; and a detection region spaced apart from the amplification region. The sample assessment device may also include a valve coupled to the substrate and configured to separate the amplification region from the detection region in a closed configuration, wherein the amplification region and the valve are positioned on the sample assessment device between the sample application region and the detection region and wherein the sample assessment device is configured to permit lateral flow from the amplification region to the detection region when the valve is in an open configuration. | 2017-01-26 |
20170022551 | METHODS AND COMPOSITIONS FOR REDUCING NON-SPECIFIC AMPLIFICATION PRODUCTS - Methods, compositions, systems and kits to amplify or improve amplification of target-specific amplification products by reducing non-specific amplification products (e.g., primer-dimers) when amplifying multiple different nucleotide regions. The methods, compositions, systems and kits described herein may include, or include the use of, one or more resolvases that recognize and bind to and/or cut an aberrant DNA structure. | 2017-01-26 |
20170022552 | Methods and Systems for Quantification Without Standard Curves - A method for quantitation of biological material in a biological sample is provided. The method includes receiving amplification data from amplification of a first and a second reference sample and receiving amplification data from amplification of a biological sample. The method further includes determining an efficiency from the received amplification data from amplification of the first and second reference sample. The method includes determining a relative PCR efficiency for the biological sample. Next, the method includes determining a quantity of biological material in the biological sample using the relative PCR efficiency. | 2017-01-26 |
20170022553 | NUCLEIC ACID SEQUENCING METHODS AND SYSTEMS - The present disclosure provides compositions, methods and systems for sequencing a template nucleic acid using a polymerase based, nucleic acid binding reaction involving examination of the interaction between a polymerase and template nucleic acid in the presence of one or more unlabeled nucleotides. The methods rely, in part, on identifying a base of a template nucleic acid during nucleic acid synthesis by controlling the sequencing reaction conditions. Template nucleic acid bases may be identified during an examination step followed by an optional incorporation step. | 2017-01-26 |
20170022554 | MULTIPLE TAGGING OF INDIVIDUAL LONG DNA FRAGMENTS - This disclosure provides methods and compositions for tagging long fragments of a target nucleic acid for sequencing and analyzing the resulting sequence information in order to reduce errors and perform haplotype phasing, for example. | 2017-01-26 |
20170022555 | MODULAR FLOW CELLS AND METHODS OF SEQUENCING - Modular flow cells, devices with modular flow cells, and methods of sequencing using modular flow cells, as well as systems and kits including modular flow cells, are described, permitting sequencing wherein less than the full capacity for sequencing is desired. | 2017-01-26 |
20170022556 | POLYNUCLEOTIDE SEQUENCING METHODS - Methods for determining the sequence of a polynucleotide comprising the steps of (i) contacting a polynucleotide processive enzyme immobilised in a fixed position, with a target polynucleotide under conditions sufficient to induce enzyme activity; (ii) detecting an effect consequent on the interaction of the enzyme and the polynucleotide, wherein the effect is detected by measurement of a non-linear optical signal or a linear signal coupled to a non-linear signal. | 2017-01-26 |
20170022557 | METHOD OF TARGET MOLECULE CHARACTERISATION USING A MOLECULAR PORE - The invention relates to a new method of determining the presence, absence or one or more characteristics of multiple analytes. The invention concerns coupling a first analyte to a membrane containing a detector and investigating the first analyte using the detector. The invention also concerns coupling a second analyte to the membrane and investigating the second analyte. The first analyte is uncoupled from the membrane prior to investigating the second analyte. The invention also relates to polynucleotide sequencing. | 2017-01-26 |
20170022558 | INTEGRATED SYSTEM FOR NUCLEIC ACID SEQUENCE AND ANALYSIS - An integrated end-to-end system for large-scale, high-quality nucleic acid sequencing having a nucleic acid extraction module, a library preparation module, a nucleic acid sequencing module, and a data analysis module reversibly integrated with one another and having components that are physically loosely-coupled within such system and reversibly integrated for sequence interrogation and analysis. This system is fully automated from sample to data output. A workflow management system is integrated across all system components and provides an intuitive user interface for managing system operations. | 2017-01-26 |
20170022559 | METHODS AND COMPOSITIONS FOR NUCLEIC ACID SEQUENCING - The present disclosure provides methods and systems for detecting multiple different nucleotides in a sample. In particular, the disclosure provides for detection of multiple different nucleotides in a sample utilizing fewer detection moieties than the number of nucleotides being detected and/or fewer imaging events than the number of nucleotides being detected. | 2017-01-26 |
20170022560 | HIGH THROUGHPUT SCREENING OF POPULATIONS CARRYING NATURALLY OCCURRING MUTATIONS - Efficient methods are disclosed for the high throughput identification of mutations in genes in members of mutagenized populations. The methods comprise DNA isolation, pooling, amplification, creation of libraries, high throughput sequencing of libraries, preferably by sequencing-by-synthesis technologies, identification of mutations and identification of the member of the population carrying the mutation and identification of the mutation. | 2017-01-26 |
20170022561 | RISK ASSESSMENT FOR PHENYTOIN-INDUCED ADVERSE DRUG REACTIONS - A method of predicting the risk of a patient for developing phenytoin-induced adverse drug reactions (ADRs), including Stevens-Johnson syndrome (SJS), toxic epidermal necrolysis (TEN), or drug reactions with eosinophilia and systemic symptoms (DRESS) is disclosed. Genetic polymorphisms of CYP2C genes (including rs1057910 (CYP2C9*3) and rs3758581 on CYP2C19), and HLA alleles (including HLA-B*1502, HLA-B*1301, and HLA-B*5101) can predict adverse reactions caused by phenytoin or fosphenytoin. Accordingly, the present invention provides a kit to assess the risk of a patient for developing adverse reactions in response to phenytoin-related drugs, which comprises the determination of the presence of a specific allele selected from the group consisting of rs1057910 (CYP2C9*3), rs3758581 on CYP2C19, HLA-B*1502, HLA-B*1301, and HLA-B*5101, wherein the presence of at least one allele is indicative of a risk for the adverse drug reactions. | 2017-01-26 |
20170022562 | Biomarkers and Therapeutic Targets for Abnormal Retinal Pigment Epithelium - The present invention relates to markers and therapeutic targets of abnormal retinal pigment epithelium (RPE). | 2017-01-26 |
20170022563 | GENETIC POLYMORPHISMS ASSOCIATED WITH CORONARY EVENTS AND DRUG RESPONSE, METHODS OF DETECTION AND USES THEREOF - The present invention provides compositions and methods based on genetic polymorphisms that are associated with coronary heart disease (particularly myocardial infarction), aneurysm/dissection, and/or response to drug treatment, particularly statin treatment. For example, the present invention relates to nucleic acid molecules containing the polymorphisms, variant proteins encoded by these nucleic acid molecules, reagents for detecting the polymorphic nucleic acid molecules and variant proteins, and methods of using the nucleic acid molecules and proteins as well as methods of using reagents for their detection. | 2017-01-26 |
20170022564 | GENETIC POLYMORPHISMS ASSOCIATED WITH PSORIASIS, METHODS OF DETECTION AND USES THEREOF - The present invention is based on the discovery of genetic polymorphisms that are associated with psoriasis and related pathologies. In particular, the present invention relates to nucleic acid molecules containing the polymorphisms, including groups of nucleic acid molecules that may be used as a signature marker set, such as a haplotype, a diplotype, variant proteins encoded by such nucleic acid molecules, reagents for detecting the polymorphic nucleic acid molecules and proteins, and methods of using the nucleic acid and proteins as well as methods of using reagents for their detection. | 2017-01-26 |
20170022565 | BIOMARKER PAIRS FOR PREDICTING PRETERM BIRTH - The disclosure provides a pair of isolated biomarkers selected from the group consisting of IBP4/SHBG, IBP4/PSG3, IBP4/LYAM1, IBP4/IGF2, CLUS/IBP3, CLUS/IGF2, CLUS/LYAM1, INHBC/PSG3, INHBC/IGF2, PSG2/LYAM1, PSG2/IGF2, PSG2/LYAM1, PEDF/PSG3, PEDF/SHBG, PEDF/LYAM1, CD14/LYAM1, and APOC3/LYAM1, wherein the pair of biomarkers exhibits a change in reversal value between pregnant females at risk for pre-term birth and term controls. Also provided is a method of determining probability for preterm birth in a pregnant female, the method comprising measuring in a biological sample obtained from the pregnant female a reversal value for at least one pair of biomarkers selected from the group consisting of IBP4/SHBG, IBP4/PSG3, IBP4/LYAM1, IBP4/IGF2, CLUS/IBP3, CLUS/IGF2, CLUS/LYAM1, INHBC/PSG3, INHBC/IGF2, PSG2/LYAM1, PSG2/IGF2, PSG2/LYAM1, PEDF/PSG3, PEDF/SHBG, PEDF/LYAM1, CD14/LYAM1, and APOC3/LYAM1 to determine the probability for preterm birth in the pregnant female. | 2017-01-26 |
20170022566 | CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE REGULATOR GENE MUTATIONS - The present invention provides novel mutations of the CFTR gene related to cystic fibrosis or to conditions associated with cystic fibrosis. The mutations include duplication of exons including duplication of exons 6b through 10. Methods of identifying if an individual contains the exons 6b through 10 duplication are provided as well as nucleic acid fragments that contain the junction site of the duplicated segment. The detection of additional mutations in the CFTR gene are also provided. | 2017-01-26 |