48th week of 2021 patent applcation highlights part 29 |
Patent application number | Title | Published |
20210371468 | METHODS AND COMPOSITIONS FOR NOROVIRUS VACCINES AND DIAGNOSTICS - The present invention is directed to methods and compositions for norovirus therapeutics, such as vaccines, and diagnostics. | 2021-12-02 |
20210371469 | VIRUS VECTORS FOR TARGETING OPHTHALMIC TISSUES - The present disclosure provides AAV capsid proteins comprising a modification in the amino acid sequence and virus vectors comprising the modified AAV capsid protein. The disclosure also provides methods of administering the vims vectors and vims capsids of the disclosure to a cell or to a subject in vivo. | 2021-12-02 |
20210371470 | COMPOSITIONS AND METHODS FOR DELIVERY OF AAV - The disclosure provides compositions and methods for the preparation, manufacture, formulation and therapeutic use of adeno-associated virus (AAV) particles for the prevention and/or treatment of diseases. | 2021-12-02 |
20210371471 | ANTIBODY-EVADING VIRUS VECTORS - The present disclosure provides AAV capsid proteins comprising a modification in the amino acid sequence and virus vectors comprising the modified AAV capsid protein. The disclosure also provides methods of administering the virus vectors and virus capsids of the disclosure to a cell or to a subject in vivo. | 2021-12-02 |
20210371472 | INFLUENZA VIRUS HEMAGGLUTININ MUTANTS - The present invention relates to the production of modified influenza viral proteins in plants. More specifically, the present invention relates to producing and increasing influenza virus-like particle (VLP) production in plants, wherein the VLPs comprise the modified influenza viral proteins, such as modified influenza hemagglutinin (HA). The HA protein may comprising an amino acid sequence comprising at least one substitution when compared to a corresponding wildtype amino acid sequence. Further provided are nucleic acid encoding the modified HA protein. Furthermore methods of producing an influenza virus like particle (VLP) and methods of increasing yield of production of an influenza virus like particle (VLP) in a plant, portion of a plant, or a plant cell, are also provided. | 2021-12-02 |
20210371473 | AXMI477, AXMI482, AXMI486 AND AXMI525 TOXIN GENES AND METHODS FOR THEIR USE - Compositions and methods for conferring pesticidal activity to bacteria, plants, plant cells, tissues and seeds are provided. Compositions comprising a coding sequence for a toxin polypeptide are provided. The coding sequences can be used in DNA constructs or expression cassettes for transformation and expression in plants and bacteria. Compositions also comprise transformed bacteria, plants, plant cells, tissues, and seeds. In particular, isolated toxin nucleic acid molecules are provided. Additionally, amino acid sequences corresponding to the polynucleotides are encompassed, and antibodies specifically binding to those amino acid sequences. In particular, the present invention provides for isolated nucleic acid molecules comprising nucleotide sequences encoding the amino acid sequence shown in SEQ ID NO:5-26, or the nucleotide sequence set forth in SEQ ID NO:1-4, as well as variants and fragments thereof. | 2021-12-02 |
20210371474 | Tuberculosis Compositions And Methods Of Using The Same - The present disclosure provides fusion proteins comprising | 2021-12-02 |
20210371475 | METHOD FOR THE TREATMENT OF A RELAPSING-REMITTING CONDITION - The present invention relates to a method for the acute treatment of a relapsing-remitting condition, the method comprising the step of administering to a subject in need thereof one or more doses of an effective amount of a peptide molecule as defined in claim | 2021-12-02 |
20210371476 | AFFINITY-ENHANCED MONMERIC STREPTAVIDIN CHIMERIC ANTIGEN RECEPTOR (CAR) - A chimeric antigen receptor is disclosed that includes: (a) an extracellular high affinity streptavidin; (b) a hinge domain from CD8; (c) a CD28 transmembrane domain; (d) an intracellular 4-1BB and/or CD28 signaling domain; and (e) an intracellular CD3 zeta signaling domain, wherein (a)-(e) are in N-terminal to C-terminal order. Nucleic acids encoding this chimeric antigen receptor, and T and natural killer (NK) cells transformed with this chimeric antigen receptor are also disclosed. The use of this chimeric antigen receptor for the treatment of tumors is also disclosed. | 2021-12-02 |
20210371477 | Photoprotein, Substrate Thereof and Use of Same - Provided is a method for causing a subject including a luminescent protein to emit light. The method provided is a method for causing a subject to emit light, wherein the subject is a plant body that has a fusion luminescent protein in a cell wall thereof, or a processed product of the same; the method includes the step of bringing a substrate composition into contact with the fusion luminescent protein; the fusion luminescent protein is a protein that includes a chemiluminescent protein moiety, a fluorescent protein moiety, and a moiety that connects the chemiluminescent protein moiety and the fluorescent protein moiety so that resonance energy transfer can occur from the chemiluminescent protein moiety to the fluorescent protein moiety; and the substrate composition contains a substrate of the chemiluminescent protein. | 2021-12-02 |
20210371478 | GENERATION OF BRAIN AND SPINAL CORD NEURONS, CARDIAC MYOCYTES, AND HEPATOCYTES USING REG PEPTIDES, PEPTIDOMIMETICS, SMALL MOLECULES AND STIMULATORY ANTIBODIES TO REG RECEPTOR - Reg gene receptors are found throughout the body, including in the neurons of the brain and spinal cord, liver and heart. Reg proteins are expressed during fetal development for organogenesis and then only upregulated in times of organ injury, such as in the setting of stroke, myocardial infarction or spinal cord injury. Upregulation of Reg proteins following organ injury is a protective mechanism against organ failure and has been shown to result in the formation of new neurons, cardiac myocytes, hepatocytes and in other organs expressing the Reg receptor. Described are the compositions of bioactive Reg peptides, as well as optimization of these peptides (to increase plasma half-life), peptidomimetics, stimulatory antibodies and small molecules that interact with the Reg receptor that are capable of initiating formation of new cells after organ injury. | 2021-12-02 |
20210371479 | MENTSH ANALOGS AS THERAPEUTICS FOR DIABETES, OBESITY, AND THEIR ASSOCIATED DISEASES AND COMPLICATIONS - Described herein is a novel, mitochondrial encoded, open reading frame, that leads to the production of a new mitochondrial peptide. Residing within the ND-Two subunit, a specific small nucleotide polymorphism disrupts expression of this mitochondrial peptide, and is correlated with an increase in obesity and diabetes, particularly in certain ethnic populations. In vitro administration of the peptide increases insulin secretion, decreases fat accumulation and improves glucose uptake in muscle cell. Antibodies generated against the peptide can be used for detecting peptide deficiency, in addition to SNP detection, supporting diagnostic approaches. In vivo studies further revealed that administration of the peptide improves glucose tolerance, thereby providing a new therapeutic avenue for a novel diabetes therapy and decreases bodyweight, thus serving as a novel obesity therapy. Generation of synthetic analogs further enhance or abrogated activity relative to the natural peptide. | 2021-12-02 |
20210371480 | COMPOSITIONS AND METHODS FOR TREATING AGE-RELATED MACULAR DEGENERATION AND OTHER DISEASES - The present disclosure provides compositions and methods for treating, preventing, or inhibiting diseases of the eye. In one aspect, the disclosure provides recombinant CF1 adeno-associated virus (rAAV) vectors comprising a complement system gene. | 2021-12-02 |
20210371481 | DELIVERY OF CARD PROTEIN AS THERAPY FOR OCCULAR INFLAMMATION - The present invention provides methods and compositions for treating and/or preventing age related macular degeneration and other conditions involving macular degeneration, ocular neovascularization, or ocular inflammation. In an exemplary embodiment, a method is disclosed that involves administering an expression vector that delivers a secretable and cell penetrating CARD to a subject in need of treatment or prevention of age-related macular degeneration or another condition involving macular degeneration or ocular neovascularization. | 2021-12-02 |
20210371482 | PEPTIDE KINASE INHIBITORS AND METHODS OF USE THEREOF - Described herein are isolated regulatory peptides of protein kinase C, chimeric peptides thereof, and their variants. Use of the described peptides, in compositions and methods for treatment of cellular proliferation pathologies is also described. | 2021-12-02 |
20210371483 | Composition for Inactivating Spores by Means of Antimicrobial Peptides - A composition, which comprises at least one natural, recombinant, or synthetic human antimicrobial peptide, is selected from a human defensin or cathelicidin or functional fragments or combinations thereof, for inactivating bacterial spores. | 2021-12-02 |
20210371484 | PEPTIDE AND USE THEREOF FOR TREATMENT OF DISEASE OF BRAIN AND NERVOUS SYSTEM - Peptides are easy to pass through a tissue-blood barrier, have excellent physiological activity in the protective activity of cells, and have an economic advantage due to low production costs. In addition, since there is no side effect of cell proliferation, a pharmaceutical composition containing a peptide of an aspect as an active ingredient can be usefully used in the treatment or prevention of neurological disorders and degenerative brain diseases. | 2021-12-02 |
20210371485 | CYCLIC PEPTIDE FROM NOVEL BONE MORPHOGENETIC PROTEIN 2, PREPARATION METHOD THEREFOR AND APPLICATION THEREOF - The present invention relates to a cyclic peptide from a novel bone morphogenetic protein 2 (BMP2), a preparation method therefor and an application thereof. The cyclic peptide from the novel BMP2 is selected from one of the following cyclized polypeptides: 1. a cyclized polypeptide having the sequence of CKIPKASSVPTELSAISMLYLGPGGDWIVAC; and 2. a cyclized polypeptide of which the sequence has an 80% homology with the sequence defined in item 1. The present invention also relates to a preparation method for the cyclic peptide from the novel BMP2, and an application thereof in the preparation of the composite material for promoting the repair of large-sized bone defects. | 2021-12-02 |
20210371486 | IL-2 FUSION POLYPEPTIDE COMPOSITIONS AND METHODS OF MAKING AND USING THE SAME - Provided herein are compositions comprising polypeptides comprising a circularly permuted interleukin-2 (IL-2) fused to the extracellular portion of an IL-2Rα chain, and methods of making and using such compositions. | 2021-12-02 |
20210371487 | METHODS OF PRODUCING LONG ACTING CTP-MODIFIED POLYPEPTIDES - Disclosed herein is a method for manufacturing a recombinant polypeptide of interest modified by a CTP extension in a mammalian cells culture system. | 2021-12-02 |
20210371488 | DUAL-FUNCTION PROTEIN FOR LIPID AND BLOOD GLUCOSE REGULATION - The present disclosure relates to a dual-function protein for regulating blood glucose and lipid metabolism, wherein said dual-function protein comprises a human GLP-1 analog and human FGF21. In the present disclosure, provided is a method for preparing said dual function protein, and also provided is the use of said dual-function protein in the preparation of a biological substance for treating type 2 diabetes, obesity, dyslipidemia, fatty liver disease and/or metabolic syndrome. The dual-function protein provided in the present disclosure can synergistically regulate blood glucose and lipid levels in vivo, and satisfy multiple requirements for patients with type 2 diabetes such as lowering blood glucose, relieving hepatic steatosis, reducing body weight and improving metabolic disorders of circulating lipids. | 2021-12-02 |
20210371489 | SITE 2 SINGLE-CHAIN INSULIN ANALOGUES - A single-chain insulin analogues may comprise an insulin B-chain polypeptide sequence connected by a connecting polypeptide (or C-domain) sequence to an insulin A-chain polypeptide sequence. The connecting polypeptide sequence may be Glu-Xaa-Gly-Pro-Arg-Arg where Xaa is Glu or Ala. The insulin analogues may additionally comprise Glu or His substitutions at the position corresponding to A8 of human insulin and/or a Glu substitution at the position corresponding to A14 of human insulin. In some embodiments, the insulin analogues may additionally comprise either a Pro or Glu at the positions corresponding to B28 and B29 of wild-type insulin. Additional substitutions may comprise Phe or Trp at the position corresponding to A13 of wild type insulin and/or Gln, Arg, Phe, or Glu at the position corresponding to A17 of wild type insulin. In some embodiments, a Glu substitution at the position corresponding to B16 of wild type insulin may be present. In other embodiments, a Cys substitution may be present at the positions corresponding to A10 and/or B4 of wild-type insulin. In addition or in the alternative, the analogue may comprise a His or Ala substitution at the position corresponding to B22 of wild-type insulin and/or the connecting polypeptide sequence may be Glu-Glu-Gly-Pro-Ala-His. A method of treating a patient with diabetes mellitus comprises administering a physiologically effective amount of the insulin analogue or a physiologically acceptable salt thereof to a patient by means of intravenous, intraperitoneal, or subcutaneous injection. | 2021-12-02 |
20210371490 | Chimeric antigen receptor with a spacer comprising C2-set Ig-like domains - The present invention provides a CAR comprising a) an antigen binding domain specific for an antigen, b) a spacer, c) a transmembrane domain, and d) an intracellular signaling domain, wherein said spacer consists of 1, 2 or 3 C2-set Ig-like domain(s). Said C2-set Ig-like domain(s) may be selected from the group of C2-set Ig-like domains of the sialic acid binding Ig-like lectin (Siglec) family. A composition comprising a) an immune cell expressing said CAR, wherein said CAR is specific for a tag and b) a tagged polypeptide is also disclosed. | 2021-12-02 |
20210371491 | CHIMERIC ANTIGEN RECEPTORS THAT BIND TO PROSTATE SPECIFIC MEMBRANE ANTIGEN - The present invention relates to a novel chimeric antigen receptor (CAR) comprising an antigen-binding fragment which binds specifically to PSMA antigen, and a method of manufacturing high-quality CAR T cell products by transfection and/or transduction of T cells therewith, which allows to eradicate tumors in vivo alone or in combination with pharmaceutical drugs, such chemotherapies, biopharmaceutical drugs, such as antibodies, or small-molecule drugs, such as protein kinase inhibitors. | 2021-12-02 |
20210371492 | Anti-GCC Antibody and CAR thereof for Treating Digestive System Cancer - The present disclosure relates to compositions and methods of treating a subject having digestive tract cancer, the method comprising: administering an effective amount of a composition to the subject, the composition comprising a first population of cells comprising a first CAR binding a first antigen, and a second population of cells comprising a second CAR binding GCC, wherein the first antigen comprises a cell surface molecule of a white blood cell (WBC). | 2021-12-02 |
20210371493 | TCR LIBRARIES - The present invention relates to a library of particles, the library displaying a plurality of different T cell receptors (TCRs), wherein the plurality of TCRs may consist essentially of TCRs which may comprise an alpha chain variable domain from a natural repertoire and a beta chain variable domain from a natural repertoire, wherein the alpha chain variable domain may comprise a TRAV12-2 or a TRAV21 gene product and the beta chain variable domain may comprise a TRBV6 gene product. | 2021-12-02 |
20210371494 | CIRCULAR RNA COMPOSITIONS AND METHODS - Circular RNA and transfer vehicles, along with related compositions and methods are described herein. In some embodiments, the inventive circular RNA comprises group I intron fragments, spacers, an IRES, duplex forming regions, and an expression sequence. In some embodiments, the expression sequence encodes a chimeric antigen receptor (CAR). In some embodiments, circular RNA of the invention has improved expression, functional stability, immunogenicity, ease of manufacturing, and/or half-life when compared to linear RNA. In some embodiments, inventive methods and constructs result in improved circularization efficiency, splicing efficiency, and/or purity when compared to existing RNA circularization approaches. | 2021-12-02 |
20210371495 | USE OF THE CD2 SIGNALING DOMAIN IN SECOND-GENERATION CHIMERIC ANTIGEN RECEPTORS - The present invention provides compositions and methods for treating cancer in a human. The invention includes relates to administering a genetically modified T cell expressing a CAR having an antigen binding domain, a transmembrane domain, a CD2 signaling domain, and a CD3 zeta signaling domain. The invention also includes incorporating CD2 into the CAR to alter the cytokine production of CAR-T cells in both negative and positive directions. | 2021-12-02 |
20210371496 | ANTI-PD-1 VACCINE COMPOSITION - The present invention relates to a polypeptide which comprises or consists of:—a first sequence consisting of at least 8 contiguous amino acid residues selected from within the sequence extending from amino acid residues 123 to 137 of the PD-1 protein, and at most 30 contiguous amino acid residues selected from within the complete sequence of the PD-1 protein; and/or—a second sequence consisting of at least 8 contiguous amino acid residues selected from within the sequence extending from amino acid residues 66 to 81 of the PD-1 protein, and at most 30 contiguous amino acid residues selected from within the complete sequence of the PD-1 protein; and/or—a third sequence consisting of at least 8 contiguous amino acid residues selected from within the sequence extending from amino acid residues 95 to 110 of the PD-1 protein, and at most 30 contiguous amino acid residues selected from within the complete sequence of the PD-1 protein; and/or—a fourth sequence consisting of at least 8 contiguous amino acid residues selected from within the sequence extending from amino acid residues 22 to 33 of the PD-1 protein, and at most 30 contiguous amino acid residues selected from within the complete sequence of the PD-1 protein. | 2021-12-02 |
20210371497 | ARTIFICIAL SYNAPSES - Described herein are compositions and techniques related to generation and therapeutic application of artificial synapses. Artificial synapses are engineered extracellular vesicles, including exosomes, which incorporate sticky binders on their surface to anchor signaling domains against biological targets, such as receptors. These engineered additives can be organized in genetic vector constructs, expressed in mammalian cells, wherein the sticky binders attach to extracellular vesicles such as exosomes, thereby presenting their joined signaling domains which are rapidly taken up by recipient cells. Artificial synapses adopt the hallmark biophysical and biochemical features of extracellular vesicles, allowing for rapid deployment and scale-up. Importantly, this strategy can allow for kinetically favorable signal generation and signal propagation. This includes, for example, increasing density of agonist presentation to support receptor clustering—an onerous barrier for traditional receptor targeting strategies. | 2021-12-02 |
20210371498 | MHC CLASS I COMPOSITIONS AND METHODS - Compositions are provided that comprise peptide receptive MHC class I complexes (peptide receptive MHC-I complexes) that are formed after treatment with a catalytic amount of chaperone (i.e. a ratio of chaperone to MHC-I of less than 1:1). In particular, these peptide receptive MHC class I complexes can be used to form peptide-MHC class I (pMHC-I) multimers that can be used in high throughput applications such as detection of antigen specific T cells and characterization of T cell profiles in subjects. | 2021-12-02 |
20210371499 | PEPTIDE-RECEPTIVE MHC-I COMPLEX COMPOSITIONS AND METHODS - Compositions that include peptide receptive MEW class I complexes and methods of making and using such complexes are provided. In particular embodiments, such peptide receptive MHC class I complexes are used to form peptide MHC class I (pMHC-I) multimers useful for high throughput applications, such as, for the detection of antigen specific T cells and characterization of T cell profiles in subjects. | 2021-12-02 |
20210371500 | SIRPalpha-41BBL FUSION PROTEIN AND METHODS OF USE THEREOF - SIRP1alpha-41BBL fusion proteins are provided. Accordingly, there is provided a SIRPalpha-41BBL fusion protein comprising a single amino acid linker between the SIRPalpha and the 41BBL. Also there is provided a SIRPalpha-41BBL fusion protein in a form of at least a homo-trimer. Also provided are polynucleotides and nucleic acid constructs encoding the SIRP1alpha-41BBL fusion protein, host-cells expressing the SIRP1alpha-41BBL fusion protein and methods of use thereof. | 2021-12-02 |
20210371501 | ANTI-VEGF PROTEIN COMPOSITIONS AND METHODS FOR PRODUCING THE SAME - The present disclosure pertains to compositions comprising aflibercept and methods for producing such compositions in chemically defined media and using chromatography to reduce amounts of certain aflibercept variants. | 2021-12-02 |
20210371502 | TGF- RECEPTOR II ISOFORM, FUSION PEPTIDE, METHODS OF TREATMENT AND METHODS IN VITRO - An isoform of the TGF beta receptor II comprising a sequence of about of 80 amino acids and lacking a transmembrane domain. The isoform comprises the amino acid sequence set forth in SEQ ID No. 12. The isoform may have the amino acid sequence set forth in SEQ ID No. 2 or sequences having at least 85% sequence identity to the sequence set forth in SEQ ID No. 2. A fusion peptide is provided comprising an isoform of the TGF beta II receptor fused to a ligand, wherein a vector comprising the fusion peptide is used to treat cancer and/or hepatic fibrosis. An antibody binding the soluble isoform of the TGF beta II receptor is provided. The antibody binds the amino acid sequence shown in SEQ ID No. 12 and is used in in vitro methods. | 2021-12-02 |
20210371503 | NEUTRALIZING ANTIBODIES AGAINST SARS-RELATED CORONAVIRUS - The present invention relates to antibodies or antigen-binding fragments thereof against SARS-related coronavirus, a pharmaceutical composition comprising such antibodies or antigen-binding fragments thereof, a kit comprising such antibodies or antigen-binding fragments thereof. The present invention also relates to the antibodies or antigen-binding fragments thereof, the pharmaceutical composition, and the kit, for use as a medicament, and in the treatment or prevention of a disease caused by SARS-related coronavirus. | 2021-12-02 |
20210371504 | ANTIBODIES AGAINST SARS-COV-2 AND METHODS OF USING THE SAME - The instant disclosure provides antibodies and antigen-binding fragments thereof that can bind to a SARS-CoV-2 antigen and, in certain embodiments, are capable of neutralizing a SARS-CoV-2 infection. Also provided are polynucleotides that encode an antibody or antigen-binding fragment, vectors and host cells that comprise a polynucleotide, pharmaceutical compositions, and methods of using the presently disclosed antibodies, antigen-binding fragments, polynucleotides, vectors, host cells, and compositions to treat or diagnose a SARS-CoV-2 infection. | 2021-12-02 |
20210371505 | HUMAN ANTIBODIES TO INFLUENZA HEMAGGLUTININ - The present invention provides monoclonal antibodies, or antigen-binding fragments thereof, that bind to the influenza hemagglutinin (HA) protein, pharmaceutical compositions comprising the antibodies and methods of use. The antibodies of the invention are useful for inhibiting or neutralizing influenza virus activity, thus providing a means of treating or preventing influenza infection in humans. In some embodiments, the invention provides for use of one or more antibodies that bind to the influenza HA for preventing viral attachment and/or entry into host cells. The antibodies of the invention may be used prophylactically or therapeutically and may be used alone or in combination with one or more other anti-viral agents or vaccines. | 2021-12-02 |
20210371506 | ANTI-ABETA ANTIBODY, ANTIGEN-BINDING FRAGMENT THEREOF AND APPLICATION THEREOF - Murine, chimeric or humanized anti-Abeta antibody having a specific CDR region, an antigen-binding fragment thereof, a pharmaceutical composition thereof, and usage thereof. Use of a humanized anti-Abeta antibody for the preparation of drugs for the treatment of a disease or disorder (such as Alzheimer's disease) caused by amyloid beta protein. | 2021-12-02 |
20210371507 | ANTI-TRANSTHYRETIN ANTIBODIES - The invention provides antibodies that specifically bind transthyretin (TTR). The antibodies can be used for treating or effecting prophylaxis of diseases or disorders associated with TTR accumulation or accumulation of TTR deposits (e.g., TTR amyloidosis). The antibodies can also be used for diagnosing TTR amyloidosis and inhibiting or reducing aggregation of TTR, among other applications. | 2021-12-02 |
20210371508 | NMES1 ANTIBODIES AND METHODS OF USE THEREOF - Provided herein are methods for treating cancer, such as breast cancer, by administering an inhibitor of NMES1. Further provided herein are NMES1 monoclonal antibodies which may be used to detect or treat cancer. | 2021-12-02 |
20210371509 | ANTI-N3pGlu AMYLOID BETA PEPTIDE ANTIBODIES AND USES THEREOF - Antibodies to human N3pGlu Aβ, compositions comprising such N3pGlu Aβ antibodies, and methods of using such N3pGlu Aβ antibodies for the treatment of a disease characterized by deposition of Aβ including clinical or pre-clinical Alzheimer's disease, Down's syndrome, and clinical or pre-clinical cerebral amyloid angiopathy. | 2021-12-02 |
20210371510 | Methods for Treating TNFa-Related Diseases - The present invention relates to a method of TNF-α-related disease by subcutaneously administering an antibody binding to TNF-α (anti-TNF-α antibody). A treatment method, composition, kit or use according to the present invention reduces the time for administration and the time for patients to stay in hospitals, thereby improving patient convenience and the quality of life of the patient. This provides the advantage of improving the patient's satisfaction. | 2021-12-02 |
20210371511 | USE OF CANAKINUMAB - Use of an IL-1β inhibitor such as canakinumab for the treatment and/or prevention of osteoarthritis and complications related thereto. | 2021-12-02 |
20210371512 | Use of IL-1 beta Binding Antibodies - The present invention relates to an IL-1β binding antibody or a functional fragment thereof for use in preventing or reducing risk of experiencing a recurrent cardiovascular (CV) event or a cerebrovascular event in a patient that has suffered of a qualifying CV event. | 2021-12-02 |
20210371513 | Compounds - Binding members, e.g. human antibody molecules, which bind interleukin-6 (IL-6) and neutralise its biological effects. Use of binding members for IL-6 in medical treatment e.g. for treating inflammatory diseases and tumours associated with IL-6. | 2021-12-02 |
20210371514 | MATERIALS AND METHODS FOR TREATING STRESS-RELATED DISORDERS AND CANCER - Disclosed herein are materials and methods for the treatment of stress-related disorders and cancer. The disclosure provides an antibody, or antigen binding fragment thereof, that specifically binds to a region of corticotropin-releasing hormone (CRH). The disclosure also provides methods of treating a disorder associated with HPA axis activation, such as a stress-related disorder or cancer, comprising administering to a subject in need thereof an antibody or antigen binding fragment thereof described herein in an amount effective to treat the disorder. | 2021-12-02 |
20210371515 | IMMUNOCYTES WITH IMPROVED CANCER-FIGHTING ABILITY - Provided are a genetically modified immunocyte expressing a chimeric antigen receptor (CAR) comprising an antigen binding domain specifically binding to cancer cells and/or expressing TRAIL, a composition for preventing or treating cancer, the composition comprising the immunocytes, a cell therapeutic agent, a method of providing information for cancer diagnosis, and a method of preparing the genetically modified immunocyte. | 2021-12-02 |
20210371516 | ANTIBODY CONSTRUCTS AND METHODS OF TREATING CANCER - Provided herein are antibodies and related polypeptides that bind specifically to CEACAM6. The antibodies and/or polypeptides can be configured as bispecific T cell engagers. The antibodies and/or polypeptides can also be configured as chimeric antigen receptors. Also provided are methods of detection and treatment of cancer, for example, pancreatic cancer, using the antibodies and related polypeptides herein. | 2021-12-02 |
20210371517 | METHOD AND COMPOSITIONS FOR CELLULAR IMMUNOTHERAPY - The present invention provides nucleic acids, vectors, host cells, methods and compositions to confer and/or augment immune responses mediated by cellular immunotherapy, such as by adoptively transferring CD8+ central memory T cells or combinations of central memory T cells with CD4+ T cells that are genetically modified to express a chimeric receptor. In some alternatives the genetically modified host cell comprises a nucleic acid comprising a polynucleotide coding for a ligand binding domain, a polynucleotide comprising a customized spacer region, a polynucleotide comprising a transmembrane domain, and a polynucleotide comprising an intracellular signaling domain. In some alternatives, the ligand binding domains binds to CD171. | 2021-12-02 |
20210371518 | NOVEL LILRB4 ANTIBODIES AND USES THEREOF - The present disclosure provides an isolated monoclonal antibody or an antigen-binding fragment thereof that binds specifically to leukocyte immunoglobulin-like receptor 4 (LILRB4). In certain embodiments, the antibody or antigen-binding fragment, when bound to LILRB4, modulates the activation of LILRB4. In certain embodiments, the antibody or antigen-binding fragment, when bound to LILRB4, activates LILRB4. In certain embodiments, the antibody or antigen binding fragment, when bound to LILRB4, suppresses activation of LILRB4. In certain embodiments, the antibody or antigen-binding fragment, when bound to LILRB4, specifically blocks binding of ApoE to LILRB4. In another aspect, there is provided a method of treating or ameliorating the effects of a cancer in a subject, comprising administering to the subject a therapeutically effective amount of the antibody or an antigen-binding fragment thereof or an engineered cell as provided herein. | 2021-12-02 |
20210371519 | Suppressing IgE-Mediated Allergy by Desensitization with Monovalent Anti-FCeR1a Monoclonal Antibody - A monovalent monoclonal antibody is provided, the antibody including one light chain, one heavy chain, and one truncated heavy chain, wherein the truncated heavy chain lacks a variable domain and a CH1 domain and wherein the antibody specifically binds an epitope of FcεRIα. Also provided are methods of desensitizing a subject to an allergen, methods of treating an allergy, and methods of preventing an allergic reaction in a subject having an allergy. | 2021-12-02 |
20210371520 | ANTI-HUMAN LAG-3 ANTIBODIES AND THEIR USE IN IMMUNOHISTOCHEMISTRY (IHC) - Provided are chimeric or recombinant antibodies (Ab), or antigen binding fragments thereof, or monomeric or dimeric antigen binding proteins, that can specifically bind to human LAG-3 polypeptides, including human LAG-3 polypeptides expressed on the surface of lymphocytes such as activated T cells that have infiltrated tumors or tumor infiltrating lymphocytes (TILs), and methods for making and using them. In alternative embodiments, chimeric or a recombinant antibodies (Ab), or antigen binding fragments thereof, or monomeric or dimeric antigen binding proteins as provided herein are used for in vitro diagnostics, for example, in immuno-histochemistry (IHC), for example, to diagnose and/or treat a cancer, for example, bladder cancer, urothelial carcinoma, breast cancer, lung cancer, Non-Small Cell Lung Cancer, renal carcinoma, Renal Clear cell Carcinoma and/or melanoma or malignant melanoma, by their ability to specifically bind to activated T cells that have infiltrated tumors, or tumor infiltrating lymphocytes. | 2021-12-02 |
20210371521 | ANTI-CD200R1 ANTIBODIES AND METHODS OF USE THEREOF - The present disclosure provides binding proteins, such as antibodies and antigen-binding fragments, which specifically bind to human CD200R1 receptor protein (hu-CD200R1) and are capable of decreasing, inhibiting, and/or fully-blocking immune regulatory effects mediated by hu-CD200R1. The present disclosure also provides methods of using the antibodies (and compositions thereof) to treat diseases and conditions responsive to decreasing, inhibiting and/or blocking immune regulatory function or activity mediated by CD200 binding to CD200R1. | 2021-12-02 |
20210371522 | CD47 ANTIBODIES AND METHODS OF USE THEREOF - CD47 antibodies that specifically inhibit the interaction between CD47 and the CD47-signal regulatory protein alpha (SIRPα) but not the interaction between CD47 and thrombospondin-1 (TSP-1), and methods of using these monoclonal antibodies as therapeutics are provided. | 2021-12-02 |
20210371523 | ANTIBODY MOLECULES THAT BIND TO NKP30 AND USES THEREOF - Antibody molecules that specifically bind to NKp30 are disclosed. The anti-NKp30 antibody molecules can be used to treat, prevent and/or diagnose cancerous, autoimmune or infectious conditions and disorders. | 2021-12-02 |
20210371524 | ANTI-CD45 ANTIBODIES AND CONJUGATES THEREOF - Disclosed are anti-CD45 antibodies and antibody drug conjugates (ADCs) useful in therapeutic methods, including targeting CD45 expressing hematopoietic stem cells (HSCs) or immune cells prior to transplantation. | 2021-12-02 |
20210371525 | NOVEL BISPECIFIC ANTIBODIES FOR USE IN THE TREATMENT OF HEMATOLOGICAL MALIGNANCIES - The present invention relates to novel methods for the treatment of hematological malignancies. In particular, the invention relates to the treatment of hematological malignancies using antibodies comprising a first binding moiety that is able to bind human CD1d and a second binding moiety that is able to bind the human Vγ9Vδ2-TCR. | 2021-12-02 |
20210371526 | HOMODIMERIC BISPECIFIC ANTIBODY, PREPARATION METHOD THEREFOR AND USE THEREOF - Provided is a tetravalent homodimeric bispecific antibody molecule simultaneously targeting an immune effector cell antigen CD3 and a tumor-associated antigen, wherein the bispecific antibody molecule contains, in order from N-terminus to C-terminus, a first single chain Fv, a second single chain Fv and a Fc fragment; wherein the first single chain Fv can specifically bind to the tumor-associated antigen, the second single chain Fv can specifically bind to CD3, and the first and the second single chain Fvs are connected by a linker peptide, while the second single chain Fv and the Fc fragment are directly connected or connected by a linker peptide; and the Fc fragment does not have effector functions such as CDC, ADCC and ADCP. | 2021-12-02 |
20210371527 | ANTIGEN BINDING CONSTRUCTS TO CD4 - Antigen binding constructs that bind to CD4, for example antibodies, including antibody fragments (such as scFv, minibodies, and cys-diabodies) that bind to CD4, are described herein. Methods of use are described herein. | 2021-12-02 |
20210371528 | VIRTUAL ASSISTANT FOCUSED USER INTERFACES - Conversation user interfaces that are configured for virtual assistant interaction may include contextual interface items that are based on contextual information. The contextual information may relate to a current or previous conversation between a user and a virtual assistant and/or may relate to other types of information, such as a location of a user, an orientation of a device, missing information, and so on. The conversation user interfaces may additionally, or alternatively, control an input mode based on contextual information, such as an inferred input mode of a user or a location of a user. Further, the conversation user interfaces may tag conversation items by saving the conversation items to a tray and/or associating the conversation items with indicators. | 2021-12-02 |
20210371529 | ANTI-LAG-3 ANTIBODY AND USE THEREOF - The invention relates to a novel antibody and an antibody fragment thereof that specifically bind to ALG-3 and a composition comprising the antibody or the antibody fragment. In addition, the invention relates to a nucleic acid encoding the antibody or the antibody fragment thereof, a host cell comprising the nucleic acid, and related use. Furthermore, the invention relates to therapeutic and diagnostic use of the antibody and the antibody fragment. In particular, the invention relates to combination therapy of the antibodies and the antibody fragments described herein with other therapeutic agents, such as anti-PD-1 or anti-PD-L1 antibodies. | 2021-12-02 |
20210371530 | ANTI-PD-1/LAG3 BISPECIFIC ANTIBODIES - Provided herein are anti-PD-1/LAG3 bispecific antibodies and antigen-binding fragments. Also provided here are methods and uses of these antibodies and antigen-binding fragments in the treatment of cancer or infectious disease. | 2021-12-02 |
20210371531 | ANTI PD-L1 ANTIBODIES - The present disclosure relates to antibodies and antigen-binding fragments thereof that bind to PD-L1, and to methods of using such antibodies and antigen-binding fragments. For example, the present invention provides humanized anti-PD-L1 antibodies and methods of use thereof. | 2021-12-02 |
20210371532 | ANTIBODIES TARGETING A COMPLEX COMPRISING NON-CLASSICAL HLA-I AND NEOANTIGEN AND THEIR METHODS OF USE - Provided herein are antibodies that selectively bind to complex comprising a non-classical HLA-I (e.g. HLA-E) and a neoantigen having variable heavy chain domains (VH), variable light chain domains (VL), and complementarity determining regions (CDRs) as disclosed herein, as well as methods and uses thereof. | 2021-12-02 |
20210371533 | METHODS OF TREATING INFLAMMATORY DISEASES BY BLOCKING GALECTIN-3 - Disclosed herein are methods, antibodies, and compositions for disrupting an interaction between Galectin-3 (Gal3) and viral proteins, such as proteins of the SARS-CoV-2 virus or other coronaviruses, or viral-associated host proteins. Further disclosed herein are methods, medicaments, and compositions for the treatment of a disease or a disorder in a subject, such as the treatment of a viral infection, or treatment of a fibrosis, such as lung fibrosis, that develop as a sequela of a viral infection, or cytokine release syndrome. Further disclosed herein are methods, medicaments, and compositions for the treatment of an inflammatory disease or disorder, such as inflammation of the lungs or systemic lupus erythematosus, which may be associated with neutrophil activity, in a subject. Also disclosed herein are pharmaceutical antibody formulations for the treatment of a disease, such as a coronavirus infection. | 2021-12-02 |
20210371534 | Recombinant Fusion Proteins Targeting P-selectin, and Methods of Use Thereof for Treating Diseases and Disorders - The present invention describes compositions and methods for targeting complement inhibition to sites of p-selectin expression, and compositions for inhibiting p-selectin and complement. | 2021-12-02 |
20210371535 | MODULATORS OF ROR1-ROR2 BINDING - Provided herein are, inter alia, methods of identifying agents that are capable of inhibiting the binding (e.g., coupling) between a ROR1 protein and a ROR2 protein. By interfering with ROR1-ROR2 coupling (binding) the agents identified using the methods provided herein inhibit non-canonical Wnt5a signaling. Thus, the agents identified by the methods provided herein may, inter alia, be useful for cancer diagnosis and therapy. | 2021-12-02 |
20210371536 | PDGF RECEPTOR ANTIBODY AND USE THEREOF - The present invention relates to an antibody against a PDGF receptor, an antibody-drug conjugate in which a chemotherapeutic agent is conjugated to the antibody against PDGF receptor, and a use of prevention or treatment of ocular neovascular diseases. | 2021-12-02 |
20210371537 | ANTI-TNFR2 ANTIBODIES AND USES THEREOF - Anti-TNFR2 antibodies which bind to particular human TNFR2 epitopes, therapeutic compositions comprising the anti-TNFR2 antibodies, and methods of using such antibodies and compositions in the treatment of cancer are disclosed. | 2021-12-02 |
20210371538 | BISPECIFIC ANTIBODIES AGAINST CD3 AND CD20 - The present invention relates to bispecific antibodies (bsAbs) and the use of such antibodies in the treatment of disease in subjects. Moreover, advantageous treatment regimens are provided for the treatment of B-cell Non-Hodgkin Lymphoma (B-NHL). | 2021-12-02 |
20210371539 | ANTI-CD37 ANTIBODIES AND ANTI-CD20 ANTIBODIES, COMPOSITIONS AND METHODS OF USE THEREOF - The present invention relates to anti-CD37antibodies having an Fc-Fc interaction enhancing substitution in the Fc-region of a human IgG, for use as a medicament in combination with anti-CD20 antibodies having an Fc-Fc interaction enhancing substitution in the Fc-region of a human IgG. The invention also relates to a novel composition of anti-CD37 antibodies having an Fc-Fc 5 interaction enhancing substitution and anti-CD20 antibodies having an Fc-Fc interaction enhancing substitution. In particular, the invention relates to compositions wherein the anti-CD37 antibody binds human CD37 and the anti-CD20 antibody binds human CD20. The invention also relates to compositions where the composition is a pharmaceutical composition and the use of such compositions in treatment of cancer and other diseases. | 2021-12-02 |
20210371540 | CHIMERIC ANTIGEN RECEPTORS WITH MUTATED CD28 PHOSPHORYLATION SITES - Disclosed herein are chimeric antigen receptor (CAR) polypeptides, which can be used with adoptive cell transfer to target and kill cancers, that comprise a costimulatory signaling region having a mutated form of a cytoplasmic domain of CD28 with altered phosphorylation at Y206 and/or Y218. Also disclosed are immune effector cells, such as T cells or Natural Killer (NK) cells, that are engineered to express these CARs. Therefore, also disclosed are methods of providing an antitumor immunity in a subject with a tumor associated antigen-expressing cancer that involves adoptive transfer of the disclosed immune effector cells engineered to express the disclosed CARs. | 2021-12-02 |
20210371541 | CONJUGATED ANTIBOIDES AGAINST LY75 FOR THE TREATMENT OF CANCER - The invention provides antibodies which bind to LY75. Nucleic acid molecules encoding the antibodies, expression vectors, host cells and methods for expressing the antibodies are also provided. The antibodies may be used for the treatment of cancer, including pancreatic cancer, ovarian cancer, breast cancer, colorectal cancer, esophageal cancer, skin cancer, thyroid cancer, lung cancer, bladder cancer, multiple myeloma and lymphoma. | 2021-12-02 |
20210371542 | CHIMERIC ANTIGEN RECEPTORS TARGETING TUMOR ANTIGENS - Nucleic acid constructs encoding a chimeric antigen receptor (CAR) and a truncated human epidermal growth factor receptor (huEGFRt) are described. The encoded CARs include a tumor antigen-specific monoclonal antibody, such as a glypican-3 (GPC3)-specific, a GPC2-specific or a mesothelin-specific monoclonal antibody, fused to a CD8α hinge region, a CD8α transmembrane region, a 4-1BB co-stimulatory domain and a CD3ζ signaling domain. Isolated host cells, such as isolated T cells that co-express the disclosed CARs and huEGFRt are also described. T cells transduced with the disclosed CAR constructs can be used for cancer immunotherapy. | 2021-12-02 |
20210371543 | Thrombin-Binding Antibody Molecules And Uses Thereof - This invention relates to isolated antibodies which recognize the exosite 1 epitope of thrombin and selectively inhibit thrombin without promoting bleeding. These antibody molecules may be useful in the treatment and prevention of thrombosis, embolism and other conditions mediated by thrombin. | 2021-12-02 |
20210371544 | LOW-VISCOSITY ANTIGEN BINDING PROTEINS AND METHODS OF MAKING THEM - The present invention concerns a method for preparing antigen binding proteins specific for PCSK9 with reduced viscosity. The method proceeds by replacing residues in high viscosity variable domain subfamilies with residues in correlating low viscosity subfamilies. The method further comprises substituting residues in the Fc domain with residues associated with low viscosity and adding charged residues to the C-terminus of the Fc domain. The present invention further concerns antigen binding proteins produced by this method. | 2021-12-02 |
20210371545 | CALIBRATOR, COMPLEX, AND METHOD FOR MEASURING IgA AGGREGATE - Disclosed is a calibrator comprising IgA having a biotin group and a biotin-binding site, the calibrator being used to obtain a concentration of an IgA aggregate in a sample. | 2021-12-02 |
20210371546 | ANTIBODIES TO TICAGRELOR AND METHODS OF USE - The disclosure generally provides antibodies and antigen binding fragments of antibodies that bind ticagrelor and metabolites of ticagrelor. The disclosure also provides compositions comprising the antibodies, nucleic acid molecules encoding the antibodies, methods of treating a patient comprising administering the antibodies, and methods of making and using the antibodies. | 2021-12-02 |
20210371547 | BIOLOGICAL PRODUCTS - There is disclosed antibody molecules containing at least one CDR derived from a mouse monoclonal antibody having specificity for human CD22. There is also disclosed a CDR grafted antibody wherein at least one of the CDRs is a modified CDR. Further disclosed are DNA sequences encoding the chains of the antibody molecules, vectors, transformed host cells and uses of the antibody molecules in the treatment of diseases mediated by cells expressing CD22. | 2021-12-02 |
20210371548 | HYALURONIC ACID DERIVATIVE MODIFIED WITH POLYETHYLENE GLYCOL - The present invention provides hyaluronic acid derivatives including one or more of each of repeating units represented by the formulae (Ia), (Ib), and (Ic) in which certain cationic sites, certain hydrophobic sites, and certain hydrophilic sites have been introduced. In addition, the present invention provides complexes of the hyaluronic acid derivatives with a drug and pharmaceutical compositions including the hyaluronic acid derivatives, in particular, complexes of the hyaluronic acid derivatives with a drug. | 2021-12-02 |
20210371549 | METHOD OF MANUFACTURING POLYMERIZABLE COMPOSITION, POLYMERIZABLE COMPOSITION, AND CURED PRODUCT - A method of manufacturing a polymerizable composition is capable of imparting antibacterial properties and the like to a cured product of polymerizable composition without deteriorating an appearance of the cured product of the polymerizable composition. The method of manufacturing a polymerizable monomer wherein a solution, that a second polymerizable monomer is dissolved in a first solvent, is dispersed in a first polymerizable monomer, includes mixing the first polymerizable monomer, the second polymerizable monomer, and the first solvent. The first polymerizable monomer is a liquid, and the second polymerizable monomer is a solid. | 2021-12-02 |
20210371550 | COMPONENT ADDITION POLYMERIZATION - Provided is a process of making a collection of polymeric beads, wherein the beads comprise
| 2021-12-02 |
20210371551 | LIGHT CURABLE (METH)ACRYLATE RESIN COMPOSITION FOR THERMOPLASTIC ELASTOMERS BONDING - The present invention provides a light curable (meth)acrylate resin composition for thermoplastic elastomer bonding. The light curable (meth)acrylate resin composition of the present invention comprises: a (meth)acrylic monomer, a polyolefin (meth)acrylate oligomer having a viscosity of 200 000 to 2 500 000 mPa*s at 25° C., and a photoinitiator. The present invention also provides a cured product of the light curable (meth)acrylate resin composition and a use of the composition. | 2021-12-02 |
20210371552 | CARRIER FOR OLEFIN POLYMERIZATION CATALYST, AND PREPARATION METHOD THEREFOR AND APPLICATION THEREOF - A carrier for an olefin polymerization catalyst contains a magnesium-containing compound and sulfur. The sulfur is at least one of an elemental sulfur, a complex sulfur, and a compound sulfur. The carrier has good particle morphology and a smooth surface, and has a narrow particle size distribution. The catalyst prepared from the carrier has high activity and good sensitivity to hydrogen regulation, and can improve the density of a polymer stack when being used for olefin polymerization. | 2021-12-02 |
20210371553 | PROCESS FOR THE PREPARATION OF POLYETHYLENES - The present invention relates to a process for the production of a polyethylene by polymerisation of a reaction mixture comprising ethylene in the presence a catalyst system and an antistatic agent according to formula I: (I) wherein R1, R2 and R3 stand for a moiety according to formula II or a hydrocarbon moiety having 1 to 20 carbon atoms (II) wherein each of R4, R5 and R6 may be the same or different, and wherein each of R4, R5 and R6 is a hydrocarbon moiety having 1 to 10 carbon atoms, and wherein at least one of R1, R2 and R3 is a moiety according to formula II. Such process allows for the reduction of sheeting in the polymerisation reactor without compromising the polymerisation reaction kinetics. | 2021-12-02 |
20210371554 | STYRENE RESIN, STYRENE RESIN COMPOSITION, MOLDED ARTICLE THEREOF, AND STYRENE RESIN PRODUCTION METHOD - A styrene resin having a syndiotactic structure, with an endothermic amount in a range of 175 to 260° C. of less than 30% based on the total endothermic amount, and a styrene resin composition containing 50 to 95% by mass of a thermoplastic resin composition and 5 to 50% by mass of a glass filler, the thermoplastic resin composition containing 100 parts by mass containing 80 to 100% by mass of a styrene resin having a syndiotactic structure and 0 to 20% by mass of a rubbery elastic material, 0.2 to 2.0 parts by mass of at least one kind of an antioxidant selected from a phenol-based antioxidant and a sulfur antioxidant, 1.5 to 5.0 parts by mass of at least one kind of a compound selected from a polyphenylene ether or a modified polyphenylene ether, and at least one kind selected from a nucleating agent or a release agent. | 2021-12-02 |
20210371555 | POLYMERIZATION PROCESS FOR THE SYNTHESIS OF VINYL AROMATIC POLYMERS WITH A CONTROLLED STRUCTURE - The present invention relates to a polymerization process for the synthesis of vinyl aromatic polymers, in which the sequence of monomers in the chain and the linear, branched soluble, or crosslinked insoluble structure, with reactive or different polarity functions, are controlled. Said process comprises the step of polymerizing vinyl aromatic monomers by means of an Atom Transfer Radical Polymerization (ATRP) reaction with an Activator ReGenerated by Electron Transfer (ARGET), the reaction being carried out at a temperature comprised between 25° C. and 110° C. in an inert gas atmosphere in the presence of a complex catalyst containing a cupric halide and a multidentate amine ligand, feeding to the reaction an organic initiator having two geminal halogens, an alkali metal (bi)carbonate, a solvent pair of an aliphatic alcohol and an acetic ester of the same aliphatic alcohol and possibly ascorbic acid, provided that no initiator is used with three or more active halogens, or polyvinyl monomers or inimers. | 2021-12-02 |
20210371556 | METHOD FOR PREPARING VINYL ETHER POLYMER BY PHOTO-INITIATED POLYMERIZATION - The invention relates to a method for preparing a vinyl ether polymer by photo-initiated polymerization, which comprises the step of: under a protective atmosphere, performing photo-initiated polymerization on a vinyl ether monomer in the presence of an organic halogenated hydrocarbon and manganese carbonyl under irradiation of light having a wavelength of 365-550 nm at −25° C. to 25° C., to obtain a vinyl ether polymer after the reaction is completed. In the method, a vinyl ether monomer is subjected to cationic polymerization in the presence of manganese carbonyl and an organic halogenated hydrocarbon under visible light, to prepare a vinyl ether polymer with controlled molecular weight and narrow molecular weight distribution. | 2021-12-02 |
20210371557 | AZIRIDINE POLYMERS WHOSE CHEMICAL STRUCTURAL CHANGES ARE INDUCED BY MECHANICAL FORCE - Disclosed are new polymeric materials that respond to a mechanical force. The novel polymeric compounds contain an isomer of aziridine, a three-membered N-heterocyclic compound. Also disclosed are methods for preparing the polymeric compounds. Mechanical force-induced cycloaddition of aziridines as mechanophores yields stereospecific products without covalent bond cleavage of aziridines. That is, a mechanical force makes the mechanochemical products stereospecific. The stereospecific products prepared from the isomeric mechanophores by a mechanical force can be widely used in various industrial fields, including new materials. | 2021-12-02 |
20210371558 | Polyolefin - The present invention relates to polyolefin. More specifically, the present invention relate s to polyolefin having excellent dart drop impact strength, and exhibiting improved transparency and satisfying one of the following 1)˜4):
| 2021-12-02 |
20210371559 | ETHYLENE-ALPHA-OLEFIN-NONCONJUGATED POLYENE COPOLYMER RUBBER AND RUBBER COMPOSITION - Disclosed is an ethylene-α-olefin-nonconjugated polyene copolymer rubber satisfying the following requirements (A) and (B):
| 2021-12-02 |
20210371560 | UV CURABLE WATER BASED POLYELECTROLYTE COMPOSITION AND METHOD FOR PRODUCING POLYELECTROLYTE FILM USING THE COMPOSITION - The present invention relates to a UV curable water-based polyelectrolyte composition and a method for producing a polyelectrolyte film using the same, which provides a polyelectrolyte composition comprising: at least one polyelectrolyte selected from Formulas 1 to 3; an acrylate-based material; a cross-linker; a photoinitiator; and a solvent. | 2021-12-02 |
20210371561 | FLUOROCOPOLYMERS FOR COATING APPLICATIONS - Disclosed are copolymers formed by copolymerization of: (1) one or more hydrofluoroolefin monomer(s) such as hydrofluoropropenes, (2) one or more of an alkyl vinyl ether monomer(s) that are not substituted with a reactive group, and (3) one or more reactive group substituted, lower alkyl vinyl ether monomer(s) wherein the copolymer has a MWn of from about 1000 to about 6000 grams/mole and other advantageous properties. | 2021-12-02 |
20210371562 | PRESSURE-SENSITIVE ADHESIVE SHEET FOR SEMICONDUCTOR PROCESSING - Provided is a pressure-sensitive adhesive sheet for semiconductor processing that appropriately protects a semiconductor wafer without reducing a yield. The pressure-sensitive adhesive sheet for semiconductor processing includes a pressure-sensitive adhesive layer and a base material. The pressure-sensitive adhesive sheet for semiconductor processing shows a warping amount of from 0 mm to 5 mm in an outer peripheral rib wafer heat warping evaluation, and shows a deflection amount of from 0 mm to 5 mm in an outer peripheral rib wafer deflection evaluation. | 2021-12-02 |
20210371563 | Polymer Composition and Use for Making Adhesive and Article Containing It - Polymer composition obtained from polymerization of C | 2021-12-02 |
20210371564 | HYDROGENATED STYRENE/CONJUGATED DIOLEFIN COPOLYMER, FOAMING MATERIAL THEREOF, AND APPLICATION THEREOF - Disclosed are a hydrogenated styrene/conjugated diolefin copolymer, a foaming material thereof, and application thereof. The copolymer contains a styrene structure unit and a hydrogenated conjugated diolefin structure unit; by taking the total content of the copolymer as a reference, the content of the styrene structure unit is 15-50 wt %, the content of 1,2-polymerization structure unit in the hydrogenated conjugated diolefin structure unit is 8-32%, the degree of randomness of the styrene structure unit in the hydrogenated conjugated diolefin structure unit is 30-80%, and the degree of hydrogenation of conjugated diolefin in the copolymer is 85-100%. The tensile strength at break of the hydrogenated styrene/conjugated diolefin copolymer is 30-60 MPa, the elongation at break is 300-600%, and the hardness (Shore A) is 70-98. Moreover, a foaming body having excellent performance including more than 60% rebound and less than 30% compression deformation can be manufactured by using a supercritical carbon dioxide foaming process. | 2021-12-02 |
20210371565 | CROSS-LINKED SBR MICROSPHERE BINDER AND PREPARATION METHOD THEREOF AND LITHIUM-ION BATTERY CONTAINING THE BINDER - A cross-linked SBR microsphere binder and a preparation method, and a lithium-ion battery containing the binder, the cross-linked SBR microsphere binder has a porous cross-linked structure, the cross-linked SBR microsphere has a particle size of 10 nm-1 μm, and a porosity of 0.01%-40%, and a pore diameter of the pore is greater than 0 and less than or equal to 200 nm. The lithium-ion battery containing the binder has advantages of better rate performance, low temperature performance, fast charge performance, and long cycle performance, compared with a lithium-ion battery containing a conventional SBR binder. | 2021-12-02 |
20210371566 | CHEMICAL COMPOSITIONS & METHODS OF PATTERNING MICROELECTRONIC DEVICE STRUCTURES - A chemical composition includes a polymer chain having a surface anchoring group at a terminus of the polymer chain. The surface anchoring group is metal or dielectric selective and the polymer chain further includes at least one of a photo-acid generator, quencher, or a catalyst. In some embodiments, the surface anchoring group is metal selective or dielectric selective. In some embodiments, the polymer chain includes side polymer chains where the side polymer chains include polymers of photo-acid generators, quencher, or catalyst. | 2021-12-02 |
20210371567 | ALKALI-SWELLABLE MULTI-FUNCTIONAL RHEOLOGY MODIFIERS - Alkali-swellable rheology modifier comprising a core-shell polymer comprising a core polymer and a shell comprising at least one shell copolymer layer at least partially cross-linked and containing a mole percent of crosslinking agent greater than the mole percent of crosslinking agent in the core polymer, provided if the mole percent of crosslinking agent in the core polymer is zero, then either the core polymer is greater than 60 wt % of the core-shell polymer; the core polymer comprises at least one associative monomer; at least one shell copolymer layer copolymer comprises at least one associative monomer; and/or the at least one shell copolymer layer that is at least partially cross-linked comprises greater than 3 mole % crosslinking agent. Aqueous compositions comprising the alkali-swellable rheology modifier include personal care formulations, healthcare formulations, agricultural formulations, paint formulations, coating formulations, laundry and fabric care formulations, household cleaning formulations, and industrial and institutional cleaning formulations. | 2021-12-02 |