25th week of 2010 patent applcation highlights part 62 |
Patent application number | Title | Published |
20100160195 | Aniline Compounds as Ashless TBN Sources and Lubricating Oil Compositions Containing Same - Aniline compounds useful as ashless TBN sources for lubricating oil compositions that are compatible with fluoroelastomeric engine seal materials, and lubricating oil compositions containing such aniline compounds. | 2010-06-24 |
20100160196 | Power Transmission Fluids with Improved Viscometric Properties - A copolymer which can be used in power transmission fluids to provide improved viscometric properties is disclosed. The copolymer includes a mixture of alcohols having side chains with an average number of carbons ranging from greater than 8 to less than 12 defined by the following formula: | 2010-06-24 |
20100160197 | Highly basic calcium carboxylate compositions and method of preparation - Environmentally friendly, shelf-stable overbased calcium carboxylate compositions and their method of preparation are described. The subject compositions possess anti-oxidation and anti-wear properties superior to those associated with existing sulfonate compositions. The subject compositions are prepared by neutralizing a mixture of two different molecular weight aliphatic carboxylic acids or anhydrides in the presence of an aromatic or aliphatic hydrocarbon solvent; adding a mixture of calcium oxide and calcium hydroxide; adding methyl alcohol to promote the reaction; carbonating the mixture with carbon dioxide at temperatures between 80° F. and 120° F.; heating to 200°-250° F. and finishing carbonation; adding diluent oil to the crude product; clarifying the product in solvent; and removing the solvent. | 2010-06-24 |
20100160198 | FRICTION MODIFIERS AND/OR WEAR INHIBITORS DERIVED FROM HYDROCARBYL AMINES AND CYCLIC CARBONATES - A lubricating oil composition comprising a major amount of base oil of lubricating viscosity and a minor amount of an additive comprising the reaction product obtained by reacting a cyclic carbonate and a hydrocarbyl amine having the formula: | 2010-06-24 |
20100160199 | METAL PROCESSING LUBRICANT COMPOSITION - The present invention relates to metal processing lubricant compositions that are based on polyhydrocarbyl esters of aliphatic polyols, in particular tetrahydrocarbyl esters of pentaerythritol, wherein at least one hydrocarbyl group of the tetrahydrocarbyl ester comprises 6-14 carbon atoms and the other hydrocarbyl groups comprise 6-20 carbon atoms. The compositions are in particular suitable for metal forming operations, e.g. a cold rolling operation, a hot rolling operation or a drawing operation, and metal removing operations, e.g. grinding, milling, cutting, turning and honing. | 2010-06-24 |
20100160200 | Cleaning liquid for semiconductor device and cleaning method - The invention provides a cleaning liquid for semiconductor devices which is capable of removing deposits on a surface of an object to be cleaned including a photoresist, an antireflective film, an etching residue and an ashing residue at a low temperature in a short period of time with reduced environmental burdens and without causing corrosion of an interlayer dielectric film, a metal, a metal nitride, and an alloy in the object to be cleaned. The cleaning liquid for semiconductor devices according to the invention contains a reducing agent and a surfactant and has a pH of 10 to 14. | 2010-06-24 |
20100160201 | Natural Disinfecting Cleaners - A cleaning composition with a limited number of natural ingredients contain a hydrophobic syndetic, a hydrophilic syndetic, and a biguanide or a cationic quaternary ammonium salt. The cleaning composition can be used to clean laundry, soft surfaces, and hard surfaces and cleans as well or better than commercial compositions containing synthetically derived cleaning agents. | 2010-06-24 |
20100160202 | Detergent Composition - A detergent composition comprising; a) a non-phosphorous based builder which is an amino acid based compound or a succinate based compound, b) one or more enzymes which are destabilised by the non-phosphorous containing builder and c) a stabilisation system for the one or more enzymes. The stabilising system comprising one or more divalent metal ion salts and a non-ionic surfactant. Preferably the builder is the tetrasodium salt of glutamic-N,N-diacetic acid and the enzyme comprises protease. The preferred divalent metal ion salts are calcium salts. | 2010-06-24 |
20100160203 | CLEANING FORMULATIONS FOR MACHINE DISHWASHING COMPRISING HYDROPHILICALLY MODIFIED POLYCARBOXYLATES - The invention relates to a phosphate-free cleaning formulation for machine dishwashing, comprising as components: a) 1 to 20% by weight of copolymers of a1) 50 to 93 mol % acrylic acid and/or of a water-soluble salt of acrylic acid, a2) 5 to 30 mol % of methacrylic acid and/or of a water-soluble salt of methacrylic acid and a3) 2 to 20 mol % of at least one nonionic monomer of the formula (I), b) 1 to 50% by weight of complexing agents chosen from the group consisting of glycine-N,N-diacetic acid derivatives and glutamic acid-N,N-diacetic acid and salts thereof, c) 1 to 15% by weight of low-foaming nonionic surfactants, d) 0 to 30% by weight of bleaches and optionally bleach activators, e) 0 to 60% by weight of further builders, f) 0 to 8% by weight of enzymes, g) 0 to 50% by weight of one or more further additives, such as anionic or zwitterionic surfactants, bleach catalysts, alkali carriers, corrosion inhibitors, antifoams, dyes, fragrances, fillers, organic solvents and water, where the sum of components a) to g) is 100% by weight. | 2010-06-24 |
20100160204 | Detergents - Dishwasher detergents containing: a) 10 to 60 percent by weight of a builder; and b) non-ionic surfactant of the general formula | 2010-06-24 |
20100160205 | Low-Density Cleaning Substrate - The present invention is directed to a low-density substrate, which has an optimized pore volume distribution. The optimized pore volume distribution allows the substrate to hold at least 50 percent of its cumulative volume within pores with a radius size of about 110 to 250 microns. The optimized pore volume distribution can also be characterized by having a dry fibrous web that absorbs less than 20 percent of the cumulative volume of the fibrous web at a pore radius of 75 microns. The optimized pore volume distribution of the substrate enables it to controllably release a fluid composition effectively onto a surface. The basis weight of the substrate is about 80 to 20 gsm and the density of the substrate is below 0.1 g/cc. The substrate may be a pre-loaded wipe, which is either moistened by a consumer prior to use or moistened prior to packaging. The composition loaded onto the substrate may contain dry and/or liquid compositions preferably for cleaning hard or soft surfaces. | 2010-06-24 |
20100160206 | SURFACTANT COMPOSITION - The invention relates to a surfactant composition containing an alkyl ether sulfate represented by the following formula (1): | 2010-06-24 |
20100160207 | Feedback Prodrug - Compounds and methods for use in selectively inhibiting a lytic enzyme based on feedback inhibition. The conjugated compound serves as a substrate for a lytic enzyme. Cleavage of the conjugated compound by the lytic enzyme releases an inhibitor of the enzyme. | 2010-06-24 |
20100160208 | Pharmaceutical composition - The invention concerns a pharmaceutical composition comprising at least one stimulator of the immune cell functions and at least one substance inhibiting the cell proliferation and/or inducing cell death. In a preferred embodiment the stimulator of the function of the immune system and/or the immune cells are antagonists of TGF-beta selected from the group of oligonucleotides hybridizing with an area of the messenger RNA and or DNA encoding TGF-beta and the at least one substance inhibiting cell proliferation and/or inducing cell death is selected from the group of temozolomide, nitrosoureas, Vinca alkaloids, antagonists of the purine and pyrimidines bases, cytoststatic active antibiotics, caphthotecine derivatives, anti estrogens, anti-androgens and analogs of gonadotropin releasing hormone. | 2010-06-24 |
20100160209 | Composition and Method for Increasing Cell Permeability of a Compound - The invention provides for a cell permeable peptide conjugated to an insulin compound for improved cell penetration of the insulin moiety. The composition may be delivered by intravenous, intramuscular, subcutaneous, intranasal, oral inhalation, intrarectal, intravaginal or intraperitoneal means for the treatment, including prophylaxis of Type I, Type II diabetes, prediabetes and/or metabolic syndrome. | 2010-06-24 |
20100160210 | GUANIDINIUM DELIVERY CARRIERS - Disclosed herein are transmembrane transporter compounds containing guanidinium groups. Also disclosed herein are methods for transporting a biologically active moiety across a biological membrane using the transmembrane transporter compounds. Particularly, this invention provides a method for the delivery of a biologically active moiety across the biological membranes of such membranes as endothelial tissues. | 2010-06-24 |
20100160211 | GLYCOPEPTIDE PHOSPHONATE DERIVATIVES - Disclosed are glycopeptides that are substituted with one or more substituents each comprising one or more phosphono groups; and pharmaceutical compositions containing such glycopeptide derivatives. The disclosed glycopeptide derivatives are useful as antibacterial agents. | 2010-06-24 |
20100160212 | Modified Human Plasma Polypeptide or Fc Scaffolds and Their Uses - Modified human plasma polypeptides or Fc and uses thereof are provided. | 2010-06-24 |
20100160213 | ANTIMICROBIAL AND ANTICANCER LIPOPEPTIDES - The invention provides lipophilic conjugates comprising a peptide coupled to a fatty acid, the peptide comprising at least two positively charged amino acid residues, said peptide after conjugation to the fatty acid possessing antibacterial, antifungal, and/or anticancer activity higher than prior to conjugation. The lipophilic conjugates are suitable for treatment of infections caused by pathogenic organisms such as bacteria and fungi. The lipophilic conjugates are also suitable for sanitation, as disinfectants, or for food preservation. | 2010-06-24 |
20100160214 | DESMOPRESSIN COMPOSITION - Disclosed is a pharmaceutical formulation that may be used in the treatment of nocturia, primary nocturnal enuresis, incontinence, urinary frequency, diabetes insipidus, or any disease or syndrome where desmopressin therapy is useful or where safe temporary suppression of urine production may lead to beneficial health effects or increased convenience in voiding control. | 2010-06-24 |
20100160215 | ANTIBIOTIC COMPOSITIONS FOR THE TREATMENT OF GRAM NEGATIVE INFECTIONS - Provided herein are novel compounds and novel protected compounds that can be derived from polymyxin, including, e.g., polymyxin B | 2010-06-24 |
20100160216 | ENHANCED TRANSPORT USING MEMBRANE DISRUPTIVE AGENTS - Compositions and methods for transport or release of therapeutic and diagnostic agents or metabolites or other analytes from cells, compartments within cells, or through cell layers or barriers are described. The compositions include a membrane barrier transport enhancing agent and are usually administered in combination with an enhancer and/or exposure to stimuli to effect disruption or altered permeability, transport or release. In a preferred embodiment, the compositions include compounds which disrupt endosomal membranes in response to the low pH in the endosomes but which are relatively inactive toward cell membranes (at physiologic pH, but can become active toward cell membranes if the environment is acidified below ca. pH 6.8), coupled directly or indirectly to a therapeutic or diagnostic agent. Other disruptive agents can also be used, responsive to stimuli and/or enhancers other than pH, such as light, electrical stimuli, electromagnetic stimuli, ultrasound, temperature, or combinations thereof. The compounds can be coupled by ionic, covalent or H bonds to an agent to be delivered or to a ligand which forms a complex with the agent to be delivered. Agents to be delivered can be therapeutic and/or diagnostic agents. Treatments which enhance delivery such as ultrasound, iontopheresis, and/or electrophereis can also be used with the disrupting agents. | 2010-06-24 |
20100160217 | ACETYLYCHOLINE GATED ION CHANNEL CHAPERONS AND METHODS OF USING THE SAME - The present invention provides receptor chaperons and means for producing cells having increased and/or decreased expression of nAChR subunit combinations and/or nAChR subtypes, which provide useful models for investigating pharmacological properties of the receptors and regulation of the binding sites of potential nAChR subtypes. | 2010-06-24 |
20100160218 | Airway Administration of Tissue Factor Pathway Inhibitor in Inflammatory Conditions Affecting the Respiratory Tract - The present invention provides methods for the local treatment of acute and chronic extravascular pulmonary fibrin deposition and/or reducing unwanted effects associated with systemic administration of natural anticoagulants to a subject via airway administration to the subject by intratracheal, intrabronchial or intraalveolar routes of natural anticoagulants or biologically active derivatives thereof. | 2010-06-24 |
20100160219 | Novel Polypeptides Inducing Dendritic Cell Migration, as Well as Medicines and Pharmaceutical Compositions Containing Same - The invention concerns a polypeptide corresponding to amino acids 26 to 75 of the sequence of GRA5-RH protein of SEQ ID No 1: MASVKRVWAVMIVNVLALIFVGVAGSTRDVGSGGDDSEGARGRE QQQVQQHEQNEDRSLFERGRAAVT-GHPVRTAVGLAAAWAWSLL RLLKRRRRRAIQEESKESATAEEEEVAEEE, its variants acting on dendritic cell migration, homologues acting on dendritic cell migration, and fragments thereof acting on dendritic cell migration, as well as the pharmaceutical compositions thereof comprising such polypeptides and their use for making a medicine for preventing or treating skin and mucous membrane conditions involving dendritic cells or Langerhans cells. | 2010-06-24 |
20100160220 | Compositions and Methods for Improving Bone Mass Through Modulation of Novel Receptors of PTH and Fragments Thereof - The present invention relates to the discovery of novel receptors for the signaling of PTH and/or fragments of PTH, and the role of cPTH in bone development. The novel PTH receptors identified are selected from the group consisting of LRP5/6, TGFβRII, BMPRII (long form and short form), ActRIIA, and ActRIIB. Specifically, the present invention provides a novel screening tool for identifying compounds that improve bone mass by affecting certain pathways that promote or downregulate bone-forming activity. This promotion of bone-forming activity could provide for treatments for bone-loss or bone density disorders and/or kidney disease. The invention further encompasses the compounds, PTH ligands, and fragments of PTH ligands described herein; pharmaceutical compositions comprising the compounds, PTH ligands, or fragments of PTH ligand; and methods of increasing bone density using the compounds, PTH ligands, or fragments of PTH ligands. | 2010-06-24 |
20100160221 | EFFECT OF TULA ON HIV - A method of inhibiting a retrovirus production, the method includes administering a retrovirus inhibitor selected from at least one of a TULA protein, a fragment of TULA containing a UBA domain, a UBA domain of TULA, a peptide mimicking TULA, a peptide mimicking a fragment of TULA containing a UBA domain, a peptide mimicking a UBA domain of TULA, a polynucleotide encoding TULA, a polynucleotide encoding a fragment of TULA containing a UBA domain, a polynucleotide encoding a UBA domain of TULA, a polynucleotide encoding a peptide mimicking TULA, a polynucleotide encoding a peptide mimicking a fragment of TULA containing a UBA domain, a polynucleotide encoding a peptide mimicking the UBA domain of TULA, fragments thereof, muteins thereof, variants and splice variants thereof, and combinations thereof to a cell or a tissue infected by a retrovirus. | 2010-06-24 |
20100160222 | Treatment of Psoriasis through Down-Regulation of the EGF-Receptor with Topically Applied EGF - A topical formulation containing epidermal growth factor for treating psoriasis is described. | 2010-06-24 |
20100160223 | Synergetic Effects of HGF and Antibacterial Treatment - A method of treating an infection and/or an injury caused or complicated by an infection in a mammal, comprising providing an antibiotic or fungicide and either HGF or a polypeptide exhibiting HGF activity to said mammal. In one embodiment, the injury is not a chronic skin ulcer. | 2010-06-24 |
20100160224 | SHELF-STABLE CONSUMABLE COMPOSITIONS CONTAINING PROBIOTIC-MIMICKING ELEMENTS AND METHODS OF PREPARING AND USING THE SAME - A shelf-stable consumable composition may comprise one or more Probiotic-Mimicking Elements (PMEs) wherein the median particle size of the one or more PMEs is less than the median particle size of a probiotic from which the one or more PMEs were derived. In some embodiments, the median particle size of the one or more PMEs may be less than about 0.2 microns. In some embodiments, the PMEs may comprise at least one of peptides, fatty acids, bacteriocins, cell surface proteins, phospholipids, teichoic acids, and nucleic acids, and may be combined with one or more prebiotics, such as oligosaccharides, inulin, short-chain fructo-oligosaccharides, xylooligosaccharides, galactooligosaccharides, soyoligosaccharides, and lactulose/lactitol. Methods for preparing and using a shelf-stable consumable composition for promoting digestive health in a subject are also described. | 2010-06-24 |
20100160225 | Lefty, lefty derivatives and uses thereof - The disclosure relates to Lefty derivatives and the uses of Lefty polypeptides as antagonists of the function of certain ligands such as Nodal, GDF-8 (Myostatin), and GDF-11. These derivatives may be fused to other functional heterologous proteins such as IgG, especially the Fc portion of IgG. According to the disclosure, Lefty polypeptides are useful in the treatment of a variety of disorders, including, for example, neuronal diseases, muscle and bone conditions, and metabolic disorders. | 2010-06-24 |
20100160226 | Y-RECEPTOR AGONISTS - Human Pancreatic Polypeptide mutants are provided which have utility, inter alia, for regulation of energy intake or energy metabolism, control of intestinal secretion, decrease of gastrointestinal tract motility, decrease of rate of gastric emptying, treatment of obesity or overweight, or conditions in which obesity or overweight is a contributory factor. | 2010-06-24 |
20100160227 | SIGNALING PEPTIDES - The present invention provides novel peptides of specified sequence and their use as a signal peptide or a membrane-anchoring peptide. It also relates to chimeric polypeptide comprising one or more such peptides and a polypeptide of interest as well as nucleic acid molecules, vectors, infections vital particles and host cells encoding such peptides and chimeric polypeptides. The present invention also relates to a pharmaceutical composition comprising such elements and a pharmaceutically acceptable vehicle. The present invention also provides a method for recumbently producing a polypeptide using such peptides, especially for directing expression of a polypeptide of interest extracellularly or anchored at the surface of the plasma membrane. | 2010-06-24 |
20100160228 | METHOD FOR INHIBITING OR STIMULATING ANGIOGENESIS IN AN INDIVIDUAL - The invention concerns a method for inhibiting vascular endothelial growth factor receptor 2 (VEGFR2) signalling in an individual by administering an effective amount of an agent capable of activating T cell protein tyrosine phosphatase (TCPTP), and a method for inhibiting angiogenesis and treating or preventing diseases related thereto. Furthermore, this invention concerns a method for stimulating angiogenesis or for treatment or prevention of a disease benefiting from increasing the growth of blood vessels in an individual by inhibiting TCPTP. | 2010-06-24 |
20100160229 | TREATMENT OF EARLY-STAGE OSTEOARTHRITIS - A method for treating early-stage osteoarthritis in an animal is provided. The method comprises delivery of a therapeutically effective amount of a parathyroid hormone (PTH) or a PTH derived substance to an affected joint cavity of the patient. Methods for inhibiting articular chondrocytes apoptosis and for inhibiting a degenerative process of articular chondrocytes in an afflicted animal are also provided. | 2010-06-24 |
20100160230 | UBIQUITIN AND UBIQUITIN RELATED MOLECULES FOR TREATMENT AND PREVENTION OF HARMFUL ACTIVATION OF THE IMMUNE SYSTEM - Compositions and methods for suppressing the immune system of a mammal using ubiquitin and derivatives and analogs thereof. | 2010-06-24 |
20100160231 | AXMI-150 DELTA-ENDOTOXIN GENE AND METHODS FOR ITS USE - Compositions and methods for conferring pesticidal activity to bacteria, plants, plant cells, tissues and seeds are provided. Compositions including a coding sequence for pesticidal polypeptides are provided. The coding sequences can be used in DNA constructs or expression cassettes for transformation and expression in plants and bacteria. Compositions also include transformed bacteria, plants, plant cells, tissues, and seeds. In particular, isolated pesticidal nucleic acid molecules are provided. Additionally, amino acid sequences corresponding to the polynucleotides are encompassed. In particular, the present invention provides for isolated nucleic acid molecules having nucleotide sequences encoding the amino acid sequence shown in SEQ ID NO:2, the nucleotide sequence set forth in SEQ ID NO:1, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12, as well as variants and fragments thereof. | 2010-06-24 |
20100160232 | PHYSIOLOGICALLY ACTIVE COMPLEX COMPRISING PROTAMINE AND/OR SALT THEREOF AND AN ACIDIC MACROMOLECULAR SUBSTANCE, AND USE THEREOF - To provide a method of reducing an intrinsic harsh/astringent taste of protamine and a protamine salt and effectively using a fat absorption suppressive effect of these. | 2010-06-24 |
20100160233 | ANTITUMOUR COMBINATIONS CONTAINING A VEGF INHIBITING AGENT AND IRINOTECAN - Disclosed are antitumor combinations of VEGF inhibitors with Irinotecan and the use thereof in the treatment of neoplastic diseases. | 2010-06-24 |
20100160234 | CELL-PROLIFERATION INHIBITING VPG PROTEINS, FRAGMENTS OR ANALOGS THEREOF AND THEIR APPLICATIONS - Use of VPg proteins, fragments or analogs thereof having the ability to bind an eukaryotic initiation factor eIF4E, for inhibiting cell-proliferation. | 2010-06-24 |
20100160235 | FGF HOMOLOGS COMPOSITIONS AND USES THEREOF - The present invention relates to methods of using zFGF5 compositions to proliferate chondrocytes and their progenitors, and to induce deposition of cartilage. zFGF5 compositions are disclosed for treating disorders associated with chondrocytes, such as cartilage injuries and defects. In addition, methods for treating neurological disorders, such as stroke, are disclosed, and methods for using zFGF5 compositions to stimulate growth of cells associated with neurological injury and disease are disclosed. | 2010-06-24 |
20100160236 | Method for Preventing Formation of Trisulfide Derivatives of Polypeptides - A method for reducing or substantially preventing formation of a trisulfide derivative of a polypeptide in a liquid medium containing the polypeptide ijn question comprises stripping the liquid medium with a gas, suitably a chemically unreactive gas such as nitrogen or argon. | 2010-06-24 |
20100160237 | DRY FEEDSTUFF FOR CONTROLLING EXCESS WEIGHT AND OBESITY OF DOGS - The invention concerns a dry feedstuff designed to feed dogs containing at least 35% of proteins relative to dry matter, and/or a protein input more than 110 grams per 1 000 kcal of metabolizable energy, and its use as food, additive or veterinary medicine in particular for controlling excess weight and obesity in dogs. | 2010-06-24 |
20100160238 | TGFP-CAP Peptide and its Uses - The present invention relates to a GFP-CAP peptide having an amino acid sequence derived from TGF-β1 (transforming growth factor-β1) and a cell adhesion sequence, wherein the amino acid sequence derived from TGF-β1 consists of the amino acid sequence of SEQ ID NO:1 and the TGFP-CAP peptide is represented by the following formula I: Ile-Trp-Ser-Leu-Asp-Thr-Gln-Tyr-Cell adhesion sequence (I). The TGFP-CAP peptide of the present invention exhibits excellent anti-angiogenic activity. In addition, the TGFP-CAP peptide of the present invention prevents effectively melanin generation in skin to have skin whitening effects. The present peptide shows much higher stability and permeability to skin than natural-occurring TGF-β1. Such plausible activities and safety of the present peptide enable advantageously to application to drugs, quasi-drugs and cosmetics. | 2010-06-24 |
20100160239 | PEPTIDE NUCLEIC ACID BASED GUANIDINIUM COMPOUNDS - Disclosed herein are transmembrane transporter compounds containing guanidinium groups to enhance transport across biomembranes. Therapeutic and other biologically active moieties may be attached to the compounds. The transmembrane transporter compounds may include peptide nucleic acid monomer units. | 2010-06-24 |
20100160240 | TREATMENT FOR EPILEPSY - The invention provides methods of treating a patient having epilepsy in which an effective regime of an agent that inhibits specific binding of PSD-95 to an NMDA receptor is administered to a patient. | 2010-06-24 |
20100160241 | NOVEL COMPOUND HAVING GPR54 AGONISTIC ACTIVITY - The present invention provides a compound represented by the following formula (1); | 2010-06-24 |
20100160242 | Antibacterial deodorant - By selecting one or more deodorizing agents from among glycine, cysteine and glycylglycine, and incorporating the selected deodorizing agent(s) and a surfactant, the toxicity of the surfactant to men and beasts is controlled without inhibiting the antibacterial actions that the surfactant has inherently. Glycine, cysteine, and glycylglycine each have a strong deodorizing action. The invention causes antibacterial deodorants to further have a deodorizing action by using such deodorizing agents. Moreover, the invention increases the permeating ability, thereby enhancing both the antibacterial action and the deodorizing action by subjecting water to treatment for fragmenting a cluster of the water and then adding the resulting active water as a diluent, or by preparing the diluent by incorporating alcohol to the active water. | 2010-06-24 |
20100160243 | COMPOUNDS AND METHODS FOR ENHANCING ERYTHROPOIESIS - Compounds and methods for enhancing erythropoiesis. The compound contains a chemical structure of the formula (I) indicated below, in which R is a glucosyl group. In addition to having an erythropoiesis effect, the compound of the formula (1) is effective in enhancing erythropoietin formation, and increasing kidney function and expression of hepatocyte growth factor. The method includes the step of administering an effective amount of the compound of the formula (I) to a subject in need thereof and thereby results in an enhancement of erythropoiesis. | 2010-06-24 |
20100160244 | METHODS AND COMPOSITIONS FOR ENHANCING COLLAGEN, PROTEOGLYCAN, AND GLUTATHIONE SYNTHESIS IN THE SKIN - A composition for application to the skin can stimulate the in vivo synthesis of collagen and proteoglycans and improve the appearance of the skin, increasing its elasticity and fullness. In general, a composition according to the present invention comprises: (1) an antioxidant compound in a quantity sufficient to enhance collagen synthesis in the skin; (2) an organic penetrant in which the antioxidant compound is soluble in a sufficient quantity that a concentration of the antioxidant compound sufficient to enhance collagen synthesis can be applied topically and penetrate the skin; (3) a mixture of essential amino acids or hydrolyzed whey protein; (4) a supplemental source of sulfur; and (5) a topical pharmaceutically acceptable carrier. The antioxidant compound can be lipoic acid or a lipoic acid analogue or derivative. The organic penetrant is preferably benzyl alcohol. Other ingredients, such as esters of tocopherol and ascorbic acid, can be included. | 2010-06-24 |
20100160245 | Quercetin-Containing Compositions - This invention relates to a composition containing quercetin, vitamin B3, and vitamin C. Also disclosed is a method of using the composition for enhancing physical or mental performance or treating various diseases or disorders. | 2010-06-24 |
20100160246 | MICROSPHERES FOR TREATMENT OF BRAIN TUMORS - There is provided a new use of microspheres comprising a water-insoluble, water-swellable polymer which is anionically charged at pH7, and electrostatically associated with the polymer, in releasable form, a cationically charged chemotherapeutic agent, in the manufacture of a composition for use in the treatment of a brain tumour, wherein in the treatment the composition is introduced into the brain and the chemotherapeutic agent is released from the microspheres, wherein the microspheres, when equilibrated in water at 37° C., comprise at least 40 wt % water based on weight of polymer plus water. Compositions comprising the microspheres and methods for the treatment of brain tumours are also provided. | 2010-06-24 |
20100160247 | Synthesis of deuterated morpholine derivatives - The present invention is directed to a process for preparing a 2,26,6-d | 2010-06-24 |
20100160248 | ISOTOPICALLY MODIFIED COMPOUNDS AND THEIR USE AS FOOD SUPPLEMENTS - A nutrient composition comprises an essential nutrient in which at least one exchangeable H atom is | 2010-06-24 |
20100160249 | NANOPARTICLE DERIVATIVES OF GEMCITABINE - The use of squalenic acid or a derivative thereof in formulating at least one polar active principle with a molecular weight of 100 Da or more, in the form of nanoparticles, and pharmaceutical compositions thereof. | 2010-06-24 |
20100160250 | METHOD FOR TREATING INFLAMMATORY CONDITIONS - This invention provides a method for inhibiting the release of interleukin-1β in a mammal. This invention also provides a method for preventing or treating pulmonary diseases, ophthalmic diseases, and autoimmune diseases that are associated with inflammation or inflammatory conditions. The invention also provides a method for preventing or treating neurodegenerative diseases, or pain in a mammal. The method comprises administering to a mammal in need thereof a therapeutically effective amount of a mononucleoside compound, which is an antagonist of P2X | 2010-06-24 |
20100160251 | IMIDAZO COMPOUNDS - The present invention relates to the use of at least one lactose-derived C-glycoside of general formula (I): | 2010-06-24 |
20100160252 | OPHTHALMIC COMPOSITIONS CONTAINING MUCOADHESIVE POLYSACCHARIDES ABLE TO PROMOTE CORNEAL RE-EPITHELIZATION - Ophthalmic solutions containing arabinogalactans with a protective activity on the corneal epithelium, particularly suitable for use as artificial tears stimulating the recovery of corneal lesions and also particularly useful for contact lens users, containing from 1% to 10% by weight of arabinogalactan in an aqueous solution and possible other excipients, among which tonicity-adjusting agents, pH correctors, buffers and preservatives, except for benzalkonium chloride. | 2010-06-24 |
20100160253 | SULPHATED XYLANS FOR TREATMENT OR PROPHYLAXIS OF RESPIRATORY DISEASES - The present invention relates generally to agents and medicinal protocols useful in the prophylaxis and/or treatment of respiratory diseases or conditions such as asthma, allergic rhinitis and chronic obstructive pulmonary disease (COPD). More particularly, the present invention relates to the use of a sulfated xylan or a derivative or homolog thereof in the treatment of respiratory diseases or conditions. | 2010-06-24 |
20100160254 | Cellulose Sulfate for the Treatment of Rhinovirus Infection - The present invention provides the use of a polymer for the manufacture of an antiviral pharmaceutical composition for the treatment of a rhinovirus infection, wherein the polymer is cellulose sulfate. | 2010-06-24 |
20100160255 | SPIRO-CYCLIC COMPOUND - The present invention provides a compound represented by the formula (I): | 2010-06-24 |
20100160256 | INDAZOLE COMPOUNDS - Provided are compounds represented by the following formula (A-1) and formula (1), or salts thereof. The compounds of formula (A-1) and formula (1) or salts thereof have 133 adrenergic receptor agonist activity, and thus are useful as therapeutic and prophylactic agent for diabetes mellitus, obesity, hyperlipidemia, depression, diseases caused by gallstones or hypermotility of the biliary tract, diseases caused by hyperactivity of the digestive tract, interstitial cystitis, overactive bladder or urinary incontinence, or as therapeutic and prophylactic agents for diseases concomitant with decreased tears. | 2010-06-24 |
20100160257 | USE OF HDAC INHIBITORS FOR THE TREATMENT OF MYELOMA - The present invention relates to the use of an HDAC inhibitor, especially an HDAC inhibitor of formula (I) | 2010-06-24 |
20100160258 | Bicyclic aryl sphingosine 1-phosphate analogs - Compounds that have agonist activity at one or more of the S1P receptors are provided. The compounds are sphingosine analogs that, after phosphorylation, can behave as agonists at S1P receptors. | 2010-06-24 |
20100160259 | DOSAGE REGIMEN FOR A S1P RECEPTOR AGONIST - S1P receptor modulators or agonists are administered following a dosage regimen whereby during the initial days of treatment the daily dosage is lower than the standard daily dosage | 2010-06-24 |
20100160260 | TRBD-Binding Effectors and Methods for Using the Same to Modulate Telomerase Activity - The present invention embraces compounds selected for interacting with the T-pocket of telomerase and use thereof for modulating the activity of telomerase and preventing or treating diseases or conditions associated with telomerase. | 2010-06-24 |
20100160261 | POLYUNSATURATED FATTY ACID MONOGLYCERIDES, DERIVATIVES, AND USES THEREOF - There are provided various polyunsaturated fatty acid monoglycerides and derivatives thereof. These compounds can be useful as cancer chemopreventive agents, cancer treating agent, inhibiting tumor growth or cell proliferation, reducing tumor growth or as radioenhencers for radiotherapy of cancer. | 2010-06-24 |
20100160262 | COMPOSITIONS AND METHODS FOR MODULATING SIRTUIN ACTIVITY - The present invention provides treatment methods involving modulating a sirtuin activity and/or a sirtuin mRNA and/or a sirtuin polypeptide level. In some embodiments, the present invention provides treatment methods involving modulating SIRT1 activity and/or SIRT mRNA and/or polypeptide level. The present invention provides methods of inhibiting SIRT1 Tat deacetylase activity. Methods of inhibiting SIRT1 Tat deacetylase activity are useful for treating immunodeficiency virus infections, particularly human immunodeficiency virus (HIV) infection. Thus, the present invention provides methods of treating an immunodeficiency virus infection, generally involving inhibiting SIRT1 Tat deacetylase activity. The present invention further provides methods of identifying agents that modulate sirtuin activity (e.g., SIRT1 activity), particularly ability of sirtuins to interact with (e.g., bind and/or deacetylate) a substrate, e.g., a viral substrate such as a Tat polypeptide. The present invention further provides active agents that modulate sirtuin activity or expression; and compositions, including pharmaceutical compositions, comprising the active agents. | 2010-06-24 |
20100160263 | 7,9-SUBSTITUTED TETRACYCLINE COMPOUNDS - The present invention pertains to novel 7,9-substituted tetracycline compounds. These tetracycline compounds can be used to treat numerous tetracycline compound-responsive states, such as bacterial infections and neoplasms, as well as other known applications for minocycline and tetracycline compounds in general, such as blocking tetracycline efflux and modulation of gene expression. | 2010-06-24 |
20100160264 | CRYSTALLINE SOLID FORMS - The present invention relates to the new crystalline solid form VI and VIII of tigecycline and processes for the production of form VI and VIII. It further relates to a new method for preparing Form I and Form III in high polymorphic purity. | 2010-06-24 |
20100160265 | 7, 8 AND 9-SUBSTITUTED TETRACYCLINE COMPOUNDS - 7, 8 and 9-substituted tetracycline compounds, methods of treating tetracycline responsive states, and pharmaceutical compositions containing the 7, 8 and 9-substituted tetracycline compounds are described. | 2010-06-24 |
20100160266 | ORGANIC COMPOUNDS - A pleuromutilin in the form of a salt with salicylic acid, azelaic acid, sebacic acid or 2-[(2,6-dichlorophenyl)amino]benzeneacetic acid. | 2010-06-24 |
20100160267 | Treatment of Inflammatory Bowel Disease With 2-Methylene-19-Nor-Vitamin D Compounds - A method of preventing and/or treating inflammatory bowel disease, particularly ulcerative colitis and Crohn's disease, is disclosed. The method involves administering a 2-methylene-19-nor-vitamin D compound in an amount effective to treat the disease. The administration of a 2-methylene-19-nor-vitamin D compound also prevents the development of or delays the onset of inflammatory bowel disease in susceptible individuals. The preferred compounds are 1α-hydroxy-2-methylene-19-nor-homopregnacalciferol and 2-methylene-19-nor-20(S)-1α,25-dihydroxyvitamin D | 2010-06-24 |
20100160268 | Isoflavonoid Analogs and their Metal Conjugates as Anti-Cancer Agents - A pharmacologic agent for treating and/or preventing cancer, among other diseases and conditions, and particularly breast, prostate, and pancreatic cancer, in humans and animals. The novel pharmacologic agent is an isoflavonoid or isoflavonoid mimetic covalently attached to a cytotoxic pharmacophore that, preferably has the ability to conjugate with a metal salt to form a more potent metal complex, particularly a Cu(II) complex. The isoflavonoid or isoflavonoid mimetic may he non-fragmented steroidal hormone, such as progesterone which is structurally related to the isoflavone genistein, or a small molecule hormone mimetic, such as chromone. An illustrative non-fragmented steroidal embodiment is 17-acetyl-10,13-dimethyl-1,2,6,7,8,9,11,12,13,14,15, 16,17-tetradecahydrocyclopenta[a]phenanthren-3-thiosemicarbazone and its Cu(II) complex. Effective chromone analogs include the thiosemicarbazone and hydrazone analogs of 4-oxo-4H-chromene-3-carboxaldehyde and their Cu(IT) complexes. | 2010-06-24 |
20100160269 | Use of N-(dibenz(B,F)oxepin-10-ylmethyl)-N-methyl-N-prop-2-ynylamine or a pharmaceutically acceptable addition salt thereof for the prophylaxis and/or treatment of muscular dystrophy - The invention relates to the use of a compound of the formula (I) | 2010-06-24 |
20100160271 | BICYCLIC MODULATORS OF H1 RECEPTORS - The present invention relates to new bicyclic modulators of H1 receptor activity, pharmaceutical compositions thereof, and methods of use thereof | 2010-06-24 |
20100160272 | OXEPINE MODULATORS OF H1 RECEPTORS AND/OR INHIBITORS OF MAST CELL DEGRANULATION - The present invention relates to new oxepine modulators of H1 receptors and/or inhibitors of mast cell degranulation, pharmaceutical compositions thereof, and methods of use thereof. | 2010-06-24 |
20100160273 | CONTROLLED DELIVERY SYSTEM OF ANTIFUNGAL AND KERATOLYTIC AGENTS FOR LOCAL TREATMENT OF FUNGAL INFECTIONS OF THE NAIL AND SURROUNDING TISSUES - A topical sustained release delivery system for delivery of antifungal agents to the finger or toenails achieving high penetration through the nails by combining the antifungal agent with a keratolytic agent and a humectant. The pharmaceutical sustained release topical preparation is provided in a varnish or spray form for treating the nail and surrounding tissues, where the active ingredient is an antifungal agent, a keratolytic agent or combination thereof. The composition may further include an antibacterial, an antiviral, an antipsoriatic agents, or combinations thereof. | 2010-06-24 |
20100160274 | 7-KETO DHEA for Psychiatric Use - The present invention relates to the use of 3-acetyl-7-oxo-dehydroepiandrosterone (7-keto DHEA) in the preparation of a medicament to treat or ameliorate psychiatric conditions. The present invention relates to methods of using compositions comprising 7-keto DHEA to treat or ameliorate psychiatric conditions. These methods include administering an effective amount of a composition comprising 7-keto DHEA in an acceptable carrier, alone or in combination with other psychiatric drugs to reduce or ameliorate symptoms of a psychiatric condition. This method may be used alone or as an adjunctive treatment for treating a wide variety of psychiatric conditions. | 2010-06-24 |
20100160275 | METHODS AND COMPOSITIONS FOR CANCER PREVENTION AND TREATMENT - The present invention relates to methods and compositions for cancer prevention and treatment. In particular, the present invention provides methods and compositions for modulating, studying, preventing and treating progesterone receptor related carcinogenesis with anti-progesterones and anti-estrogens. | 2010-06-24 |
20100160276 | SYNTHETIC BILE ACID COMPOSITIONS AND METHODS - Bile acids and related compositions and methods of synthesis and use. More specifically, deoxycholic acid and related compositions, said compositions being free of all moieties of animal origin and free of pyrogenic moieties. | 2010-06-24 |
20100160277 | COMPOSITIONS FOR COMBATING BETA-LACTAMASE-MEDICATED ANTIBIOTIC RESISTANCE USING BETA-LACTAMASE INHIBITORS USEFUL FOR INJECTION - The invention describes a composition for combating beta-lactamase-mediated antibiotic resistance using beta-lactamase inhibitor useful for injection, capable of pharmaceutical application. The invention relates to pharmaceutical composition containing ceftriaxone (normally as ceftriaxone sodium) and sulbactam (normally as sulbactam sodium). Such compositions are found to be useful for intramuscular or intravenous administration as antibiotics for hospitalized patients with serious infections. Specifically, this invention relates to a pharmaceutical composition further including an aminocarboxylic acid chelating agent, for example, ethylenediaminetetraacetic acid (EDTA), or a pharmaceutically acceptable salt thereof. The pharmaceutical compositions of this invention have been found normally to enhance resistance to particulate formation in solutions to be administered parenterally. The invention also gives details of the dosage forms stored in sealed containers to be reconstituted before use. The invention also gives a process to manufacture these compositions. The invention gives a method of treating a subject having a condition or disorder, wherein a treatment with ceftriaxone sodium and sulbactam sodium is indicated. | 2010-06-24 |
20100160278 | STABILIZED FREEZE-DRIED FORMULATION FOR CEPHALOSPORIN DERIVATIVES - The present invention relates to a freeze-dried formulation for cephalosporin derivatives having increased stability, a solution for obtaining and a method for preparing such a formulation, as well as the use of certain compounds for stabilizing cephalosporin derivatives in freeze-dried formulations. The compounds preferably used as stabilizers according to the invention are mannitol, trehalose, and PVP. | 2010-06-24 |
20100160279 | Azetidine Derivatives as Muscarinic Receptor Antagonists - The invention relates to compounds of formula (I) processes and intermediates for their preparation, their use as muscarinic antagonists and pharmaceutical compositions containing them. | 2010-06-24 |
20100160280 | AMINOPYRIDINE AND CARBOXYPYRIDINE COMPOUNDS AS PHOSPHODIESTERASE 10 INHIBITORS - Pyridine and pyrimidine compounds: | 2010-06-24 |
20100160281 | MONOCARBAMS - The invention relates to compounds of formula (I): | 2010-06-24 |
20100160282 | NOVEL DIPHENYLAZETIDINONES, PROCESS FOR THEIR PREPARATION, MEDICAMENTS COMPRISING THESE COMPOUNDS AND THEIR USE - Compounds of the formula I, | 2010-06-24 |
20100160283 | HETEROARYL-SUBSTITUTED ALKYNE COMPOUNDS AND METHOD OF USE - The present invention comprises a new class of compounds useful for the prophylaxis and treatment of protein kinase mediated diseases, including inflammation, cancer and related conditions. The compounds have a general Formula I | 2010-06-24 |
20100160284 | CARBAPENEM ANTIBACTERIALS WITH GRAM-NEGATIVE ACTIVITY AND PROCESSES FOR THEIR PREPARATION - The present invention provides β-methyl carbapenem compounds and pharmaceutical compositions useful in the treatment of bacterial infections and methods for treating such infections using such compounds and/or compositions. The invention includes administering an effective amount of a carbapenem compound or salt and/or prodrug thereof to a host in need of such a treatment. The present invention is also in the field of synthetic organic chemistry and is specifically provides an improved method of synthesis of β-methyl carbapenems which are useful as antibacterial agents. | 2010-06-24 |
20100160285 | Biphenyloxyacetic Acid Derivatives for the Treatment of Respiratory Disease - The invention relates to substituted phenoxyacetic acids of formula (I), where the variables are as defined in claim | 2010-06-24 |
20100160286 | HETEROARYLCARBAMOYLBENZENE DERIVATIVES FOR THE TREATMENT OF DIABETES - Compounds of formula (I) | 2010-06-24 |
20100160287 | COMPOUNDS USEFUL AS INHIBITORS OF JANUS KINASES - The present invention relates to compounds useful as inhibitors of protein kinases, particularly of JAK family kinases. The invention also provides pharmaceutically acceptable compositions comprising said compounds and methods of using the compositions in the treatment of various disease, conditions, or disorders. | 2010-06-24 |
20100160288 | Purine Compounds - A compound of the formula: | 2010-06-24 |
20100160289 | SULFONAMIDES AS TRPM8 MODULATORS - Disclosed are compounds, compositions and methods for treating various diseases, syndromes, conditions and disorders, including pain. Such compounds are represented by Formula (I) and Formula (II) as follows: | 2010-06-24 |
20100160290 | PHARMACEUTICAL COMPOSITION FOR TREATING ALZHEIMER'S DISEASE - A pharmaceutical composition for treating Alzheimer's disease containing a compound represented by the general formula (I); | 2010-06-24 |
20100160291 | TRICYCLIC SPIRO-OXINDOLE DERIVATIVES AND THEIR USES AS THERAPEUTIC AGENTS - This invention is directed to tricyclic spiro-oxindole derivatives of formula (I), wherein j, k, m, n, w, q, Y, Q, X, R | 2010-06-24 |
20100160292 | Kinase Inhibitors, and Methods of Using and Identifying Kinase Inhibitors - Methods of inhibiting BTK activity by inhibiting phosphorylation of Y551 of BTK, methods of treating patients by inhibiting BTK activity by inhibiting phosphorylation of Y551 of BTK, chemical entities that bind to BTK and inhibited complexes are provided. | 2010-06-24 |
20100160293 | Solid Ophthalmic Drug for External Use - An ophthalmic solid pharmaceutical preparation for external use is disclosed which can be used to continuously administer with ease a pharmacologically active agent to ocular local tissues. The pharmaceutical preparation is a solid pharmaceutical preparation containing a pharmacologically active ingredient in a base, which may comprise an oily base, and designed to be applied by being rubbed on the surface of the skin including the surface of either of the eyelids to deliver, through the skin of the eyelids, the pharmacologically active ingredient to the local tissues of the eye located on the backside of the eyelids. | 2010-06-24 |
20100160294 | TOLERABILITY OF MIRTAZAPINE AND A SECOND ACTIVE BY USING THEM IN COMBINATION - A reduction in the side effects of treating with an agent having combined 5HT | 2010-06-24 |
20100160295 | TREATMENT OF RESTLESS LEG SYNDROME AND SLEEP DISORDERS - Methods of preventing and/or treating at least one symptom of Restless Leg Syndrome (RLS) and its related disorders, including disorders such as periodic limb movements in sleep (PLMS) and periodic limb movement disorder (PLMD), are disclosed. The methods comprise identifying a host, afflicted with Restless Leg Syndrome (RLS) and its related disorders; and administering to the host a pharmaceutically effective amount of a 4-hydroxyphenylpyruvate dioxygenase. Also provided are methods and compositions for treating/preventing sleep disorders, and methods and compositions for improving sleep quantity and adequacy. | 2010-06-24 |